Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214325.433ON20720710911e-153
KLTH0F16082g5.433ON2062077661e-104
SAKL0G02508g5.433ON2282086054e-79
CAGL0A02794g5.433ON2162065741e-74
KNAG0C049205.433ON2172065706e-74
Suva_2.5395.433ON2272085577e-72
YDR367W (KEI1)5.433ON2212065516e-71
KAFR0E039305.433ON2112075497e-71
NCAS0F033705.433ON2112075462e-70
TDEL0E019205.433ON2202075323e-68
Skud_4.6365.433ON2342115292e-67
Smik_4.6335.433ON2212065221e-66
TPHA0E017705.433ON2172074942e-62
Kpol_1062.305.433ON2142064837e-61
ZYRO0F10010g5.433ON2082054645e-58
AER256C5.433ON2392064589e-57
KLLA0E21099g5.433ON2242074561e-56
NDAI0B056605.433ON1611754372e-54
TBLA0A065205.433ON2062074193e-51
Ecym_47625.433ON2212194022e-48
TBLA0G020105.433ON2131903924e-47
Skud_1.88na 1ON20468663.6
NCAS0D040806.233ON1179114648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21432
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   424   e-153
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   299   e-104
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   237   4e-79
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   225   1e-74
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   224   6e-74
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   219   7e-72
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   216   6e-71
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   216   7e-71
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   214   2e-70
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   209   3e-68
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   208   2e-67
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   205   1e-66
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   194   2e-62
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   190   7e-61
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   183   5e-58
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   181   9e-57
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   180   1e-56
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   172   2e-54
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   166   3e-51
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   159   2e-48
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   155   4e-47
Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W (R...    30   3.6  
NCAS0D04080 Chr4 (766605..770144) [3540 bp, 1179 aa] {ON} Anc_6....    29   8.1  

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  424 bits (1091), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LKHRGFLRRWWIRAETHSYKICRRYLA
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  299 bits (766), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/207 (71%), Positives = 180/207 (86%), Gaps = 1/207 (0%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           MGVEIGLGIT+LNKCSGFYGILGLLTGH LDFMQWVLYLTS+ T++VYS+GL+++YKP +
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
            +Y+ +LLTFT DTL+TCFFTLWFSG WF+AK SEL+DP+S T Q+S G +S S  L++ 
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGS-KLLTA 119

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           RG+TLSSQSASQ TEYFFTILV++ AL +RFYFNFII+AFVQRL RHPKY+VDQDDV+QD
Sbjct: 120 RGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQD 179

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LKH+   +RWWIRAE  SY++C  YLA
Sbjct: 180 LKHKKLWQRWWIRAENWSYRVCHHYLA 206

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  237 bits (605), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 114/208 (54%), Positives = 149/208 (71%), Gaps = 1/208 (0%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+GLGI++ NK SGFYGIL L TGH LDFMQW  Y  S++T++VY  GL  I KP+ 
Sbjct: 21  IGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVYLSGLWQIRKPNP 80

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFS-AKNSELTDPNSTTLQSSAGNNSPSGNLIS 119
           L+YSL+L+ FT DTL+ CFFT+WFS QWFS  +N +      T+   SAG        ++
Sbjct: 81  LTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRALGPAKELN 140

Query: 120 KRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQ 179
           +R ++L+SQSASQG EY  T+L T+  LA RFYFNFI+ AFVQ++LRHPKY+VD+DDVEQ
Sbjct: 141 RRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQ 200

Query: 180 DLKHRGFLRRWWIRAETHSYKICRRYLA 207
           DLK++   RR  I++E   Y  C+R LA
Sbjct: 201 DLKNKSLFRRLCIKSEKWCYNACQRALA 228

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  225 bits (574), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 143/206 (69%), Gaps = 10/206 (4%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVEI LGIT+LNKCSG YGIL L TGH LD+MQW+ YL S+ T+IV+S GL  I+KP +
Sbjct: 20  LGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKL 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           + +S IL+ FT DT++TCFFTLWFS QWF + N E    + T+       N        +
Sbjct: 80  IVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEE---KHETSAPVGVSQN-------YR 129

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           R   L+SQ AS+  EY  T+L T+  L  R YFNFI+ +FVQ LLRHPKY+VDQDDVEQD
Sbjct: 130 RSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVEQD 189

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LK++  ++RWWI+++   YK+CR  L
Sbjct: 190 LKNKSAIKRWWIKSQKFCYKLCRHTL 215

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  224 bits (570), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 147/206 (71%), Gaps = 9/206 (4%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVEI LG+T+LNKCSG +GIL L TGH LD MQW  YL S+ T++VY+ GL  I+KP +
Sbjct: 20  IGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKL 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L++S I++ F+ DT++TC FTLWF+G WF+ +++  TD    T  S+          + K
Sbjct: 80  LTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESN--TDAAMGTAASAVAR-------LVK 130

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           RG  + +Q A++  EY FTI++T+ +L  R YFNF++ +FVQ LLRHP+Y+VDQDD+EQD
Sbjct: 131 RGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQD 190

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LK++ FLRRWW+ ++  SY ICR  L
Sbjct: 191 LKNKFFLRRWWVVSQKSSYSICRHVL 216

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  219 bits (557), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 108/208 (51%), Positives = 147/208 (70%), Gaps = 3/208 (1%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           + VEI LGI++LNKCSG YGIL L TGH LDFMQWV YL S+ T+IV++ GL  I+KP++
Sbjct: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNL 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKN--SELTDPNSTTLQSSAGNNSPSGNLI 118
           L +S I + +T DT+ TCFFTLWF+ QWF+ +   S + D +ST  Q+   N   +G L 
Sbjct: 80  LVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQTINYNPIATGKLT 139

Query: 119 SKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVE 178
           ++  DT S Q AS+  EY  TIL+T+ +L  RFYFNFI+ +FVQ LL HPKY+VD+DDVE
Sbjct: 140 ARSTDT-SGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVE 198

Query: 179 QDLKHRGFLRRWWIRAETHSYKICRRYL 206
           QDLK++   +R W +++   YK+C+  L
Sbjct: 199 QDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  216 bits (551), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 148/206 (71%), Gaps = 5/206 (2%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           + VEI LGI++LNKCSG YGIL L TGH LDFMQW+ YL S+ T+IV+S GL  I+KP++
Sbjct: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNL 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L +S I + +T DT+ TCFFTLWF+ QWF+ +++   D N+  LQS    N  S   +++
Sbjct: 80  LVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN-ALQS----NPISTGKLTE 134

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           RG  +S QSA++  EY  TIL+T+ +L  RFYFNFI+ +FVQ LL HPKY+VD+DDVEQ+
Sbjct: 135 RGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQN 194

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LK++   +R W +++   YK+C+  L
Sbjct: 195 LKNKPIWKRLWAKSQKGCYKLCKNLL 220

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  216 bits (549), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 141/207 (68%), Gaps = 15/207 (7%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           + VEI LGIT  NK SG +GIL L TGH L FMQWV YL S +T+ V++ GL  I+KP++
Sbjct: 20  LAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNI 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L++S I + ++ DTL  CFFTLWF+G WF+ ++           Q+ A      G+ I+K
Sbjct: 80  LTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVES-----------QTEAA----VGSTITK 124

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           R + +SSQ ASQG EY  TI +T+ +L  RFYFNFI+ +FVQ LLRHPKY+ DQDD+EQD
Sbjct: 125 RTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQD 184

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LK++   +RWW++ +   YK+C+  LA
Sbjct: 185 LKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  214 bits (546), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 138/207 (66%), Gaps = 18/207 (8%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVEI LGIT+ NKCSG YGIL L TGH LDF+QWV YL SI T+I+++ GL  I+KP++
Sbjct: 23  LGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTL 82

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L++S IL+ ++ DT+ TC FTLWF+ QWF       T+P  T               + +
Sbjct: 83  LTFSQILVFYSLDTICTCIFTLWFTSQWFQ------TEPTGTE------------EALQR 124

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           R ++L SQ A++  EY  TI +T+  L  R YFN ++ AFVQ LL HPKY+VDQDDVEQD
Sbjct: 125 RNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQD 184

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LK++   +RWWI+ +  SYK+C   LA
Sbjct: 185 LKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  209 bits (532), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 143/207 (69%), Gaps = 9/207 (4%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVEI LGI+++NKCSG YGIL L TGH LD MQWVLY+ SI T+I+   GL  I+KP+V
Sbjct: 23  IGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLIICVQGLYQIHKPNV 82

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L++S I +TF  DTL T FFTLWF+ QW++ +       NS  ++ +  + S +    S 
Sbjct: 83  LTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEG------NSNNVKDTKSSYSDAPVDYSS 136

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           +   ++ Q AS+G EY  T+ +TI +LA + YF FII +FVQ LL HP+Y++DQDDVEQD
Sbjct: 137 K---IAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQDDVEQD 193

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LKH+ F +RWWI+++   YK+ +  LA
Sbjct: 194 LKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  208 bits (529), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 103/211 (48%), Positives = 144/211 (68%), Gaps = 6/211 (2%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           + VEI LGI++LNKCSG YGIL L TGH LDFMQWV YL S+ T+IV+S GL  I+KP++
Sbjct: 24  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNL 83

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKN-----SELTDPNSTTLQSSAGNNSPSG 115
           L +S I + +T DT+ TCFFTLWF+ QWF+ +N     S       T L+++  +   +G
Sbjct: 84  LVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADTALRTNGLSPIMAG 143

Query: 116 NLISKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQD 175
            L ++  D  S QSA++  EY  TI +T+ +L  RFYFN I+ +FVQ LL HPKY+VD+D
Sbjct: 144 KLTARSADK-SGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRD 202

Query: 176 DVEQDLKHRGFLRRWWIRAETHSYKICRRYL 206
           DVEQDLK++   +R W +++   Y++C+  L
Sbjct: 203 DVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  205 bits (522), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 102/206 (49%), Positives = 139/206 (67%), Gaps = 5/206 (2%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           + VEI LGI++LNKCSG YGIL L TGH LDFMQWV YL S+ T+I++S GL  I+KP++
Sbjct: 20  LAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIFSQGLYLIHKPNL 79

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L +S I   +T DTL TCFFTLWF+ QWF+     L D        S  +N  S   ++ 
Sbjct: 80  LLFSQICALYTLDTLFTCFFTLWFTTQWFT-----LEDTAGGVASQSNNSNLISTERLTV 134

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
           R   +S QSA++  EY  TIL+T+ +L  RFYFN I+ +FVQ LL HPKY+VD+DDVEQ+
Sbjct: 135 RNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVDRDDVEQN 194

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LK++   +R + +++   YK+C+  L
Sbjct: 195 LKNKPIWKRLYAKSQKGCYKLCKNLL 220

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  194 bits (494), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 138/207 (66%), Gaps = 18/207 (8%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE  LGIT+ NKCSG YGIL L TGH L  +QWV YL S  T+++Y+ GL  ++ P++
Sbjct: 29  IGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNL 88

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L+Y  IL+T++ DT+ TCFFT++F   WF             T +S+AG+N  S   + K
Sbjct: 89  LTYCQILITYSFDTICTCFFTIYFCSHWF-------------TEESNAGDNINSSTTVDK 135

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
                 +Q AS+  E+F+T+ +T+ AL +RFYFNFI+ +F Q+L  HPKY++DQDDVEQD
Sbjct: 136 Y-----NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQD 190

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           LK++  + +WWI+++   Y   +R+LA
Sbjct: 191 LKNKSIIVQWWIKSKKRCYYTSKRFLA 217

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  190 bits (483), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 132/206 (64%), Gaps = 21/206 (10%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE  LGIT+LNKCSG YGIL L TGH L+  QWV YL S+ T+I+YS GL  ++ PS+
Sbjct: 29  IGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSL 88

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L+YS I + F+ DT +TC FT+ FS QWF+   S ++D                G+ + +
Sbjct: 89  LTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSD----------------GSGVDE 132

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
            G     Q AS+  EY FTIL+T+ AL +R YFNFI+ AF Q L  HPKY+VD DDVEQD
Sbjct: 133 YG-----QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQD 187

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LK++  + +WWI+++   Y + R  L
Sbjct: 188 LKNKNKIVQWWIKSKKSCYNLARHIL 213

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  183 bits (464), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 129/205 (62%), Gaps = 21/205 (10%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LG+T+LNKCSG +GIL L TGH L+F+QWVLYL SI + +VY+ GL +  KPS+
Sbjct: 19  IGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSL 78

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
           L +S I + F+ DT +TC FTLWF+ QW++ +                 +N+P+   I+ 
Sbjct: 79  LVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLE-----------------DNTPTQKSIAA 121

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
                 +Q ASQ  E+  TI +T+ +L  R YFNF++ +FVQ LL+HP+Y+VD  DVEQ+
Sbjct: 122 AAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQE 181

Query: 181 LKHRGFLRRWWIRAETHSYKICRRY 205
           L+ +   +R W R +      C RY
Sbjct: 182 LRTQPVWKRVWTRTQIR----CLRY 202

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  181 bits (458), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 132/206 (64%), Gaps = 6/206 (2%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LGI + NK  G +G+L L TGH LD +QW+ YL S +T++VY  GL  IY+P +
Sbjct: 40  IGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRL 99

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
            +Y L+L+ ++TDT++TC +TLWF+  WF   +  +T   +T  +  A     S   ++ 
Sbjct: 100 AAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVT---ATAKEDDADATQGS---VTV 153

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
             + +S QSAS+  EY FT+  T+FAL+ RFY NF+I +FVQR+ +H K+    DDVEQD
Sbjct: 154 ENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQD 213

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206
           LKH+    R + + +   Y +CRRYL
Sbjct: 214 LKHKSVAYRAYAKMQRWCYFLCRRYL 239

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  180 bits (456), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 131/207 (63%), Gaps = 4/207 (1%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LG+   NK SG YG+L L TGH LDF+QW  Y+ SI  ++V+  G+  +YKP++
Sbjct: 21  IGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNI 80

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNS-ELTDPNSTTLQSSAGNNSPSGNLIS 119
           L  S +   F+ DT+V+C + LWF+  WFS + S ++TD  S        +   +   IS
Sbjct: 81  LLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGPAHEGTTST-IS 139

Query: 120 KRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQ 179
            + DT  S+SAS G E+F  IL+T+  LA RFYFNFII+AF Q+LLR  K+  DQ+D+E 
Sbjct: 140 TKVDT--SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEV 197

Query: 180 DLKHRGFLRRWWIRAETHSYKICRRYL 206
           +L +R  L +W  + E   + +C+RYL
Sbjct: 198 NLHNRNILFKWRYKFEKWCFYLCKRYL 224

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  172 bits (437), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 117/175 (66%), Gaps = 14/175 (8%)

Query: 33  MQWVLYLTSIITVIVYSVGLSSIYKPSVLSYSLILLTFTTDTLVTCFFTLWFSGQWFSAK 92
           MQWV YL SI  +I+++ GL  I+KP++L++S I + FT DTL TCFFTLWF+ QWF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 93  NSELTDPNSTTLQSSAGNNSPSGNLISKRGDTLSSQSASQGTEYFFTILVTIFALATRFY 152
             E      + +Q+S G        + KR  +L+SQ A+ G EYF T+L+T   L  RFY
Sbjct: 61  EGE------SAVQTSTG--------VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFY 106

Query: 153 FNFIIMAFVQRLLRHPKYVVDQDDVEQDLKHRGFLRRWWIRAETHSYKICRRYLA 207
           FN I+ +FVQ LL +PK+++DQDDVEQDLK++  ++RWWI+ E   Y++C+  L+
Sbjct: 107 FNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  166 bits (419), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 127/207 (61%), Gaps = 27/207 (13%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LGIT+ NKC G YGIL L  GH L+F QWVLY  SI+ + +Y+ GL+ +++P++
Sbjct: 27  LGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTL 86

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
            ++S + + F+ DTL+TC FT++F+ +WF+A        N+TT   +A            
Sbjct: 87  YTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA--------NTTTRPPAA------------ 126

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
                  Q AS   EY  ++LVT+ +L +R YFNFI+ +F+Q L   P Y +D D+VE +
Sbjct: 127 -------QGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETE 179

Query: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207
           L+H   LRR W++ + + Y + RR L+
Sbjct: 180 LRHSSLLRRLWLQNQHYCYILSRRILS 206

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  159 bits (402), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 126/219 (57%), Gaps = 25/219 (11%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LG+ + NK  G YGIL L TG  LD +QW  Y+ S   ++V++ GLS +YKP +
Sbjct: 15  IGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKL 74

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLI-- 118
           ++Y ++L  ++ DT++ CFF + F+G WFS ++            +S+G+N  SG  I  
Sbjct: 75  MTYCMVLTVYSLDTVLACFFAVLFTGDWFSKED------------TSSGSNPVSGKGIGV 122

Query: 119 -----------SKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRH 167
                      + R     +QSAS   EY  TIL+T+   A RFY NFII +FV+R+++ 
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 168 PKYVVDQDDVEQDLKHRGFLRRWWIRAETHSYKICRRYL 206
            +Y+ + DDVE DLK+     R ++  +   Y  CRRYL
Sbjct: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  155 bits (392), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 119/190 (62%), Gaps = 13/190 (6%)

Query: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60
           +GVE+ LGI +LNKCSGFYGIL L TGH L  +QW+ Y+ SI T+++Y+ G+  I KP+V
Sbjct: 25  LGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNV 84

Query: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120
             +S I   F+ DT+ T F TL+F+  WFS+ +S     NS  LQ +  +   S      
Sbjct: 85  YLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENS--LQRTEKDIELS------ 136

Query: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180
                  Q AS   E F  ++VT+F L +R Y+N ++ +F+ +L  +PK+++DQDDVE D
Sbjct: 137 -----QKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191

Query: 181 LKHRGFLRRW 190
           LK++ F +++
Sbjct: 192 LKNKSFFKKF 201

>Skud_1.88 Chr1 (159215..159829) [615 bp, 204 aa] {ON} YGL053W
          (REAL)
          Length = 204

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 26 TGHHLDFMQWVLYLTSIITVIVYSVGLSSIYK-PSVLSYSLILLTFTTDTLVTCFFTLWF 84
            H+   M WVL + S+I +IV+   +    + P+VL++ ++L++        CFF +  
Sbjct: 20 AAHYRPIMGWVLTVVSLILLIVFLYCVKDCVRLPAVLAFFILLISIYP----LCFFRMRV 75

Query: 85 SGQWFSAK 92
          + + F  K
Sbjct: 76 NDRDFEIK 83

>NCAS0D04080 Chr4 (766605..770144) [3540 bp, 1179 aa] {ON} Anc_6.233
           YGL133W
          Length = 1179

 Score = 29.3 bits (64), Expect = 8.1,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 49/114 (42%), Gaps = 9/114 (7%)

Query: 83  WFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGN-------LISKRGDTLSSQSASQGTE 135
           +F G+    + ++ T  NSTT   ++ +NS +G        LI       ++ + +  T 
Sbjct: 118 FFPGEIVFLRRNKETTQNSTTSNGNSTSNSQNGTPQPPIEYLIEPGPPGSNTTTPNNATS 177

Query: 136 YFFTILVTIFALATRFYFNFIIMAFVQRLL--RHPKYVVDQDDVEQDLKHRGFL 187
               +    + +  +  FN  I    Q +L   H KY++ +DD E    ++ F+
Sbjct: 178 QSHHLAQKPYIIKEKVQFNPTIDPVTQEVLVPGHAKYMLVEDDAESSSNNKSFV 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,716,937
Number of extensions: 890326
Number of successful extensions: 4654
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4751
Number of HSP's successfully gapped: 38
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)