Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214265.434ON30830816510.0
KLTH0F16060g5.434ON30930912591e-175
Kwal_47.18084na 1ON30930310211e-139
KLTH0E15532gsingletonON30930310171e-139
SAKL0G02530g5.434ON3123089921e-135
NDAI0C016005.434ON3133099401e-127
CAGL0I01100g5.434ON3103049351e-126
Suva_2.5405.434ON3123089351e-126
Suva_8.1735.434ON3123099321e-126
YDR368W (YPR1)5.434ON3123089221e-124
Smik_15.2985.434ON3123099191e-124
KLTH0A03476gna 1ON3083049191e-124
TDEL0E019105.434ON3113079181e-124
KAFR0E03850singletonON3113089141e-123
Skud_4.6375.434ON3123089111e-123
Skud_15.2835.434ON3123099111e-122
YOR120W (GCY1)5.434ON3123099081e-122
Smik_4.6345.434ON3123089001e-121
NCAS0H020605.434ON3223038911e-119
TBLA0A02825singletonON3113008871e-119
KNAG0C049105.434ON3133108801e-118
Kpol_1062.295.434ON3113058711e-116
NCAS0F033805.434ON3133098691e-116
CAGL0A02816g5.434ON3103048641e-115
TPHA0E017605.434ON3103048611e-115
TPHA0G00210singletonON3113018451e-112
KLLA0B14707gsingletonON3102958391e-112
KAFR0E038405.434ON3103088391e-112
ZYRO0F10032g5.434ON3102958381e-111
KLTH0E00220gsingletonON3063018261e-110
KLTH0A00528gsingletonON3063018261e-110
TDEL0D00230singletonON3123018241e-109
TBLA0A065105.434ON3123088051e-106
TBLA0A02835singletonON3113077871e-104
NDAI0B056705.434ON3183027871e-103
KLLA0D10109gsingletonON3092997811e-103
AER401W5.434ON3133037494e-98
NDAI0A070003.108ON3202925506e-68
KLLA0F02728g3.108ON3302975342e-65
YBR149W (ARA1)3.108ON3443035082e-61
SAKL0C10626gsingletonON3222945028e-61
KAFR0G013503.108ON3242935028e-61
NCAS0I024203.108ON3202905011e-60
ZYRO0B06138g3.108ON3283114984e-60
Smik_2.2883.108ON3443024994e-60
Smik_2.289singletonON3443034951e-59
Kwal_56.226113.108ON3212964922e-59
Skud_2.2763.108ON3443034901e-58
KLTH0C10010g3.108ON3213074853e-58
SAKL0C09922g3.108ON3222964844e-58
Suva_4.3983.108ON3443034856e-58
KNAG0K020703.108ON3232974732e-56
TDEL0D051603.108ON3252864645e-55
ACL107C5.409ON3543044142e-47
NCAS0A066605.409ON3263164105e-47
KNAG0B03780singletonON3263074071e-46
NDAI0D016005.409ON3273214035e-46
KLLA0E21627g5.409ON3293193992e-45
TPHA0E018605.409ON3263033983e-45
Ecym_55085.409ON3263063941e-44
CAGL0I01122g5.409ON3263173941e-44
TBLA0A00630singletonON3282913913e-44
TBLA0F01720singletonON3263063904e-44
SAKL0G01914g5.409ON3293243904e-44
KLTH0F16610g5.409ON3293093905e-44
KAFR0C05320singletonON3273273852e-43
Ecym_7160na 2ON2712793803e-43
TDEL0E021505.409ON3293053826e-43
Skud_8.1655.409ON3273223801e-42
ZYRO0A06336g5.409ON3273153703e-41
CAGL0C04543g7.468ON2872743641e-40
YHR104W (GRE3)5.409ON3273213652e-40
Kwal_47.18893na 3ON2892873622e-40
YJR096W7.468ON2822803603e-40
Smik_8.1825.409ON3273213634e-40
KAFR0G009207.468ON2862793561e-39
Suva_15.3005.409ON3273213582e-39
KLLA0F03256g7.468ON2852753501e-38
Skud_10.3187.468ON2822763491e-38
NCAS0H005607.468ON2842763483e-38
KNAG0D013707.468ON2822733473e-38
SAKL0F14278g7.468ON2862753473e-38
Smik_10.3847.468ON2822803464e-38
KLTH0G02420gna 3ON2892883465e-38
KLTH0F01892gna 4ON3022803467e-38
Suva_12.1847.468ON2822803394e-37
ZYRO0G17600g7.468ON2832893387e-37
Kwal_55.215365.409ON3292893401e-36
Kpol_1013.827.468ON2852863343e-36
ABL209Cna 2ON3103003336e-36
KLTH0G05786g7.468ON2862753264e-35
TDEL0C033207.468ON2832763221e-34
Skud_4.1317.285ON3123153223e-34
Kwal_47.19278na 5ON3143053223e-34
Kwal_33.13276na 4ON3022773196e-34
Smik_4.1137.285ON3123153172e-33
KLLA0F05775g7.285ON3093033162e-33
CAGL0J09394g7.285ON3113113135e-33
Kwal_47.182197.468ON2932873091e-32
NCAS0A137407.285ON3093063101e-32
YDL124W7.285ON3123153065e-32
KAFR0B012007.285ON3153203066e-32
NDAI0A023007.285ON3133153066e-32
SAKL0F02574gna 3ON2892903021e-31
KLTH0G00638gna 5ON3133062971e-30
TDEL0D02790singletonON3293172945e-30
SAKL0F00704gna 5ON3153052892e-29
KNAG0C041107.285ON3113192865e-29
ZYRO0C09196g7.285ON3123062847e-29
ZYRO0E09614gna 5ON3083052785e-28
Kpol_381.8singletonON3093152733e-27
Kpol_1020.137.285ON3133232724e-27
SAKL0F09746g7.285ON3123062691e-26
TBLA0F019807.285ON3023162435e-23
Ecym_32647.285ON3113152154e-19
Kwal_33.13274singletonON108771552e-12
Suva_4.1227.285ON2062021064e-05
Suva_14.10na 6ON376109780.26
Kpol_449.4singletonON341331760.39
KAFR0D04230singletonON34247760.50
YCR107W (AAD3)singletonON363104740.82
NCAS0A129502.604ON32382721.3
NDAI0I01760na 7ON339332702.2
KAFR0J00220singletonON34358702.2
ACR244C1.202ON30051693.4
CAGL0I01584g1.468ON72283693.5
CAGL0E05214gsingletonON34658693.6
NCAS0A03110singletonON34499675.0
NCAS0F04070singletonON34458667.4
ZYRO0F04840gsingletonON37983659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21426
         (308 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   640   0.0  
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   489   e-175
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   397   e-139
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   396   e-139
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   386   e-135
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   366   e-127
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   364   e-126
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   364   e-126
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   363   e-126
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   359   e-124
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   358   e-124
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   358   e-124
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   358   e-124
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     356   e-123
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   355   e-123
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   355   e-122
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   354   e-122
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   351   e-121
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     347   e-119
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     346   e-119
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   343   e-118
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   340   e-116
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     339   e-116
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   337   e-115
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   336   e-115
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 330   e-112
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   327   e-112
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   327   e-112
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   327   e-111
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   322   e-110
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   322   e-110
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   322   e-109
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   314   e-106
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     307   e-104
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   307   e-103
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   305   e-103
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   293   4e-98
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   216   6e-68
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   210   2e-65
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   200   2e-61
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   197   8e-61
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   197   8e-61
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   197   1e-60
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   196   4e-60
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   196   4e-60
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   195   1e-59
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   194   2e-59
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   193   1e-58
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   191   3e-58
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   191   4e-58
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   191   6e-58
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   186   2e-56
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   183   5e-55
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   164   2e-47
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             162   5e-47
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               161   1e-46
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               159   5e-46
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   158   2e-45
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   157   3e-45
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   156   1e-44
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   156   1e-44
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     155   3e-44
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     154   4e-44
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   154   4e-44
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   154   5e-44
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   152   2e-43
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   150   3e-43
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   151   6e-43
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   150   1e-42
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   147   3e-41
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   144   1e-40
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   145   2e-40
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   144   2e-40
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   143   3e-40
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   144   4e-40
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   141   1e-39
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   142   2e-39
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   139   1e-38
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   139   1e-38
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   138   3e-38
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   138   3e-38
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   138   3e-38
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   137   4e-38
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   137   5e-38
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   137   7e-38
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   135   4e-37
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   134   7e-37
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   135   1e-36
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   133   3e-36
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   132   6e-36
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   130   4e-35
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   128   1e-34
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   128   3e-34
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   128   3e-34
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   127   6e-34
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   126   2e-33
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   126   2e-33
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   125   5e-33
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   123   1e-32
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   124   1e-32
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   122   5e-32
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   122   6e-32
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     122   6e-32
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   120   1e-31
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   119   1e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     117   5e-30
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   115   2e-29
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   114   5e-29
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   114   7e-29
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   111   5e-28
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   109   3e-27
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   109   4e-27
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   108   1e-26
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...    98   5e-23
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    87   4e-19
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    64   2e-12
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    45   4e-05
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    35   0.26 
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    34   0.39 
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    34   0.50 
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    33   0.82 
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    32   1.3  
NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON}               32   2.2  
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      32   2.2  
ACR244C Chr3 complement(789953..790855) [903 bp, 300 aa] {ON} Sy...    31   3.4  
CAGL0I01584g Chr9 complement(125729..127897) [2169 bp, 722 aa] {...    31   3.5  
CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {...    31   3.6  
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    30   5.0  
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    30   7.4  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    30   9.3  

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/308 (100%), Positives = 308/308 (100%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
           VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKS 180
           QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKS
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKS 180

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
           PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL
Sbjct: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN
Sbjct: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300

Query: 301 PPWFSFEE 308
           PPWFSFEE
Sbjct: 301 PPWFSFEE 308

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  489 bits (1259), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 264/309 (85%), Gaps = 1/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           MT +LKKCTATA LNTGA+IPLLGLGTWR TKE GY A LAA+KAGYRHID AAVCMNEQ
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
           V+G+AIRDSGV R+ELFVTTKLW TQHRDP  AL QSLKRLGL+YVDLYMMHWP+AFR +
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLK 179
           Q+K  N+MLIP+  +G+P VD  WDYVKTWELMQ+LP T KT A+GVANFSV QL  L+ 
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           SP NKI+PAASQLETHPFLP ++ML+FC++  ILMEAYSPLG +G PL+DEPV+REISKK
Sbjct: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
           LHVEPAQLL+SWGL+RG AVL KSKT +RIE+NL  FD+ + D  RI+E+AQERG KR H
Sbjct: 241 LHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIH 300

Query: 300 NPPWFSFEE 308
           NP WFSFEE
Sbjct: 301 NPTWFSFEE 309

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 235/303 (77%), Gaps = 1/303 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           LK  T    LNTGA IPLLG GTWR T+E GY A+L+A+K GYRHIDSAAV  NE  +G+
Sbjct: 4   LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGR 63

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           AIRDSGV R+ELFVTTKLW+TQ R+P+ ALDQSL+RLGL+YVDLY++HWPL  + D+I  
Sbjct: 64  AIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDRITD 123

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNN 183
            N   IP   +GKP VDT+WDY+KTW+LMQ+LP T KTRA+GV+N SV QL  LL    N
Sbjct: 124 GNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGN 183

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K++PA  Q+ETHP LP +++L FC +  IL+EAYSPLG  G PLIDEPVI+EI+KK + +
Sbjct: 184 KVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNAD 243

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303
           PAQ++ISW +KRG  VLPKS T +RI+SNL+  DL DED+E+I+++  E+G KR ++P W
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVNDPEW 303

Query: 304 FSF 306
           F+F
Sbjct: 304 FTF 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  396 bits (1017), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 229/303 (75%), Gaps = 1/303 (0%)

Query: 7   KCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI 66
             +A   L TGA IPLLG GTWR T+E GY A+L ALK GYRHID+AAV  NE  +G+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  RDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKN 126
           RDSGV RD+LFVTTKLW+TQHRDP  ALDQSL+RLGL+YVDLY++HWPL  R  +I   N
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 FMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKI 185
              +P   +GKP VD  W YVKTWE+MQ LP T KTRA+GV+NFSV QL +LL +   K+
Sbjct: 126 LFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTKV 185

Query: 186 IPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPA 245
           IPA +Q+ETHP LP D++  FC E  IL+EAYSPLG  G PL++EP ++EI+ K + +PA
Sbjct: 186 IPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADPA 245

Query: 246 QLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWFS 305
           Q+LISWG+KRG  +LPKS T +RIESN ++ DL+D+D+ +I+ I +E+G KR ++P WF 
Sbjct: 246 QVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWFH 305

Query: 306 FEE 308
           F+E
Sbjct: 306 FDE 308

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  386 bits (992), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 237/308 (76%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+  LK  +AT  LNTGA IP LGLGTWR + E  Y ++L+A+K GYRHIDSAA+  NE+
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKAIRDSGV R+ELFVTTKLW TQ R+P  ALD SLKRLGL+YVDLY++HWP+AF+ D
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK  +++ +P   +GK  VD  DW++VKTWEL+Q+LP T K +A+GV+NFSV  L  LL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            SP NK++PA +Q+E HP LP DE++ F + KGI++EAYSPLG +G PL+ EPVI E++K
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  VEPAQ+LI+WG++RG  +LPKS    R+ESN +VFDLS ED +RIH+I++E+G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 299 HNPPWFSF 306
            +P W SF
Sbjct: 301 VHPDWPSF 308

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 172/309 (55%), Positives = 233/309 (75%), Gaps = 3/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEG-GYKAILAALKAGYRHIDSAAVCMNE 59
           M   LK  TAT  LNTGA IP +GLGTW+ T E  GY+A++ ALKAGYRHID+AA+  NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
             +GKAI DSG+ R+E+FVTTKLW TQHRDP  AL+QSL+RLGL+YVDLY+MHWP+AF+ 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 DQIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSL 177
           D IK  N+  +P    G+  +D T W++VKTWELMQ+LP T KTRA+GV+NFS+  L +L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREIS 237
           L SP NK++PAA+Q+E HP LP DE+  FC+EKGI++EAYSPLG    P++ EP I EI+
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 238 KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297
           KK +V+PAQ++ISW +++G  VLPKS  + RI++N + F+LS ++ + ++ +++E+G +R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 298 THNPPWFSF 306
              P W  F
Sbjct: 301 IVQPNWAPF 309

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 220/304 (72%), Gaps = 1/304 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           L K T+T  LNTGA IP++GLGTW+ ++  GY A L ALKAGYRHID+AA+  NE+ IG+
Sbjct: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           AIRDS + R+ELFVTTKLW TQHR+P+ ALDQSLKRLGL+YVDLY+MHWP+A + D IK 
Sbjct: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123

Query: 125 KNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKSPNN 183
            N + IP   +G   VD  DW++VKTWELMQ+LP EK RAIGV+NFS+  L  LL S  N
Sbjct: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSKGN 183

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K++PAA+Q+E HP LP DE++ FC+EKGI++EAYSPLG    P++ E  I EI+KK  V 
Sbjct: 184 KVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVN 243

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303
             QL+ISW  +RG  VLPKS    RI  N E F LSDED+  +   A++ G +R  +P W
Sbjct: 244 AGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNW 303

Query: 304 FSFE 307
             F+
Sbjct: 304 GPFK 307

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 228/308 (74%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   LK  +AT  LNTGA IP+LG GTWR     GY +++AALKAGYRHID+AA+ +NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKAI+DSGV R+E+F+TTKLW T+ RDP AALD+SLKRLGL+YVDLY+MHWP+  + D
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            I   +F+ IP   +G   VDT +W++VKTW+LMQKLP T KT+A+GV+NFS+  +  LL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
           KSP+NK++PA +Q+E HP LP DE++AFC+EKGI++EAYSP G    PL+ E  I +++K
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  VEPAQL+ISW ++RG  VL KS    R+ SN ++F L ++D++ I  +++  G KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 299 HNPPWFSF 306
            N  W SF
Sbjct: 301 VNMQWNSF 308

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 172/309 (55%), Positives = 229/309 (74%), Gaps = 2/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+  L+  T T  LNTGAKIP +GLGTW+      YK+++AALK GYRHID+AA+  NE 
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV R+E+FVTTKLW TQH +P+ ALDQSLKRLGL+YVDLY+MHWP+    +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK  + + IP   +G   VD T+W+++KTWELMQ+LP T KTRA+GV+NFS+  L  LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            SP N++ PAA+Q+E HP LP +E++ FC+ KGI++EAYSPLG    PL+ EPV+ EI+K
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K +V+P  ++ISW  +RG  VLPKS    RI++N +VF LSDED+E I+ I++E+G KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 299 HNPPWFSFE 307
            NP W  FE
Sbjct: 301 VNPDWSPFE 309

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 228/308 (74%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   LK  +AT  LNTGA IP+LG GTWR     GY +++AALKAGYRHID+AA+ +NE+
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV R+E+F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + D
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
           ++   N + IP   +G   +DT +W+++KTWELMQ+LP T KT+A+GV+NFS+  +  LL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
           +SPNNK++PA +Q+E HP LP DE++AFC+EKGI++EAYSP G    PL+ E  I +++K
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  VEPAQL+ISW ++RG  VL KS    RI SN ++F L ++D++ I  +++  G KR 
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 299 HNPPWFSF 306
            +  W SF
Sbjct: 301 VDMKWGSF 308

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  358 bits (919), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 229/309 (74%), Gaps = 2/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+  L   T T +LNTGA+IP +GLGTW+      YK++LAALKAGY+HID+AA+  NE 
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV R+E+FVTTKLWSTQH +P+ ALD+SL+RLGL+YVDLY++HWP     +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK  + + +P  ++G   VD T+W+++KTWELMQ+LP T KT+AIGV+NFS+  L  LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            SP NK+ PAA+Q+E HP LP +E++ FC+ K I++EAYSPLG    PL+ EP I +I+K
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K +V+P  ++ISW  +RG  VLPKS    RIE+N ++F LS+ED+E I+ I++E+G KR 
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 299 HNPPWFSFE 307
            NP W  FE
Sbjct: 301 VNPNWSPFE 309

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  358 bits (919), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 224/304 (73%), Gaps = 2/304 (0%)

Query: 6   KKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKA 65
           K  T+   LNTGA IPL+GLGT+    E GYKA+L A+K GYRHID AA+  NE  +G+A
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAK 125
           IRDSGV R+ELFVTTK+W+TQHR+P+ AL++SL RLGL+YVDL++MHWP A R ++I   
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLKSPNNK 184
           N + +P+  + KP VDT+W+Y+KTW LMQ LP   KT+A+GV+NFSV QL  LL  P +K
Sbjct: 125 NMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGSK 184

Query: 185 IIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEP 244
           ++PA +Q+E HP LP   +  FC++K I++ AYSPLG    PL+D+PVI EI+ K   +P
Sbjct: 185 VVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKADP 244

Query: 245 AQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWF 304
           AQ++I W +KRG   LPKS T +RIESNL++ +L+D + E+I+EI  ++G KR  +P WF
Sbjct: 245 AQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEI-HKKGEKRVVDPEWF 303

Query: 305 SFEE 308
            FEE
Sbjct: 304 DFEE 307

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 222/307 (72%), Gaps = 1/307 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+  L   T+T  LNTG  IP +GLGTWR  +  GYKA+ AALKAGYRHID AA+ +NE+
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKAIRDSG+ R+ELF+TTKLW+TQ R+P  AL+QSL+RLGLEYVDLY+MHWP+  +  
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLK 179
           +I   N +  P   +GKP VDT+WD+VKTWELMQ+LP T+K R++GV+NFS+  L  LL 
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           SP NK++PA  Q+E HP LP   +  FC+E  I +EAYSPLGG G P++D+P+I++I+ +
Sbjct: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
            + +   +++SWG++RG   LPKS T  R+ SNL  F LSDE+   I+ +++ RG KRT+
Sbjct: 241 HNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTN 300

Query: 300 NPPWFSF 306
            P    F
Sbjct: 301 APDMSPF 307

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 168/308 (54%), Positives = 227/308 (73%), Gaps = 1/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEG-GYKAILAALKAGYRHIDSAAVCMNE 59
           M   L+  T T  LNTGA +P+LGLGTWR T +  GY A+ +AL+AGYRHID+AA+  NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
           +V+G+AIR+SG+ RDE+FVTTKLW TQHRDP+AALDQSL+RLGL+YVDLY+MHWP+    
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLK 179
              K+ + +  P   +G   V++DWD++KTWELMQ+LP  KTRAIGV+NFS+  +  LLK
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVESDWDFIKTWELMQELPKTKTRAIGVSNFSINNINDLLK 180

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           SP NKI+PAA+Q+E HP LP  E++ FC+EKGI++EAYSP G    PL+ E  I E++KK
Sbjct: 181 SPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKK 240

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
             V  AQ+++SW +KRG AVLPKS  + R+ SN + F L ++D+  I+ +++E+G KR  
Sbjct: 241 HDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVV 300

Query: 300 NPPWFSFE 307
           N  W  F+
Sbjct: 301 NFDWSPFK 308

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  355 bits (911), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 226/308 (73%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   L+  +AT  LNTGA IP LG GTWR     GY +++AALK GYRHID+AA+ +NE+
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSG+ R+E+F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + D
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            +   N + IP   +G   VDT +W+++KTW+LMQ+LP T KTRA+GV+NFS+  +  LL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
           KSP+NK++PA +Q+E HP LP DE++AFC+EKGI++EAYSP G    PL+ E  I +++K
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  VEP+QL+ISW ++RG  VL KS    R+ SN ++F L ++D++ I ++++  G KR 
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 299 HNPPWFSF 306
            N  W SF
Sbjct: 301 VNMKWASF 308

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 226/309 (73%), Gaps = 2/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   L+  T T +LNTGA+IP +GLGTW+      YK++LAALK GYRHID+AA+  NE 
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AIRDSGV R+++FVTTKLW TQH +P+ ALDQSL+RLGL+YVDLY+MHWP+    D
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK  N + +P   +G   VD T+W+++KTWELMQ+LP T K +A+GV+NFS+  L  LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            S  NK+ PAA+Q+E HP LP +E++ FCR KGI++E YSPLG    PL+ EPVI EI+K
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K +V+PA ++ISW  +RG  VLPKS    R+++N ++F LSDED+E I+ I++ +G KR 
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 299 HNPPWFSFE 307
            +P W  FE
Sbjct: 301 VHPNWSPFE 309

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 224/309 (72%), Gaps = 2/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   L   T   +LNTGA+IP +GLGTW+  +   YKA+L ALK GYRHID+AA+  NE 
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV R+E+FVTTKLW TQH +P  ALDQSLKRLGL+YVDLY+MHWP      
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 QIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK ++ + +P   +G   VD T+W+++KTWELMQ+LP T KT+A+GV+NFS+  L  LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            S  NK+ PAA+Q+E HP LP DE++ FC+ KGI++EAYSPLG    PL+ EPVI EI+K
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K +V+P  ++ISW ++RG  VLPKS    RI++N ++F LS ED+E I+ I++E+G KR 
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 299 HNPPWFSFE 307
            +P W  FE
Sbjct: 301 VHPNWSPFE 309

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 230/308 (74%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   LK  +A+  LNTGA IP+LG GTWR  +  GY +++AALKAGYRHID+AA+ +NE+
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV R+++F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + +
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            I   N + IP   +G   VDT +W+++KTW+LMQ+LP T KT+A+GV+NFS+  + +LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
           +SP+NK++PAA+Q+E HP LP +E++AFC+EKGI++EAYSP G    PL++E  I +++K
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  V PAQL+ISW ++RG  VL KS    RI SN ++F L ++D++ I  +++  G KR 
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 299 HNPPWFSF 306
            +  W SF
Sbjct: 301 VDMKWSSF 308

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 169/303 (55%), Positives = 219/303 (72%), Gaps = 3/303 (0%)

Query: 7   KCTATATLNTGAKIPLLGLGTWRLTKEG-GYKAILAALKAGYRHIDSAAVCMNEQVIGKA 65
             T T  LNTGA I  +GLGTW+ T E  GY+A++AALKAGYRHID+AA+  NE  +GKA
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAK 125
           I DSGV R+E+FVTTKLWSTQH DP+A L+ SLKRLGL+YVDLY+MHWP+      IK  
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 NFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNN 183
           NF+ IP   +GK  V+ D WDYVKTWELMQ+LP T KTRA+GV+NFS+  L  +L SP N
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K++PA +Q+E HP LP +E+L +C  KGIL+EAYSPLG    P++ EPV+  ++KK  V+
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303
            AQ++ISW ++RG  VLPKS    RI++N +   LSDE+   I+ I++E+G +R   P W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 304 FSF 306
             F
Sbjct: 316 EPF 318

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 218/300 (72%), Gaps = 3/300 (1%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+  LK CTAT  LNTGA IP +GLGTWR     GY +++AA K GYRHID+AA+  NE 
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKAI + GV R ELFVTTKLW TQ RDP  AL+QSLKRLGL+YVDLY++HWP+AF+ D
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLL 178
            IK  N + IP+  +G+  +D  +W+++KTWELMQ  L T KT+AIG++NFS+  +  LL
Sbjct: 121 TIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            +P   + PA +Q+E HP LP DE++AFC+EKGI++EAYSPLGG   P++ +  I EI+K
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           + +V+  Q++ SW ++RG  VLPKS  ++RI SNL+ F LSD+D  +I+ + + +G  RT
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  343 bits (880), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 170/310 (54%), Positives = 222/310 (71%), Gaps = 3/310 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNE 59
           M+  L K T+   LNTGA I  +GLGTWR       Y +++AAL+AGYRHID+AA+  NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
             +G+AIR+SGV R E+FVTTKLW TQH++P  ALDQSLKRLGL+YVDLY+MHWP+  R 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 DQIKAKNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSL 177
           + +   + +  P    GK  +D TDW++VKTWELMQKLP T KTRAIGV+NFS+  L  L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREIS 237
           L SP NKI+PAA+Q+E HP LP  E++ FC  KGI++EAYSPLG    P++ EPVI EI+
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 238 KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297
           KK  V  AQ++ISW ++RG  VLPKS  + RIE+NL  F L+ ED+E ++ I++ +G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 298 THNPPWFSFE 307
             +P W  F+
Sbjct: 301 IIDPDWEPFK 310

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/305 (52%), Positives = 220/305 (72%), Gaps = 3/305 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           LK C     LNTGA++P +GLGTW+  +   YKA+L ALK GYRHID AA+  NE  +GK
Sbjct: 3   LKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVGK 62

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIK- 123
           AIRDSGV R+E+FVTTKLW TQ R P  AL+QSL+RLGL+YVDLY++HWP+     Q + 
Sbjct: 63  AIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCEE 122

Query: 124 AKNFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSP 181
           + N++  P    GK  VD D W++VKTWELMQ+LP T K +A+GV+NFS+  +  LL SP
Sbjct: 123 SGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSSP 182

Query: 182 NNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLH 241
            NK++PA +Q+E HP LP  E++ FC+EKGI++EAYSPLGG G  ++ EP++ E++KK +
Sbjct: 183 GNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKYN 242

Query: 242 VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNP 301
           +  A L++SW ++RG  VLPKS T++RI SNL+   L+ ED E+I  +++E+G KRT  P
Sbjct: 243 IPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCAP 302

Query: 302 PWFSF 306
            +  F
Sbjct: 303 DFSPF 307

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  339 bits (869), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 226/309 (73%), Gaps = 3/309 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNE 59
           MT  LK  TAT  LNTGA IP + LGTWR L    GY +++AALKAGYRHID+AA+  NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
             +GKAIRDSG+ R+E+FVT+KLW+TQ  +P+ AL  +L RLGL+Y+DLY+MHWP+ F  
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSL 177
             +K  +FM+IP+N  GKP ++ D W++VKTWELMQ+LP T  T+A+GV+NFS+  L  L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREIS 237
           L SP NK+ PAA+Q+E HP LP  +++ FCREKGI++EAYSPLG    P++ EP I EIS
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 238 KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297
           KKL V PAQL+ISW ++RG  VL KS  + RI +N +VF LS ED+E I  +A+E+G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 298 THNPPWFSF 306
             +P W  F
Sbjct: 301 VVDPDWSPF 309

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  337 bits (864), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 217/304 (71%), Gaps = 2/304 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           LK  TAT  LNTGA+IP++GLGTWR     GY ++LAALK GYRHID+AA+  NE  +G+
Sbjct: 3   LKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVGR 62

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           AI+DSGV R E+F+TTKLW T+HR+P+ ALD SLKRLGL+YVDLY+MHWP+A +    + 
Sbjct: 63  AIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSEE 122

Query: 125 KNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPN 182
           K+ + IP+  +GK  +D  DWD++KTWELMQ+LP T KT+AIGV+NFS+  L +L  SP 
Sbjct: 123 KDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSPK 182

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242
              +PAA+Q+E HP  P  E++ +C+ + IL+EAYSP G    P++ EP + ++++K ++
Sbjct: 183 FNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYNI 242

Query: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPP 302
             AQL+ISW ++RG  VLPKS    RIE+NL+V  L DED E I  +++ +G KR     
Sbjct: 243 STAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQLD 302

Query: 303 WFSF 306
           W  F
Sbjct: 303 WSPF 306

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 214/304 (70%), Gaps = 2/304 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           L   TA  TLN G ++P +GLGTW+  +   YKA++AALKAGYRHID+AA+  NE+ +G+
Sbjct: 3   LSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGR 62

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           AI+DSGVRR E+FVTTKLW TQHR P  AL+QSL+RLGL+YVDLY+MHWP+     Q K 
Sbjct: 63  AIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKK 122

Query: 125 -KNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKSPN 182
             N++ IP N +G   +D   WD++KTWELMQ LP  K ++IGV+NFS+  +  LL SP 
Sbjct: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASPG 182

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242
           NK +P  +Q+E HP LP  E++ FC+ K I++EAYSPLG  G P+++   I E+SKKL +
Sbjct: 183 NKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAI 242

Query: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPP 302
            PA ++ SW ++R   VLPKS T++RI SNL+  +L  E++ +++ I+ E G KR+  P 
Sbjct: 243 PPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPN 302

Query: 303 WFSF 306
           W  F
Sbjct: 303 WTPF 306

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 208/301 (69%), Gaps = 1/301 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M+   K C  T  +    KIP + LGTW+      Y A+L ALKAGYRHID AA+  NE+
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKAIRDSG+ R ++FVTTKLW T+ R+P  ALD SLKRLGL+YVDLY+MHWP+A + D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLK 179
            I   + + IP+   GK  +D  +W+++KTWELMQ+LPT K +AIGV+NFS+  L  LL 
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELPTSKAKAIGVSNFSINNLNELLA 180

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           +P  K IPAA+Q E HP LP +E++ +C++K I++EAY PLGG   PL+  PVI EI+ K
Sbjct: 181 APTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATK 240

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
           L V   QLLISWG++RG  VLPKS  + RI +N +   +  E++E+++ + +E G +R+ 
Sbjct: 241 LGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSV 300

Query: 300 N 300
           N
Sbjct: 301 N 301

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  327 bits (839), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/295 (51%), Positives = 212/295 (71%), Gaps = 2/295 (0%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRDSGVRR 73
           LNTGA IP++GLGTW+  +E  Y A+++AL+ GYRHID+AA+  NE+ +GK IRDSGV R
Sbjct: 12  LNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRDSGVPR 71

Query: 74  DELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKNFMLIPRN 133
           +E+FVTTKLW TQ RDP AALD SL+RLGL+YVDLY++HWP+      I   N++  PR 
Sbjct: 72  EEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGNYLTFPRT 131

Query: 134 SEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKIIPAASQ 191
           ++GK  +D  +W+++KTWE MQ LP + KT+AIGV+NFS+  + +LL +  + I+PAA+Q
Sbjct: 132 ADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDFIVPAANQ 191

Query: 192 LETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPAQLLISW 251
           +E HP LP  E++ +C+ KGIL+EAYSPLG     ++ +P I  I+ K + EPA +LISW
Sbjct: 192 IEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEPANILISW 251

Query: 252 GLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWFSF 306
           G  RG  VLPKS    RI++NL++ DLS ED E+I+++ +  G KR   P +  F
Sbjct: 252 GASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFSPF 306

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  327 bits (839), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 217/308 (70%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKE-GGYKAILAALKAGYRHIDSAAVCMNE 59
           M+  LK  T T  LN G++IP++GLGTW+ T E   Y A+ AAL AGYRHID+AA+  NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
             +G+AIRDSGV R+E+FVTTKLW+ QH +P  ALD+SL+RLGL+YVDLY+MHWP++   
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLK 179
             +K     L+ R    +P V+TDW ++ TWELMQKLP  K R+IGV+NFSV  L  LLK
Sbjct: 121 SYMKESPLELMKRPDGTRP-VETDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLK 179

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           +P   ++P  +Q+E HP LP  E++ +C++  I +EAYSPLG    PL+ EP++ +++KK
Sbjct: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
             V+PA +++SW ++R   VLPKS    R+ +NL+ F L +ED++ I +I+Q+RG +R +
Sbjct: 240 NGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRIN 299

Query: 300 NPPWFSFE 307
           NP +  F+
Sbjct: 300 NPNFEPFK 307

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  327 bits (838), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 152/295 (51%), Positives = 209/295 (70%), Gaps = 1/295 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           L+  T+T  LNTG  IP +GLGTWR  +  GYKA++ ALKAGYRHID AAV  NE  +GK
Sbjct: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           AI+DSGV R+E+F+TTKLW TQ R+P  ALDQSL+RLGL+YVDLY++HWP+  R + IK 
Sbjct: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183
            N        +G   VD +W+++KTWELMQK L + KT+AIGV+NFSV  L  LL +P  
Sbjct: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K+ PA +Q+E HP LP ++++ F +E GI++EAYSPLGG+  P++ +P ++EI+K   VE
Sbjct: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
              ++ISW +++G   LPKS T +RI  NL+V  LSD D  ++  + + +G +RT
Sbjct: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRT 298

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  322 bits (826), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 215/301 (71%), Gaps = 2/301 (0%)

Query: 8   CTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR 67
            T    +NTG  IP+LGLGTW+      Y+A+LAAL++GYRHID+AA+  NE  +G+AIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKNF 127
           DSGV R+++FVTTKLW TQ RDP +AL+ SL+RLGL+YVDLY+MH+P+A + D IK  N 
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 MLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKI 185
           + IP  ++G   VD D W +VKTW+LMQ LP + KT+AIGV+NFS+  +  +LK      
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 186 IPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPA 245
           +PAA+Q+E HP LP DE++ +C+ KGI++EAYSPLG     ++ +P + ++++K  VEPA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 246 QLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWFS 305
           Q+LISWG+ RG  +LPKS    R++SNL++  LS  D ++I +I ++ G KR  +P W  
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 306 F 306
           F
Sbjct: 302 F 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  322 bits (826), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 215/301 (71%), Gaps = 2/301 (0%)

Query: 8   CTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR 67
            T    +NTG  IP+LGLGTW+      Y+A+LAAL++GYRHID+AA+  NE  +G+AIR
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKNF 127
           DSGV R+++FVTTKLW TQ RDP +AL+ SL+RLGL+YVDLY+MH+P+A + D IK  N 
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 MLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKI 185
           + IP  ++G   VD D W +VKTW+LMQ LP + KT+AIGV+NFS+  +  +LK      
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 186 IPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPA 245
           +PAA+Q+E HP LP DE++ +C+ KGI++EAYSPLG     ++ +P + ++++K  VEPA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 246 QLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWFS 305
           Q+LISWG+ RG  +LPKS    R++SNL++  LS  D ++I +I ++ G KR  +P W  
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 306 F 306
           F
Sbjct: 302 F 302

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  322 bits (824), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 214/301 (71%), Gaps = 3/301 (0%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD 68
           T +  LNTGA +P +GLGTW+ ++E  Y A+L+ALKAGY+HID+AA+  NE+ +GKAIRD
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKNFM 128
           SG+ RDELF+TTKLWSTQHRDP AALD SL+RLGL+YVDLY++H+P+AF+ D+I+  N  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 LIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKII 186
             P    GK  VD  DWD+VKTW L+Q LP + K +A+GV+NFS+  L +LL+S     +
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 187 PAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK-LHVEPA 245
           PA +Q+E HP LP  E++ FC+ K I++EAYSPLG  G  ++ +  +++I++K    +PA
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 246 QLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWFS 305
           Q+LI+WG+ RG  VLPKS T  RIE+N  + D+  ED  ++  +    GPKR   P W  
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 306 F 306
           F
Sbjct: 308 F 308

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 207/308 (67%), Gaps = 2/308 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   LK      TLN G KIP +GLGTW+  +  GY +++ ALKAGYRHID+AA+  NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +G+AI+DSGV RD++F+TTKLW T+ ++P  AL+ SLKRLGL+YVDLY+MHWP+     
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178
            IK  +++++PR  +G   VD + WDY+KTWEL+Q+LP T  TR++GV+NFS+  L  +L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
            SP NK+ PA +Q+E HP LP  E+  +C  K I +EAYSP G D  P + +  I +I+ 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298
           K  V PAQ++ SW ++R   VLPKS  + R+ SN +VFDLS ED   I  +A+  G KR 
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 299 HNPPWFSF 306
           + P W  F
Sbjct: 301 NKPDWDPF 308

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  307 bits (787), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 208/307 (67%), Gaps = 1/307 (0%)

Query: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           M   LK CT T TLN G KIP++GLGT+   +   Y+A++ A KAGYRH+D+AA   NE+
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
            +GKA++D GV R E++VTTK+W T+ RDP AALD+SLKRLGLEY+DLY+MHWP+  + D
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLK 179
            IK    M IPR  +G   VD DW +V+ WE MQK L + K ++IGV+NFS+  +  LL 
Sbjct: 121 TIKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLA 180

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
           +P   ++P  +Q+E  P LP+DE++ FCR K I+ +AY P GG   PLI +  + EI+K 
Sbjct: 181 APTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKG 240

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTH 299
             V+  Q++ SW ++RG  VLPKS  ++RI SNL+ F LSD D  +++ I++ +G KR +
Sbjct: 241 NGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLN 300

Query: 300 NPPWFSF 306
           N  +  F
Sbjct: 301 NVNFSPF 307

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 210/302 (69%), Gaps = 9/302 (2%)

Query: 14  LNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRDSGVR 72
           L+TGA IP +GLGTWR +     Y +++AALK GYRHID+AA+  NE  +GKAIRDSGV 
Sbjct: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVP 72

Query: 73  RDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKN-----F 127
           R+E+FVT+KLW  Q  DP  AL+Q+LKRLGL+Y+DLY+MHWP+ F    IK ++     F
Sbjct: 73  RNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAF 132

Query: 128 MLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKI 185
           M IP +S G   V+ D W+++KTWELMQ LP + KT+A+GV+NFS+  L  LL +   K+
Sbjct: 133 MTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKV 192

Query: 186 IPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPA 245
           +PAA+Q+E HP L  +E+L +C+EK IL+EAYSP G    P++ +  I  I+KKL ++  
Sbjct: 193 VPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVG 252

Query: 246 QLLISWGLKR-GCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWF 304
           Q+++SW ++R G  VLPKS  + RI +N +V  L DED++ I+ + +E+G  R  +P W 
Sbjct: 253 QVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWS 312

Query: 305 SF 306
            F
Sbjct: 313 PF 314

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  305 bits (781), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/299 (50%), Positives = 204/299 (68%), Gaps = 7/299 (2%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRDSGVRR 73
           LNTGA IP LG GTW  +    Y A++ ALK GYRHID+AA+  NE  +GK IRDSG+ R
Sbjct: 13  LNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSGIPR 72

Query: 74  DELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKNFMLIPRN 133
           +E+FVTTKLW+TQ RDP++ALD+SL+RLGL+YVDL+++HWP+  +   +     +L    
Sbjct: 73  EEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLK--PVGGPENLLKYPT 130

Query: 134 SEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKIIPAASQ 191
              KP +DT DW ++KTWELMQ LP T KTRA+GV+NFS+  L  LL S  + ++PA +Q
Sbjct: 131 PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPAVNQ 190

Query: 192 LETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPAQLLISW 251
            E HP LP  E++ +C+ KGI++EAY PLG     ++ +P I EI+ K HV+PA +LI+W
Sbjct: 191 FEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVLINW 250

Query: 252 GLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNP---PWFSFE 307
           G+ RG  VLPKS T  RI SN     LS ED ERI ++++  G KR  +P   P+  FE
Sbjct: 251 GISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPLFE 309

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  293 bits (749), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 209/303 (68%), Gaps = 1/303 (0%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64
           LK  T T TLNTGAKIPL GLGTW+ T +    A+ AALK GY+HID+A+   NE+++GK
Sbjct: 7   LKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVGK 66

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           A+++SG+ R+ELF+TTK+W+ Q RDP+ ALD SLK+LG EYVDL +MHWP+ F+  +   
Sbjct: 67  AVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENST 126

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183
            +   +PR  +GK   D +WD+VKTW LMQK L T K +AIGV+NFS+  L  LL +   
Sbjct: 127 LDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEGT 186

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
            ++PA +Q+E H  LP  E++ +C++KGI++EAYSPLG    PL+ +  + ++++K  V 
Sbjct: 187 TVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGVT 246

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303
           PA +L+++   RG  VLPKS  ++RI SN E F + +ED + +++I ++ G +R  +P +
Sbjct: 247 PAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDPDF 306

Query: 304 FSF 306
             F
Sbjct: 307 SPF 309

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  216 bits (550), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 179/292 (61%), Gaps = 20/292 (6%)

Query: 13  TLNTGAKIPLLGLGT------WRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI 66
            LN G +IP +GLGT      +  TKE    A+ AA++AGYRHID+A     E  IG+A+
Sbjct: 12  NLNNGTRIPAIGLGTASPKDRYPETKE----AVKAAIRAGYRHIDTAYFYKTEPYIGQAL 67

Query: 67  RD----SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           ++    + ++R+ELF+TTK+W T   +PS ++DQSLK LG++YVDL + HWP+ F+  + 
Sbjct: 68  KELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVEN 127

Query: 123 KAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL----PTEKTRAIGVANFSVPQLTSLL 178
              N + +PR+ +G    + D D++ T++ ++K+       + RAIGV+N+ +  L  L 
Sbjct: 128 SQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLF 187

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
           K    K+ PA +Q+E HP LP  E+  FC +  IL+ AYSPLG DG P +    +++++K
Sbjct: 188 KE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAK 245

Query: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIA 290
           K  VEPA +L S+ + +G  VLP+S    RI +N+    L+D+D  ++ ++ 
Sbjct: 246 KYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG 297

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  210 bits (534), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 181/297 (60%), Gaps = 24/297 (8%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           T N G K+P  GLGT    +      +A+ AA+KAGYRHID+A     E+ +G+A+++  
Sbjct: 12  TFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELF 71

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR-------V 119
               V+R++L +T+K+W T   D   +L++SL RL ++YVDL++ HWPL  +       V
Sbjct: 72  EERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPLCTQKVPDPHGV 131

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKT----RAIGVANFSVPQLT 175
           D+I  +     P + +G P  D   D+++T++ ++K+  +K     RAIGV+NF +  L 
Sbjct: 132 DKIAKE-----PVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLK 186

Query: 176 SLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIRE 235
            +LK    + +PA +Q+E HP LP  E+  FC E  IL+ AYSPLGG+G PL++ P+++ 
Sbjct: 187 RVLKEC--RTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKG 244

Query: 236 ISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQE 292
           + +K +  P  +L S+ L++G  V+P+S   TRI SNLE   LS+ED  +++E  Q+
Sbjct: 245 LCEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQK 301

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  200 bits (508), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 182/303 (60%), Gaps = 15/303 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIR--- 67
           +LN G +IP LGLGT    ++     +A+ AA+KAGYRHID+A     E  +G+AI+   
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 68  -DSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV--DQIKA 124
            D  ++R++LF+TTK+W     +   +L++SLK LGLEYVDL + HWPL F    D    
Sbjct: 86  EDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGI 145

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL---PTE-KTRAIGVANFSVPQLTSLLKS 180
              +  P +  GK     D DY++T++ ++K+   P + + RAIGV+NFS+  L  L+K 
Sbjct: 146 SGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKE 205

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              ++ P  +Q+ETHP LP  E+  FC    IL+ AYSPLG  G P +  P+++++++K 
Sbjct: 206 --CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVKKLAEKY 263

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           +V    LLIS+ +++G  V+P+S    RI S++E   L+ ++ + +++   E+ P R  +
Sbjct: 264 NVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFG-EKYPVRFID 322

Query: 301 PPW 303
            P+
Sbjct: 323 EPF 325

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  197 bits (502), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 180/294 (61%), Gaps = 18/294 (6%)

Query: 13  TLNTGAKIPLLGLGTWRLTKE--GGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
            LNTGAKIP LGLGT    ++      A+  A+K GYR ID+A +  +E  IG+A+++  
Sbjct: 12  NLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELF 71

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI---- 122
               V+R++LF+TTK+W   +     +L +SLK+L L+YVDL + HWPL F V Q     
Sbjct: 72  EEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCF-VKQYDEHG 130

Query: 123 KAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE---KTRAIGVANFSVPQLTSLLK 179
           K K+  + P++  G   +D   DY+ TW+ ++K+  +   + R IGV+N+ V  L  LLK
Sbjct: 131 KLKSHPVDPKS--GDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLK 188

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
               +++P  +Q+E HP LP +E+  +C   GILME++SPLG  G P ++ P+++E+SKK
Sbjct: 189 E--TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKK 246

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQER 293
              EP  +L+++ +++G  V+P+S    RI  N +   LS+ED +++  + +E+
Sbjct: 247 YDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREK 300

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  197 bits (502), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 173/293 (59%), Gaps = 15/293 (5%)

Query: 14  LNTGAKIPLLGLGTW--RLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD--- 68
           LN G  IP LG GT+  R       +A+ AA+KAGYRHID+A V  +E  +G+AI++   
Sbjct: 13  LNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMIE 72

Query: 69  -SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAF-RVDQIK--A 124
              V R +LFVTTK+W     +   +L++SL+ LGL+YVDL + HWPL F RV+  K   
Sbjct: 73  EGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPRVEDEKNGV 132

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL----PTEKTRAIGVANFSVPQLTSLLKS 180
              +  P + EGKP ++   D+++T+  ++K+       + RAIGV+N+++  L +L K 
Sbjct: 133 NGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLEALFKE 192

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              K+ P  +Q+E HP LP  E+  FC   GIL+ AYSPLG DG P +  P++ ++++K 
Sbjct: 193 --CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPLVHQLAEKY 250

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQER 293
            +    +LIS+ +++G  V+P+S    RI S +E    + E+ +++  +  E 
Sbjct: 251 DMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVGIEE 303

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  197 bits (501), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 172/290 (59%), Gaps = 16/290 (5%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGY----KAILAALKAGYRHIDSAAVCMNEQVIGKAI-- 66
            LN G +IP +GLGT   + +G Y    KA+ AA++AGYR ID+A     E  IG+A+  
Sbjct: 12  NLNNGGRIPAIGLGT--ASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKE 69

Query: 67  --RDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
             RD  ++R++LF+TTK+W     DPS ++++SLK LG++YVD+ + HWPL ++    + 
Sbjct: 70  LFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDEN 129

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE----KTRAIGVANFSVPQLTSLLKS 180
              +  P + +GK       D++ T++LM+K+  +    + RAIGV+N+ +  L  ++K 
Sbjct: 130 GTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVIKE 189

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              K+ P  +Q+E HP LP  E+  FC + GIL+ AYSPLG  G P    P+++E +KK 
Sbjct: 190 --CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIA 290
            V PA +L S+ +++G  V+P+S    R+ SN+    L+  + + + +  
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  196 bits (498), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 187/311 (60%), Gaps = 17/311 (5%)

Query: 6   KKCTATATLNTGAKIPLLGLGTWRLTKEGGY--KAILAALKAGYRHIDSAAVCMNEQVIG 63
           K    + TLN G ++P LGLGT     E G   +A+ AA+KAGYRHID+A    +E  +G
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  KAIRD----SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
           +AI++      +RR+++F+T+K+W     D   +L++SL+ LG++Y+DL++ HWPL + V
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCY-V 126

Query: 120 DQIKAKNFMLIPRNSE---GKPYVDTDWDYVKTWELMQKL---PTE-KTRAIGVANFSVP 172
            Q        + RN E   G+PY + D D+++T+  M+K+   P++ + R+IGV+NF V 
Sbjct: 127 KQEDTHGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQ 186

Query: 173 QLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPV 232
            L   L      + PA +Q+E HP LP  E+  FCR   IL+EAYSPLG    P +   +
Sbjct: 187 YLERTLFE--CAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQL 244

Query: 233 IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQE 292
           ++++++K  + P+ +L S+ +++G AV+ +S    RI SN+E   L++E+ + + ++   
Sbjct: 245 VQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGIT 304

Query: 293 RGPKRTHNPPW 303
           + PKR  N  W
Sbjct: 305 K-PKRFVNEKW 314

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  196 bits (499), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 184/302 (60%), Gaps = 15/302 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           +LN G +IP LGLGT    ++     +A+ AA+KAGYRHID+A     E  +G+AI++  
Sbjct: 26  SLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAF-RV-DQIKA 124
               ++R++LF+TTK+W     +   +L++SLK LGL+YVDL + HWP+ F +V D    
Sbjct: 86  EEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGKVKDPEGI 145

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE----KTRAIGVANFSVPQLTSLLKS 180
             +M +P +  GK    ++ D+++T++ ++K+  +    + RAIGV+NFS+  L  L+K 
Sbjct: 146 SGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIKE 205

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              K+ P  +Q+E+HP LP  E+  FC    IL+ AYSPLG  G P +  P+++++ +K 
Sbjct: 206 --CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEKY 263

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           +V    LLIS+ +++G  V+P+S    RI SN+E   L+ ++ + ++E   E+ P R  +
Sbjct: 264 NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFG-EKYPVRFMD 322

Query: 301 PP 302
            P
Sbjct: 323 VP 324

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  195 bits (495), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 181/303 (59%), Gaps = 15/303 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           +LN G +IP LGLGT    ++     +A+ AA+KAGYRHID+A     E  +G+AI++  
Sbjct: 26  SLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVGEAIKELL 85

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV--DQIKA 124
               ++R++LF+TTK+W     +   +L++SLK LGL+YVDL + HWPL F    D    
Sbjct: 86  EEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEKVKDPKGI 145

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE----KTRAIGVANFSVPQLTSLLKS 180
              +  P +  GK    ++ D+++T++ ++K+  +    + RAIGV+NFS+  L  L+K 
Sbjct: 146 SGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEYLERLIKE 205

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              K+ P  +Q+E+HP LP  E+  FC    IL+ AYSPLG  G P +  P+++++ +K 
Sbjct: 206 --CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLVKKLCEKY 263

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           +V    LLIS+ +++G  V+P+S    RI SN+E   L+ ++ + ++E   E+ P R  +
Sbjct: 264 NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFG-EKYPVRFID 322

Query: 301 PPW 303
            P+
Sbjct: 323 EPF 325

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  194 bits (492), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 175/296 (59%), Gaps = 14/296 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKE--GGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           TLN G K+P LGLGT  + ++     +A+ AA+K+GYRHID+A     E  IG+A+++  
Sbjct: 12  TLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKELF 71

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR--VDQIKA 124
               ++R+++F+TTK+W T       ++ +SL+ LG++YVDL + HWPL F    D    
Sbjct: 72  EEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNRLQDPEGI 131

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKT---RAIGVANFSVPQLTSLLKSP 181
                 P + +G P+ +   DY++T++ ++K+   K    R+IGV+N+ V  L  LLK  
Sbjct: 132 DGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLERLLKE- 190

Query: 182 NNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLH 241
             K++PA +Q+E HP LP  E+  FC +  I +EA+SP G  G P++   +++++++K  
Sbjct: 191 -CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKVAQKYS 249

Query: 242 VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKR 297
             P  +LI++ L++G   +P+S     I SN++   LS ED + +++   E  PKR
Sbjct: 250 CTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFGVE-NPKR 304

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (490), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/303 (35%), Positives = 188/303 (62%), Gaps = 15/303 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIR--- 67
           +LN G +IP LGLGT    ++     +A+ AA+KAGYRHID+A     E  +G+AI+   
Sbjct: 26  SLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 68  -DSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAF-RVDQIKAK 125
            D  ++R++LF+TTK+W     +   +L++SLK LGL+YVDL++ HWPL F +V   K  
Sbjct: 86  EDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEKVKDPKGL 145

Query: 126 NFML-IPRNSEGKPYVDTDWDYVKTWELMQKL---PTE-KTRAIGVANFSVPQLTSLLKS 180
           + ++  P +  GK    ++ D+++T++ ++K+   P + + RAIGV+NFS+  L  L+K 
Sbjct: 146 SGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEYLERLIKE 205

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              ++ P  +Q+ETHP LP   M  FC    IL+ AYSPLG +G P +  P+++++++K 
Sbjct: 206 --CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLTEKY 263

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           ++    +LIS+ +++G  V+P+S    RI S++E   L+ ++ + +++   E+ P R  +
Sbjct: 264 NLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFG-EKYPVRFID 322

Query: 301 PPW 303
            P+
Sbjct: 323 EPF 325

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  191 bits (485), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/307 (34%), Positives = 179/307 (58%), Gaps = 24/307 (7%)

Query: 13  TLNTGAKIPLLGLGTWRLTKE--GGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           TLN G ++P +GLGT  + ++     +A+ AA+K+GYRHID+A     E  +G+A+++  
Sbjct: 12  TLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKELF 71

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR-------V 119
               V+R+++FVTTK+W T       ++ +SL+ LGL++VDL + HWPL F        +
Sbjct: 72  EEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNRLEDPDGI 131

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKT---RAIGVANFSVPQLTS 176
           D ++       P + +G P+ +   DY++T++ ++KL   K    RAIGV+N+ V  L  
Sbjct: 132 DGVRRN-----PYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLER 186

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREI 236
           LLK    +++PA +Q+E HP LP  E+  FC +  I +EAYSPLG    PLID  ++++I
Sbjct: 187 LLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKI 244

Query: 237 SKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPK 296
           + K       +LI++ +++G   +P+S     I SN++   LS ED + +++   E   K
Sbjct: 245 AGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVE-NTK 303

Query: 297 RTHNPPW 303
           R  + P+
Sbjct: 304 RIVDEPF 310

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  191 bits (484), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 174/296 (58%), Gaps = 22/296 (7%)

Query: 13  TLNTGAKIPLLGLGT------WRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI 66
            LN G +IP +GLGT      W  TKE    A+ AA+KAG+R ID+A     E+ IG+A+
Sbjct: 12  NLNNGTRIPAVGLGTANPKDKWPQTKE----AVKAAVKAGFRQIDTAWAYGTEEYIGEAL 67

Query: 67  RD----SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           ++      V+R++LF+TTK+W         +L++SLKRL L+YVDL + HWP  F   Q 
Sbjct: 68  QELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQD 127

Query: 123 KAKNFMLI--PRNSEGKPYVDTDWDYVKTWELMQKL----PTEKTRAIGVANFSVPQLTS 176
              +  L+  P++ +G P+ DT  D+++T++ ++ +       + RAIGV+N+ +  L  
Sbjct: 128 PEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLER 187

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREI 236
           L K    K +PA +Q+E HP LP  E+  +C + GILM +YSPLG +G P +  P+++E+
Sbjct: 188 LFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQEL 245

Query: 237 SKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQE 292
           + K +     +L+S+ +++G  V+P+S    RI   L    L+ E+ +++++   E
Sbjct: 246 ASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVE 301

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  191 bits (485), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 184/303 (60%), Gaps = 15/303 (4%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           TLN G ++P LGLGT    ++     +A+ AA+KAGYRHID+A     E  +G+AI++  
Sbjct: 26  TLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELL 85

Query: 69  --SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV--DQIKA 124
               ++R++LF+TTK+W     +   +L +SLK +GL+YVDL++ HWPL F    D    
Sbjct: 86  EEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEKVKDPKGI 145

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL---PTE-KTRAIGVANFSVPQLTSLLKS 180
              +  P +  G+  + ++ D+++T++ ++K+   P + + RAIGV+NFS+  L  L+K 
Sbjct: 146 SGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLVKE 205

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              ++ P  +Q+ETHP LP  E+  FC    IL+ AYSPLG +G P +  P+++++ +K 
Sbjct: 206 --CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPLVKKLVEKY 263

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHN 300
           +V    +LIS+ +++G  V+P+S    RI S++E   L+ ++ + +++   E+ P R  +
Sbjct: 264 NVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFG-EKYPVRFID 322

Query: 301 PPW 303
            P+
Sbjct: 323 EPF 325

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  186 bits (473), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 170/297 (57%), Gaps = 25/297 (8%)

Query: 14  LNTGAKIPLLGLGTW--RLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR---- 67
           LN G  +P LGLGT   R       +A+ AA+KAGYRHID+A     E  IG A++    
Sbjct: 13  LNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELLE 72

Query: 68  DSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR--------V 119
           +  V+R +LF+T+K+W     D   +L++SLK LGL+YVDLY+ HWPL F+        V
Sbjct: 73  NGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKDGV 132

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE----KTRAIGVANFSVPQLT 175
           + +K K     P + +G   +    DY+ T++ M+K+  +    + RAIGV+N+ V  L 
Sbjct: 133 NGLKGK-----PIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLD 187

Query: 176 SLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIRE 235
            LLK    K  PA +Q+E HP LP  E+  FC    I + AYSPLG  G PL+  P+++E
Sbjct: 188 RLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKE 245

Query: 236 ISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQE 292
           +S+K  V    +LIS+ +++G  V+P+S    R+   +    L++ + +++ +I ++
Sbjct: 246 LSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRK 302

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  183 bits (464), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 165/286 (57%), Gaps = 14/286 (4%)

Query: 6   KKCTATATLNTGAKIPLLGLGTWRLTKEGG--YKAILAALKAGYRHIDSAAVCMNEQVIG 63
           K    +  LN G ++P +GLGT    ++     +A+ AA+KAGYR+ID+A    +E  +G
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 64  KAIRD----SGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAF-- 117
           +AI++      ++R++LF+T+K+W     D   +L +SLK LG++Y+DL++ HWPL +  
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNR 124

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE----KTRAIGVANFSVPQ 173
           R D          P  ++G P  +   D++ T++ M+++ +     + RAIGV+NF V  
Sbjct: 125 REDPHGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEY 184

Query: 174 LTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVI 233
           L  +LK     + P  +Q+E HP LP  E+  FC +  I + AYSPLG  G P++  P+I
Sbjct: 185 LKRVLKE--CPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPLI 242

Query: 234 REISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLS 279
           +E+S+K       +L S+ +++G  V+P+S    RI SN+E   LS
Sbjct: 243 KEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  164 bits (414), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 166/304 (54%), Gaps = 27/304 (8%)

Query: 11  TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR--- 67
           T  LN GA +PL+GLG W++  E   + +  A+K GYR +D A    NE+ +G+ IR   
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  DSG-VRRDELFVTTKLWSTQHR--DPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124
           D G VRR+ELFV +KLW+  HR  D   AL ++L  LGL+Y+DL+ +H+PLAF+   ++ 
Sbjct: 92  DEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEE 151

Query: 125 K---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLKS 180
           +          + +           ++T+  +++L  E + RAIG++NF    +  LL+ 
Sbjct: 152 RYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLLRG 211

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG------------GDGGPLI 228
              +I PAA Q+E HP+L  + ++ + + +G+ +  YS LG             +  PL+
Sbjct: 212 --CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAPLL 269

Query: 229 DEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNL---EVFDLSDEDYER 285
              V+  I+++    PA++L+ W  +R  AV+PKS  + R+ +NL   E   L+D++   
Sbjct: 270 QHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDELRE 329

Query: 286 IHEI 289
           +  +
Sbjct: 330 LSSL 333

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  162 bits (410), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 173/316 (54%), Gaps = 31/316 (9%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR----D 68
           TLN G K+P +GLG W++  +     +  A+KAGYR  D A    NE  +GK ++    D
Sbjct: 6   TLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDD 65

Query: 69  SGVRRDELFVTTKLWSTQHRDPSAALD--QSLKRLGLEYVDLYMMHWPLAFRVDQIKAKN 126
             V+R +LFV +KLW+  H      L+  ++LK LGL+Y+DLY +H+P+AF+   ++ + 
Sbjct: 66  GIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEERY 125

Query: 127 --FMLIPRNSEGKPYV-DTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPN 182
              M   +  E K  + + +   + T+  +++   E   ++IG++NF+   +  +L+  +
Sbjct: 126 PPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILRGCS 185

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG----GDGG--------PLIDE 230
             I P A Q+E HP+L  +++L +C+   + +  YS  G     D G        PL D 
Sbjct: 186 --IKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLFDH 243

Query: 231 PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD---LSDEDYERIH 287
           PVI++I++K +V  A++L+ W  +RG A++PKS  + R+ SNL + D   L++ED + I 
Sbjct: 244 PVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKSIS 303

Query: 288 EIAQERGPKRTHNPPW 303
            + Q        N PW
Sbjct: 304 GLNQ----NLRFNDPW 315

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 169/307 (55%), Gaps = 29/307 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           + T TLN G  +PL+GLG W+++ +   + +  A+K GYR  D A    NE+ +G  IR 
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 68  --DSG-VRRDELFVTTKLWSTQHRDP---SAALDQSLKRLGLEYVDLYMMHWPLAFRVDQ 121
             D G V+R++LFV +KLW+T H DP     AL ++L  + LEY+DLY +H+PLAF+   
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYH-DPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 IKAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSL 177
            + +    F     +++     +     + T+  M++L  E  T++IG++N++   +   
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 178 LKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGG------------ 225
           L+    +I P   Q+E HP+L  ++++ +C+  GI + AYS  G                
Sbjct: 181 LRG--CRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 226 PLIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDED 282
           PL D PVI++I+++  V  +Q+++ W  +RG AV+PKS  + R+  NL++     L+ +D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 283 YERIHEI 289
            E I  +
Sbjct: 299 LEEISSL 305

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  159 bits (403), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 171/321 (53%), Gaps = 32/321 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           +A  TLN G K+PL+GLG W++      + I  A+K GYR  D A    NE+ +G+ I+ 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-VRRDELFVTTKLWSTQHRDPSAALD--QSLKRLGLEYVDLYMMHWPLAFRVDQI 122
             D G V+R++LF+ +KLW+  H      L+  ++LK LGL+YVDLY +H+P+AF+    
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 123 KAKN--FMLIPRNSEGKPYV-DTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
             +    M   +  E K  + + +   + T+  M+KL  E   ++IG++N++   +   L
Sbjct: 122 DERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGG----DGG--------P 226
           +    +I P A Q+E HP+L  +++L +C+   + + AYS  G     D G        P
Sbjct: 182 RGC--RIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 227 LIDEPVIREISKKLH-VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDED 282
           L D P I++I+ K   V  +Q+L+ W  +RG A++PKS  + R+  NL +     L++ED
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 283 YERIHEIAQERGPKRTHNPPW 303
              I  + Q        N PW
Sbjct: 300 LREISALNQ----NLRFNDPW 316

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  158 bits (399), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 171/319 (53%), Gaps = 33/319 (10%)

Query: 11  TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----KAI 66
           T TLN G K+PL+GLG W++  +     I  A+K GYR  D A    NE+ +G    +AI
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 67  RDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFR---VDQ 121
           ++  V+R++L V +KLW++ H   +   AL+++L  L L+YVD++ +H+PLAF+    D+
Sbjct: 67  KEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDE 126

Query: 122 IKAKNFMLIPRNSEGKPYVDTDW-DYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLK 179
                F    +  E K +++ +    + TW  ++KL  + K +++G++NFS   +  LL+
Sbjct: 127 KYPPGFY-TGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLR 185

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGG------------DGGPL 227
               +I P A Q+E HP+L  + ++ + +  GI + AYS  G             +   L
Sbjct: 186 GA--RIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTL 243

Query: 228 IDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD---LSDEDYE 284
            +   I+ I+ K  V P Q+L+ W  + G A++PKS  + R+  NL + D   L+D++ +
Sbjct: 244 FEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELK 303

Query: 285 RIHEIAQERGPKRTHNPPW 303
           +I  + Q        N PW
Sbjct: 304 QISGLNQ----NIRFNDPW 318

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 163/303 (53%), Gaps = 29/303 (9%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----KAIRD 68
           TLN G K+P++GLG W++  +     +  A+K GYR  D A    NE+ +G    +AI +
Sbjct: 6   TLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISE 65

Query: 69  SGVRRDELFVTTKLWSTQHRDP---SAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAK 125
             V+R+ELFV +KLW++ H DP     AL ++L  + L+Y+DLY +H+P+AF+    + K
Sbjct: 66  GIVKREELFVISKLWNSYH-DPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPFEEK 124

Query: 126 ---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSP 181
               F     ++E     +     + T+  M++L T+   ++IG++NF+   +  LL+S 
Sbjct: 125 YPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLLRSC 184

Query: 182 NNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGG------------DGGPLID 229
             KI P   Q+E HP+L    ++ +C+   I + AYS  G             D   L +
Sbjct: 185 --KIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVLFE 242

Query: 230 EPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNL---EVFDLSDEDYERI 286
             VI+ I+    VEP+Q+L+ W  +RG A++PKS  + R+  NL   E   LS+++   I
Sbjct: 243 HEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQELSTI 302

Query: 287 HEI 289
            ++
Sbjct: 303 SDL 305

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 159/306 (51%), Gaps = 27/306 (8%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           T T TLN G K+P++GLG W+L+ +     +  A+K GYR  D A    NE+ IG    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI +  V+R++LF+ +KLW   H       AL ++L  LGL+YVDLY +H+PL  +   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K          +       +     + T+  M+KL  E   +++G++NF    +  LL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG------------GDGGP 226
           +    +I P A Q+E HP+L  + ++ + + K I + AYS  G             D  P
Sbjct: 184 RGA--RIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNL---EVFDLSDEDY 283
           L++  ++  I+KK  V P+Q+++ W  +RG AV+PKS  + R+ +NL   +   LSD + 
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 284 ERIHEI 289
             I  +
Sbjct: 302 SDIFSL 307

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 169/317 (53%), Gaps = 25/317 (7%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           ++  TLN G K+PL+GLG W++  +   + +  A+K GYR  D A    NE+ +G+ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
             D G V+R+++FV +KLW++ H       AL ++L  +GL+Y+DL+ +H+P+AF+    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     + +     +     + T+  +++   E   ++IG++NFS   +  LL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYS------------PLGGDGGP 226
           +    KI P A Q+E HP+L  + ++ +C++ GI + AYS            PL  +   
Sbjct: 182 RQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERI 286
           L     I++I+   +V  +Q+L+ W  +RG A++PKS  + R++ NL + +     ++ +
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 287 HEIAQERGPKRTHNPPW 303
             I++     R  N PW
Sbjct: 300 EAISKLNKNLRL-NDPW 315

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 156/291 (53%), Gaps = 26/291 (8%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           TA  TLN G K+PL+GLG W++  +     +  A+K GYR  D AA   NE+ +G    K
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           A+ +  V+R +LF+ +KLW+T H       AL ++L  LGL+Y+DLY +H+PLAF+    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 KAKN---FMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     +++       +  Y+ T+  M+KL  E  T++IGV+N     L  +L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG------------GDGGP 226
                +I PAA Q+E HP+L  + ++ FC+ + I + +YS  G             D   
Sbjct: 182 MGC--RIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 227 LIDEPVIREISKKL--HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV 275
           L D PVI++I+      V  +++L+ W  +R  A++PKS  + R+  NL V
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNV 290

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  154 bits (390), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 158/306 (51%), Gaps = 27/306 (8%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           ++ A LN G K+P++GLG W++      + +  A+K GYR  D A    NE+ +G+ IR 
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 68  ---DSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
              +  V+R +LF+ +KLW+T H       A+ ++L  LGL+Y+DLY +H+PLAF+   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     ++           Y+ T+  M+ L  E   ++IGV+N     L  +L
Sbjct: 122 EEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGG------------DGGP 226
                KI P   Q+E HP+L    ++ +C+ + I++ AYS  G             D   
Sbjct: 182 MGC--KIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPN 239

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDEDY 283
           L D PVI+ I+ K +V  +++L+ W  + G AV+PKS  + R+  NL +     LS+E+ 
Sbjct: 240 LFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEEL 299

Query: 284 ERIHEI 289
             I  I
Sbjct: 300 VEISNI 305

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  154 bits (390), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 168/324 (51%), Gaps = 31/324 (9%)

Query: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG- 63
           +   + T TLN G ++PL+GLG W++  +     +  A+K GYR  D A    NE+ +G 
Sbjct: 1   MSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQ 60

Query: 64  ---KAIRDSGVRRDELFVTTKLWSTQHR--DPSAALDQSLKRLGLEYVDLYMMHWPLAFR 118
              KAI +  V+R++LFV +KLW++ H   +   AL ++L  +GL+Y+DL+ +H+PLAF+
Sbjct: 61  GIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFK 120

Query: 119 VDQIKAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQL 174
               + K    F     + +       D   + T+  ++K   E   ++IG++NF+   +
Sbjct: 121 FVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLV 180

Query: 175 TSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPV-- 232
             LL+    +I P A Q+E HP+L  + ++ +C+  GI + AYS  G      +D  +  
Sbjct: 181 QDLLRGA--RIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAK 238

Query: 233 ----------IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD---LS 279
                     ++ I+    V  +Q+L+ W  +RG AV+PKS  + R+  NL + D   LS
Sbjct: 239 TTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLS 298

Query: 280 DEDYERIHEIAQERGPKRTHNPPW 303
           D++ + I  + ++       N PW
Sbjct: 299 DKELKAISALNKD----IRFNDPW 318

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  154 bits (390), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 168/309 (54%), Gaps = 27/309 (8%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           + T  LN G ++PL+GLG W++  E     +  A+K GYR  D A    NE+ +G+ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
             D G V+R++LFV +KLW++ H  ++   AL ++L+ LGLEY+DL+ +H+PLAF+    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + +    F     + +           + T+  +++   E   +AIGV+NF    L  LL
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDLL 184

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG-----------GDGGP- 226
                KI PA  Q+E HP+L  ++++ +C+++GI + AYS  G               P 
Sbjct: 185 AGA--KIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTPT 242

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDEDY 283
           L +  V+++++    V  +++L+ W  +R  A++PKS  + R+ +NL++     LSDE+ 
Sbjct: 243 LFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEEL 302

Query: 284 ERIHEIAQE 292
           + I  + ++
Sbjct: 303 QEISSLNKD 311

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  152 bits (385), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 168/327 (51%), Gaps = 46/327 (14%)

Query: 10  ATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNE----QVIGKA 65
           +  TLN G K+PL+GLG W+++ +   + +  A+K GYR  D A    NE    Q I KA
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 66  IRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQIK 123
           I +  V+R +LFV +KLW++ H       AL ++L+ LGL+Y+DLY +H+P+AF+     
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFK----- 117

Query: 124 AKNFMLIPRNSEGKPYVDTDWDYVKTWELMQ-KLPTEKT-------------RAIGVANF 169
                 +P   +  P   T  D  +   L + K+P   T             ++IG++NF
Sbjct: 118 -----FVPFEEKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNF 172

Query: 170 SVPQLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG-------- 221
           +   +  LL     +I P A Q+E HP+L  ++++ +C+ KGI + AYS  G        
Sbjct: 173 NGVLVQDLLNG--CRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELD 230

Query: 222 ---GDGGP-LIDEPVIREISKKLHVE-PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVF 276
                  P L++ P+I++I+       P+++L+ W  +RG AV+PKS  + R+  NL V 
Sbjct: 231 SQLAKSTPSLLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVE 290

Query: 277 DLSDEDYERIHEIAQERGPKRTHNPPW 303
           D      E ++EI+      R  N PW
Sbjct: 291 DSITLTEEELNEISSLNKNIR-FNDPW 316

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  150 bits (380), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 148/279 (53%), Gaps = 37/279 (13%)

Query: 11  TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD-- 68
           T TL  G  +P LGLG + + K    + +  ALK GYRH D+A    NE  +G+ I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRLG-LEYVDLYMMHWPLAFRVDQ 121
               S  RR ++F  TKLW++Q  + +   A+ Q L+++  L Y+DL ++H P      +
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 IKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKS 180
           +                          T+E MQ+ +     ++IGV+N+    L  L   
Sbjct: 125 LA-------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQELYAM 159

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
           PN K  P  +Q+E  P+LP ++++ +C+  G+ ++AYSPLG   G  +++P I  ++ + 
Sbjct: 160 PNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLG--CGDRVNDPYIASLATQK 217

Query: 241 HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLS 279
           +  PAQ+LI+W L +G A LPK++   R++SNL+ +++S
Sbjct: 218 NCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS 256

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  151 bits (382), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 164/305 (53%), Gaps = 29/305 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           +   TLN G K+PL+GLG W++  E     +  A+K GYR  D A    NE+ +G+ IR 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
             D G V+R+ELFV +KLW++ H  ++  AAL ++L  + L+Y+DL+ +H+P+A +    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           K K         ++ +     + +   + T+  +++L  E   ++IG++NFS   +  LL
Sbjct: 122 KEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGG------------P 226
           +    +I P A Q+E HP+L  + ++ + + +G+ + AYS  G                P
Sbjct: 182 RG--CRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 227 LIDEPVIREISKK--LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD---LSDE 281
           L + P I EI+K     + P+Q+L+ W  +   AV+PKS  + R+  NL + D   L+D+
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 282 DYERI 286
           + + I
Sbjct: 300 ELKEI 304

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  150 bits (380), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/322 (30%), Positives = 163/322 (50%), Gaps = 34/322 (10%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           ++  TLN G K+PL+GLG W++ K      I  A+K GYR  D A    NE+ +G    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI +  V R ++FV +KLW+  H       AL ++L  +GL+Y+DLY +H+P+AF+    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     + E     +     + T+  ++K   E   ++IG++NF    +  LL
Sbjct: 122 EEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDG------------GP 226
           +    +I P A Q+E HP+L  + ++ FC+   I + AYS  G                 
Sbjct: 182 RGC--RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQT 239

Query: 227 LIDEPVIREISKKLHV--EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDE 281
           L +  VI+++S+  H     +Q+L+ W  +RG AV+PKS  + R+  NLE+   F L+++
Sbjct: 240 LFENDVIKKVSEN-HTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQ 298

Query: 282 DYERIHEIAQERGPKRTHNPPW 303
           + ++I  +          N PW
Sbjct: 299 ELKKISAL----NANIRFNDPW 316

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  147 bits (370), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 166/315 (52%), Gaps = 24/315 (7%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
            +   LN G K+PL+GLG W++  E   + I  A+  GYR  D A    NE+ +G    +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIRDSGVRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI+D  V+R+ELFV +KLW++ H  ++   AL ++L  +GL+Y+DL+ +H+P+A +    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K          +++     +     + T+  +++   E   ++IGV+NFS   +  LL
Sbjct: 122 EEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGG----DGG--------P 226
           +    +I PAA Q+E HP+L  +  + + + KGI + AYS  G     D G        P
Sbjct: 182 RGA--RIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPP 239

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERI 286
           L +  V+++I+ K +V  +Q+L+ W  ++  AV+PKS  + R+  NL V        + I
Sbjct: 240 LFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEI 299

Query: 287 HEIAQERGPKRTHNP 301
            EI+      R ++P
Sbjct: 300 KEISGLNKNLRFNDP 314

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  144 bits (364), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 150/274 (54%), Gaps = 37/274 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD----- 68
           L  G KIP L LGT+ +      K +  ALK GYRH D+A +  NE+ +G+ I +     
Sbjct: 13  LQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINED 72

Query: 69  -SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
            +  +R+++F TTKLW++Q  + +   A+ + ++++ GL Y+D+ ++H PL+ +  +++ 
Sbjct: 73  KAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRLE- 131

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPNN 183
                                   TW+ MQ+   E   ++IGV+N+    +  LL     
Sbjct: 132 ------------------------TWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDEL 167

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P++   E+  +C+   +++EAY+P+    G  +++P +REISK+  + 
Sbjct: 168 KYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMNDPGLREISKETGMN 225

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD 277
           P QLLI W L+ G   LPK+KT  R+ SNL+V++
Sbjct: 226 PGQLLIRWSLQHGYLPLPKTKTVARLASNLDVYN 259

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  145 bits (365), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 162/321 (50%), Gaps = 32/321 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           ++  TLN G K+PL+GLG W++ K+     I  A+K GYR  D A    NE+ +G    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI +  V R ++FV +KLW+  H       AL ++L  +GL+Y+DLY +H+P+AF+    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     + +     +     + T+  +++   E   ++IGV+NF    +  LL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGG------------P 226
           +    +I P A Q+E HP+L  + ++ FC+   I + AYS  G                 
Sbjct: 182 RGC--RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 227 LIDEPVIREISKKL-HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDED 282
           L +  VI+++S+       +Q+L+ W  +RG AV+PKS  + R+  NLE+   F L++++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 283 YERIHEIAQERGPKRTHNPPW 303
            + I  +          N PW
Sbjct: 300 LKDISAL----NANIRFNDPW 316

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 148/287 (51%), Gaps = 40/287 (13%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI-- 66
           + T TL  G KIP+L LG +   KE     +  ALK+GYRH+D A +  NE+ +G  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---RDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRVD 120
                  V R E+F TTK+    H    A  ++ +SL+ +  +EY+DL ++H P+A   +
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLK 179
           ++                          TW+ +Q+   E K RAIGV+N+S+  L  L  
Sbjct: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
               K+ P  +Q E +P+L   E+  +C +KG+++EA+SPL    G    +P ++E+ K 
Sbjct: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKT 218

Query: 240 LHVE--PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDED 282
            +    PAQ+LI W L+ G   LPKS    R  SNL+   F++SD+D
Sbjct: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  143 bits (360), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 149/280 (53%), Gaps = 39/280 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI-----RD 68
           L+ G KIP + LGT+ + +    + +   +K GYRH D+A +  NE+ +G  I      D
Sbjct: 8   LSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

Query: 69  SGV-RRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
            G  +R+E+F TTKLW++Q  ++   AA+ Q L  + GL+Y+DL ++H PL         
Sbjct: 68  PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL--------- 118

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPNN 183
                     EG          ++TW  MQ+   E   ++IGV+N+    +  LL  P  
Sbjct: 119 ----------EGSKL------RLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPEL 162

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P++   E+  +C+ KG+++EA++PL    G  +  P + ++ K++   
Sbjct: 163 KHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLC--HGYKMTNPDLLKVCKEVDRN 220

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDE 281
           P Q+LI W L+ G   LPK+KT  R+E NL    F+LSDE
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDE 260

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  144 bits (363), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 161/321 (50%), Gaps = 32/321 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR- 67
           ++  TLN G K+PL+GLG W++ K+     I  A+K GYR  D A    NE+ +G+ IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 68  ---DSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
              +  V R ++FV +KLW+  H       AL ++L  +GL+Y+DLY +H+P+AF+    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     + +     +     + T+  +++   E   ++IG++NF    +  LL
Sbjct: 122 EEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGG------------P 226
           +    +I P A Q+E HP+L  + ++ FCR   I + AYS  G                 
Sbjct: 182 RGC--RIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 227 LIDEPVIREIS-KKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDED 282
           L +  VI++IS        +Q+L+ W  +RG AV+PKS  + R+  NLE+   F L++++
Sbjct: 240 LFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 283 YERIHEIAQERGPKRTHNPPW 303
            + I  +          N PW
Sbjct: 300 LKEISAL----NANIRFNDPW 316

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  141 bits (356), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 147/279 (52%), Gaps = 38/279 (13%)

Query: 11  TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI---- 66
           T  L++   IP + LGT+ L      + +  AL  GYRH D+A +  NE+ + + I    
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 67  -RDSGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQI 122
            R    +RDE+F TTKLW++Q  +++   A+ + + ++  L+Y+DL +MH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 KAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSP 181
                        G P +  +     TW  MQ+   E   ++IGV+NF +  L  L +  
Sbjct: 121 -------------GGPQIREE-----TWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWD 162

Query: 182 NNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLH 241
             K  P  +Q+E  P+L   E+  FC+ +G+++EAY+PL    G  I+ P + +IS +L+
Sbjct: 163 GLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLT--HGYKINHPDLIKISNELN 220

Query: 242 --VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
                 Q+LI W L+ G   LPK+KT  R+ESNL+V+D 
Sbjct: 221 NTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDF 259

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  142 bits (358), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/321 (29%), Positives = 162/321 (50%), Gaps = 32/321 (9%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           ++  TLN G K+PL+GLG W++  +     I  A+K GYR  D A    NE+ +G    K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI +  V R ++FVT+KLW+  H       AL ++L  +GL+Y+DLY +H+P+AF+    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     + +     +     + T+  ++    E   ++IG++NF    +  LL
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG------GDGG------P 226
           +    +I P A Q+E HP+L  + ++ +C+   I + AYS  G       D G       
Sbjct: 182 RGC--RIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 227 LIDEPVIREISKKL-HVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV---FDLSDED 282
           L +  V++++S+       +Q+L+ W  +RG AV+PKS  + R+  NLE+     L+D++
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 283 YERIHEIAQERGPKRTHNPPW 303
            + I  +          N PW
Sbjct: 300 LKEISSL----NANIRFNDPW 316

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  139 bits (350), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 144/275 (52%), Gaps = 37/275 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD----- 68
           L++G  IP +GLGT+ L        +  AL+ GYRH D+A +  NE  +G+ I+      
Sbjct: 11  LSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWLNEN 70

Query: 69  -SGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
            +  +R ++F TTKLW +QH    A  A+D  L+ +  L Y+DL ++H PL         
Sbjct: 71  PAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLG-------G 123

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183
           K   L                  +T+E MQ+ +   K R+IGV+N+    +  LL     
Sbjct: 124 KKLRL------------------ETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKL 165

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P+    E+  FC++KGIL+EAY+PL    G  + +P + +++ ++  +
Sbjct: 166 KYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANEVGCD 223

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
             Q LI W L++G   LPK+++ +R+ SNL+VF  
Sbjct: 224 VGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  139 bits (349), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 144/276 (52%), Gaps = 37/276 (13%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI------ 66
            L+ G +IP + LGT+ + +    + +   +K GYRH D+A +  NE+ +G  I      
Sbjct: 7   NLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 67  RDSGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIK 123
                +R+++F TTKLW++Q  ++   AA+ Q L  + GL+Y+DL ++H PL        
Sbjct: 67  NPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 AKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKT-RAIGVANFSVPQLTSLLKSPN 182
                      EG          ++TW+ MQ+   E   ++IGV+N+    +  LL  P+
Sbjct: 119 -----------EGSKL------RLETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPD 161

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242
               P  +Q+E  P++   E+  +C+ KG+++EA++PL    G  +  P + ++ K++  
Sbjct: 162 LTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLC--HGYKMTNPDLLKVCKEVDR 219

Query: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
            P Q+LI W L+ G   LPK+KT  R+E NL  +D 
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDF 255

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  138 bits (348), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 144/276 (52%), Gaps = 37/276 (13%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD---- 68
           T N G +IP + LGT+ + +    K +  ALKAGYRH D+A +  NE  +G+ I      
Sbjct: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 69  --SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIK 123
                +R ++F TTKLW++Q  +     A+ + L ++ GL+Y+D+ ++H PL  R  ++ 
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL- 127

Query: 124 AKNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPN 182
                                   +TW  MQ+ + +   + IGV+N+    +  LL+   
Sbjct: 128 ------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242
             I P  +Q+E  P++   E+  +C+  G+++EA++PL   G  L D  ++R +SK++  
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL-THGYKLHDADLVR-VSKEVGR 221

Query: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
              Q+LI W L+ G   LPK+KT  R+E NLE ++ 
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  138 bits (347), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 147/273 (53%), Gaps = 36/273 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI-----RD 68
           L +G  IP +GLGT+ L        + AAL+ GYRH+D+A +  NE  + +       R 
Sbjct: 9   LASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFLGRH 68

Query: 69  SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKAK 125
             V R+++F TTKLW++Q  +     A+ + ++ + GL Y+DL +MH P+  +  Q++  
Sbjct: 69  PDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGK--QVRR- 125

Query: 126 NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPNNK 184
                                  TW+ MQ+   +   R+IGV+++    L  L +    K
Sbjct: 126 ----------------------GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWSELK 163

Query: 185 IIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEP 244
             PA +Q+E  P++   ++  +C+ KGI++EAYSPL    G  +D+P + +++++    P
Sbjct: 164 HAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEETGKNP 221

Query: 245 AQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD 277
            Q+L+ W L+ G   LPK+KT +R++ NL+VFD
Sbjct: 222 GQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFD 254

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  138 bits (347), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 37/275 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI------R 67
           L++G  +P +GLGT+ L      + +  ALK GYRH+D+A +  NE+ +G+ I       
Sbjct: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71

Query: 68  DSGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
            S  +R+++F  TKLW++Q  + +   A+ +  +++ GL Y+DL ++H PL+    +++ 
Sbjct: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE- 130

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPNN 183
                                   T++ MQ+   +   R+IGV+N+ V  +  LL     
Sbjct: 131 ------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNEL 166

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P+L   E+  +C+ +G+++EAY+PL    G  I+ P +  ++K+    
Sbjct: 167 KYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAGCN 224

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
             Q+LI W L+ G   LPK+K+  R+ SNL+V+++
Sbjct: 225 SGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  137 bits (346), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 144/280 (51%), Gaps = 39/280 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD----- 68
           L+ G KIP + LGT+ + +    + +   +K GYRH D+A +  NE+ +G  I       
Sbjct: 8   LSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNED 67

Query: 69  -SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
               +R ++F TTKLW++Q  +R   AA+ Q L  + GLEY+DL ++H PL         
Sbjct: 68  PKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL--------- 118

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183
                     EG          ++TW  MQ+ +     ++IGV+N+    +  LL     
Sbjct: 119 ----------EGSKL------RLETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSEL 162

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           +  P  +Q+E  P++   E+  +C+ KG+++EA++PL    G  +  P +  + K++   
Sbjct: 163 RHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPLC--HGYKMTNPDLLIVCKEVDRN 220

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDE 281
           P Q+LI W L+ G   LPK++T  R+E NL    F+LSDE
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDE 260

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  137 bits (346), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 154/288 (53%), Gaps = 40/288 (13%)

Query: 8   CTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ----VIG 63
            + T TL  G KIP+LG GT+   KE     + AA K GYRH+D+A +  NE+     + 
Sbjct: 5   ASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVA 64

Query: 64  KAIRDS-GVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRV 119
           K +++S  V RD++F TTK+    H    A  ++ +SL+    LEYVDL+++H P A   
Sbjct: 65  KFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA--- 121

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSLL 178
                         +E +         + T++ +Q+     K +AIGV+++S+  L  L 
Sbjct: 122 -------------ETEKR---------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238
                ++ P  +Q E +P+L   +++ +C+E+ +++EA+SP+         +PV++++ K
Sbjct: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLK 217

Query: 239 KLH--VEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDED 282
           + +    PAQLLI W L+ G   LPKS  + R ESNL    F++S ED
Sbjct: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAED 265

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  137 bits (346), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 144/280 (51%), Gaps = 49/280 (17%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNE----QVIGKAIRDS 69
           LN G ++P++G G + +  E   + +  AL+ GYRHID+A V  N+    Q + + + ++
Sbjct: 15  LNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEET 74

Query: 70  GVRRDELFVTTKLWSTQH-RDPSAALDQSLKRLGLE------YVDLYMMHWPLAFRVDQI 122
           G  R+E++ TTKLW+TQ  RD   A  ++L+ +  +      YVDL ++H PL       
Sbjct: 75  GTPREEVWFTTKLWNTQQGRD---ATPRALEEIAADVKEFIGYVDLLLLHSPLT------ 125

Query: 123 KAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE------KTRAIGVANFSVPQLTS 176
                     +++ +         ++TW ++++   E      + RAIGV+NF V  L  
Sbjct: 126 ----------DAQRR---------LETWAVLERAVQEPASSALEIRAIGVSNFGVRHLQE 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREI 236
           LL+    K  P   QLE HP+LP  E+ AF RE GIL EAYSPL    G  + +P +  +
Sbjct: 167 LLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPLT--QGVRLQDPELLAL 222

Query: 237 SKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVF 276
             K  +   ++L+ W   +G AVL KS    RI  NL V 
Sbjct: 223 EAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  135 bits (339), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 146/280 (52%), Gaps = 39/280 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD----- 68
            + G K+P + LGT+ + +    + +   +K GYRH D+A +  NE+ +G  I       
Sbjct: 8   FSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHED 67

Query: 69  -SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124
               +R+++F TTKLW++Q  ++    A+ Q L  + GL+Y+DL ++H PL         
Sbjct: 68  PENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL--------- 118

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLKSPNN 183
                     EG          ++TW+ MQ+   E   ++IGV+N+    +  LL     
Sbjct: 119 ----------EGSKL------RLETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQL 162

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P++   E+  +C+ K +++EA++PL    G  + +P + ++ K++   
Sbjct: 163 KHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPLCH--GYKMTDPDLLKVCKEVDRN 220

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDE 281
           P Q+LI W L+ G   LPK+KT  R+ESNL    F+LSD+
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDD 260

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  134 bits (338), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 155/289 (53%), Gaps = 45/289 (15%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD---- 68
           T+  G KIP L LG + + +      +  ALK GYRH D+A +  NE+ +G+ I      
Sbjct: 8   TMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKE 67

Query: 69  --SGVRRDELFVTTKLWSTQH------RDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
             +  +R+++F TTKLW++Q+      R  S  +++ +K LG  Y+DL ++H PL+    
Sbjct: 68  DPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNK-VKELG--YIDLLLIHSPLSG--- 121

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLK 179
                     PR              ++T++ MQ+   +   ++IGV+N+    +  L K
Sbjct: 122 ----------PRRR------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYK 159

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
               K  P A+Q+E  P+   +++ ++C+ KG+++EA+SPL    G  + EP +  ++KK
Sbjct: 160 WDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKK 217

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD--LSDEDYERI 286
           L  +  Q+LI W L+RG   LPK++   R+ SNLEV+D  L+ ED + +
Sbjct: 218 LGRDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKEL 266

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  135 bits (340), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 151/289 (52%), Gaps = 24/289 (8%)

Query: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG----K 64
           + T  LN G ++PL+GLG W++  E     +  A+K GYR  D A    NE+ +G    K
Sbjct: 5   SETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIHK 64

Query: 65  AIRDSGVRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQI 122
           AI +  V+R++LFV +KLW++ H  ++   AL ++L+ + LEY+DL+ +H+PLAF+    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVPF 124

Query: 123 KAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLL 178
           + K    F     +++           + T+  +++   E   ++IG++NF    +  LL
Sbjct: 125 EEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHDLL 184

Query: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPV------ 232
                K  P   Q+E HP+L  ++++ +C ++ I + AYS  G      +D  +      
Sbjct: 185 AGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKSTPT 242

Query: 233 ------IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV 275
                 I++I+    V  +Q+L+ W  +R  A++PKS  + R+  NL++
Sbjct: 243 LFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQI 291

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 145/286 (50%), Gaps = 37/286 (12%)

Query: 4   ILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIG 63
           ++ K      L+ G  IP +GLGT+ +        +  ALKAGYRH D+A +  NE+ +G
Sbjct: 1   MVNKVAKFYKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVG 60

Query: 64  KAIRD------SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWP 114
           + I           RR+ +F TTKLW++Q  +   + A+   L ++  LEY+DL ++H P
Sbjct: 61  QGIHRWLLEDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSP 120

Query: 115 LAFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQ 173
           L       K +                     ++TW+ MQ+ +     ++IGV+N+ +  
Sbjct: 121 LG----GTKLR---------------------LETWKAMQEAVDHGMVKSIGVSNYGMHH 155

Query: 174 LTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVI 233
           +  LL     K  P  +Q+E  P+L   E+  +C+   I +E YSPL    G  +++  +
Sbjct: 156 IDELLTWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDL 213

Query: 234 REISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLS 279
           ++++ +      Q+LI W L+ G   LPK++T  R+++NL+V+D +
Sbjct: 214 KKVANETGKNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  132 bits (333), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 155/300 (51%), Gaps = 45/300 (15%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI-----RD 68
           L+ G +IP +GLG ++++++     +  AL+ GYR  DSA    NE  + + I       
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 69  SGVRRDELFVTTKLWSTQH--RDPSAALDQSLKRLG-LEYVDLYMMHWPLAFRVDQIKAK 125
            G RR++++ TTK+ +  H       +L++SL   G L Y+DL ++H P++ R  ++   
Sbjct: 75  PGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG-- 132

Query: 126 NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLKSPNNK 184
                                  TW+ +++   E + R+IGV+N+    L+ LL     K
Sbjct: 133 -----------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLK 169

Query: 185 IIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEP 244
           I P  +Q+E +P+L   E++ +CRE  I ++A+SPL    G  +D+P++++++ +     
Sbjct: 170 IRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLM--RGKRLDDPILQKVAHQYDKGV 227

Query: 245 AQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWF 304
           AQ+L+ W ++ G  VLPK+  + R+  N +++D          E++ E   + TH+  +F
Sbjct: 228 AQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDF---------ELSAETMSELTHSDDYF 278

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  130 bits (326), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 146/275 (53%), Gaps = 37/275 (13%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD----- 68
           L++G  +P LGLGT+ + +    + +  ALKAGYRH+D+A +  NE+ +G+ +       
Sbjct: 12  LSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKED 71

Query: 69  -SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRLG-LEYVDLYMMHWPLAFRVDQIKA 124
               RR ++F TTKLW++Q  + +   A+ + L ++  L Y+D+ ++H PL+    +++ 
Sbjct: 72  PKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRLE- 130

Query: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183
                                   T++ MQ+ +     R+IGV+N+    +  LL     
Sbjct: 131 ------------------------TYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEEL 166

Query: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243
           K  P  +Q+E  P++   ++  +C+ KG+++EA+SPL    G  I  P +  +++++   
Sbjct: 167 KHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEVGRN 224

Query: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
             Q+LI W L+ G   LPKS++  R++ NLEV+D 
Sbjct: 225 TGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDF 259

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  128 bits (322), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 142/276 (51%), Gaps = 37/276 (13%)

Query: 13  TLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRD---- 68
           TL+ G KIP L LGT+ L K      +  ALK GYRH D+A +  NE+ +G+ I      
Sbjct: 8   TLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 69  --SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIK 123
                +R+++F TTKLW++Q  ++    A+ + L+++  L Y+DL ++H PL+    ++ 
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRL- 126

Query: 124 AKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPN 182
                                   +T++ MQ+   E   ++IGV+N+    L  LL    
Sbjct: 127 ------------------------ETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 183 NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHV 242
            K  P  +Q+E  P+    E+  +C+ +GI++E Y+PL    G  + +P + ++++++  
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVGK 220

Query: 243 EPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
              Q+LI W L+ G   LPK+    R+  NL+V+D 
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDF 256

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 155/315 (49%), Gaps = 54/315 (17%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGG-------YKAILAALKA-GYRHIDSAAVCMNEQ 60
            LN G KIP   ++G GT W    E          + I+ AL+  G  HID+A +     
Sbjct: 9   VLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            +GKA+  +   RDE+F+T K +STQ +    P+A L+ SLK++G +YVDLY++H P   
Sbjct: 69  EVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFVS 127

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
           +    +A  F L                  + W+ M++L    K + IGV+NF+V  L  
Sbjct: 128 K----EANGFTL-----------------EEAWKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    K  P  +Q+E  PFL +    +  FC++  IL+EAYSPL          D  P
Sbjct: 167 ILKIAEVK--PQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKP 224

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
             +   ++E+S+K     AQ+++ W  KRG   +  S    RI    NL  FDL+DE+ +
Sbjct: 225 FFE--YVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVD 282

Query: 285 RIHEIAQERGPKRTH 299
            I E+     P R +
Sbjct: 283 EITELGLAHEPLRLY 297

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 155/305 (50%), Gaps = 52/305 (17%)

Query: 16  TGAKIPLLGLGT---WRLTKEGGYK----------AILAALKAGYRHIDSAAVCMNEQVI 62
           +G +IP++G G+   WR+ K  G K           + +A+ AG+ HID+A        +
Sbjct: 13  SGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAYKTHPEV 72

Query: 63  GKAIRDSGVRRDELFVTTKL--WSTQHRD---PSAALDQSLKRLGLEYVDLYMMHWPLAF 117
           G+ +++SGV RD+L++T K   WS   R    P  +L  SL+++ + YVDLY++H P   
Sbjct: 73  GRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLLHVPF-- 130

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTS 176
                       I   + G        D  + W  M+++      + IGV+NF V  L  
Sbjct: 131 ------------ITVQTAGI-------DLKEAWRQMEEIYDRGLAKNIGVSNFDVESLEY 171

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL----GGDGGPLIDE 230
           + K    K +P  +Q+E + +L      ++A+C++  I++E YSPL     G  GPL  +
Sbjct: 172 ITKI--GKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPL--D 227

Query: 231 PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD--LSDEDYERIHE 288
            ++  +++K H    Q+L+ W  + G  V+  S  Q R++ ++ +FD  L+ ED++ I +
Sbjct: 228 KLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSITK 287

Query: 289 IAQER 293
           I +E+
Sbjct: 288 IGREK 292

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  127 bits (319), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 135/277 (48%), Gaps = 43/277 (15%)

Query: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR----DS 69
           LN G +IP++G G + + KE     + +ALK GYRHID+A +  N++   + +R    ++
Sbjct: 15  LNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDET 74

Query: 70  GVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRLG--LEYVDLYMMHWPLAFRVDQIKAK 125
           G  R+ ++ TTKLW +Q    +   AL +    +   + YVDL ++H             
Sbjct: 75  GEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLH------------- 121

Query: 126 NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE------KTRAIGVANFSVPQLTSLLK 179
                PR    +         ++TW ++++   E      + ++IGV+NF V  L  LLK
Sbjct: 122 ----SPRGGAKR--------RLETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELLK 169

Query: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239
               K+ P   QLE HP+LP  E+  + +EK I  EAYSPL    G  + +P +  +  K
Sbjct: 170 VA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAK 225

Query: 240 LHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVF 276
             +  A +L+ W   +G  VL KS    RI  NL V 
Sbjct: 226 TGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVL 262

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 158/315 (50%), Gaps = 54/315 (17%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGG-------YKAILAALK-AGYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W   +E          + I+ ALK  G  HID+A +     
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQ---HRDPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            +GKA+  +   R+E+F+T K +STQ      P+  LD +LK++G +YVDLY++H P   
Sbjct: 69  EVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSP--- 124

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
                       + + + G       +   + W+ M++L  + K + IGV+NF++  L  
Sbjct: 125 -----------FVSKETNG-------FTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLER 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    +I P  +Q+E  PFL +    +  FC+E  IL+EAYSPLG         +  P
Sbjct: 167 ILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLP 224

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
             +   ++E+S+K     AQ+ + W  +RG   +  S    RI    NL  FDL+DE+  
Sbjct: 225 FFE--YVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVN 282

Query: 285 RIHEIAQERGPKRTH 299
           +I E+  E  P R +
Sbjct: 283 QITELGLEHEPLRLY 297

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  126 bits (316), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 157/303 (51%), Gaps = 49/303 (16%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGG---YKAILAALKA------GYRHIDSAAVCMNE 59
           TL+ G KIP   ++G GT W  ++E      + ++  +K       G  HID+A +    
Sbjct: 8   TLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTY 67

Query: 60  QVIGKAIRDSGVRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
             +G A++D+   RDE+F+T K  + +    +P  AL+ SLK+LG++YVDLY++H P+  
Sbjct: 68  PELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPII- 126

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSL 177
                            E K  V+ +W Y++  EL +   + K + IGV+NF+V  L  L
Sbjct: 127 ----------------KESKLDVEANWKYLE--ELYK---SGKAKNIGVSNFAVKDLEKL 165

Query: 178 LKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG------GDGGPLID 229
           L     K  P  +Q+E  PFL +    ++ F ++ GIL+EAYSPLG       D   L  
Sbjct: 166 LAVAEVK--PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPF 223

Query: 230 EPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERIH 287
              I E+SKK +   AQ+L+SW  +RG   +  S    RI+   ++  F L++E+ ++I 
Sbjct: 224 YQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKIT 283

Query: 288 EIA 290
           ++ 
Sbjct: 284 QLG 286

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  125 bits (313), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 153/311 (49%), Gaps = 48/311 (15%)

Query: 14  LNTGAKIP---LLGLGT-WRL---TKEGGYKAILAALKA-----GYRHIDSAAVCMNEQV 61
           LN G ++P   ++G GT W     T E   + ++  LK      G  H+D+A   M  + 
Sbjct: 9   LNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTYRE 68

Query: 62  IGKAIRDSGVRRDELFVTTKLW--STQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRV 119
           +G+A+ ++   RDE+F+T K W  S    +P   L+  LKRLGLEYVDLY++H P     
Sbjct: 69  VGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSP----- 123

Query: 120 DQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSLL 178
                     I + + G       +   + W +M++L  + K + IGV+NF+   L  +L
Sbjct: 124 ---------FISKETNG-------FSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERVL 167

Query: 179 KSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG------GDGGPLIDE 230
           K    K+ P  +Q+E + FL +    +  FC++  I + AYSPLG       DG      
Sbjct: 168 KVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQPFY 225

Query: 231 PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERIHE 288
             I ++++  +  P Q+L+ W  KRG   +  S+ + RI+   E+  FDL D++   I +
Sbjct: 226 SYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVTEITK 285

Query: 289 IAQERGPKRTH 299
           +  +  P R +
Sbjct: 286 LGLDHEPLRLY 296

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  123 bits (309), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 150/287 (52%), Gaps = 39/287 (13%)

Query: 4   ILKKCTA--TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQV 61
           I+ K T      L++G  +P +GLGT+ + +    + +  ALK+GYRH+D+A +  NE  
Sbjct: 7   IMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66

Query: 62  IGKAIRD------SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRLG-LEYVDLYMMH 112
           +G+ I+          +R ++F TTKLW++Q  + +   A+ + ++++  L Y+DL ++H
Sbjct: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126

Query: 113 WPLAFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSV 171
            PL+    +++                         T++ MQ+   E   R+IGV+N+  
Sbjct: 127 SPLSGTRRRLE-------------------------TYKAMQEAVDEGIVRSIGVSNYGK 161

Query: 172 PQLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEP 231
             +  LL     K  P  +Q+E  P++   ++  +C+ KG+++EA+SPL    G  +  P
Sbjct: 162 HHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHP 219

Query: 232 VIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278
            +  ++K+   +  ++LI W L+ G   LPKS++  R++ N++ +D 
Sbjct: 220 DVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF 266

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 149/306 (48%), Gaps = 57/306 (18%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGG---YKAILAALKA-----GYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W  T+E      + ++  LK      G  HID+A +     
Sbjct: 9   TLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            +  A+R+S   RDE+F+T K +STQ +   DP A L+ SLK LGL+YVDLY++H     
Sbjct: 69  EVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLH----- 122

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
                               P++       + W+ M+KL  + K + IGV+NF V  L  
Sbjct: 123 -------------------SPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK     I P  +Q+E +  L +    ++ FC+E  I +EAY+PLG         +  P
Sbjct: 164 ILKIAT--IKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKP 221

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
             D   I E+SKK +   AQ+L+ W  KRG   +  S    R+    NL  FDL   + +
Sbjct: 222 FYD--YIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVD 279

Query: 285 RIHEIA 290
           +I E+ 
Sbjct: 280 KITELG 285

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  122 bits (306), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 155/315 (49%), Gaps = 54/315 (17%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGG-------YKAILAALK-AGYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W   +E          + I+ ALK  G  HID+A +     
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            +GKA+  +   R+ +F+T K +S Q +    P+  LD +LK++G +YVDLY++H P   
Sbjct: 69  EVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP--- 124

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
                       + +   G           + W+ M++L  + K + IGV+NF+V  L  
Sbjct: 125 -----------FVSKEVNG-------LSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQR 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    K  P  +Q+E  PFL +    +  FC+E  IL+EAYSPLG         D  P
Sbjct: 167 ILKVAEVK--PQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQP 224

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
             +   ++E+S+K     AQ+++ W  KRG   +  S    RI    NL  FDL+ E+ +
Sbjct: 225 FFE--YVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVD 282

Query: 285 RIHEIAQERGPKRTH 299
           +I E+  E  P R +
Sbjct: 283 KITELGLEHEPLRLY 297

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  122 bits (306), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 101/320 (31%), Positives = 162/320 (50%), Gaps = 60/320 (18%)

Query: 12  ATLNTGAKIP---LLGLGT-WRLTKEG---GYKAILAALKA-----GYRHIDSAAVCMNE 59
            TLN G K+P   ++G GT W  T+E      + ++  +K      G  HID+A V    
Sbjct: 9   TTLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTY 68

Query: 60  QVIGKAIRDS-GVR-RDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWP 114
             +GKA+R+S  V+ RDE+F+T K +STQ +   +P   L   LK+LGL+YVDLY++H P
Sbjct: 69  PEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSP 127

Query: 115 LAFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQ 173
                          I +   G       +   + W+ M+ L    K + IGV+NFS+  
Sbjct: 128 --------------FISKEKNG-------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMAD 166

Query: 174 LTSLLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLGGDGGPLIDEP 231
           L  +LKS   ++ P  +Q+E + FL +    ++ FCRE  I + AY+PL    GPL  + 
Sbjct: 167 LQRILKSC--EVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPL----GPLQRKS 220

Query: 232 ----------VIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLS 279
                      ++++++K     AQ+L+ W  KRG   +  S  + RI+    L  FDL+
Sbjct: 221 KNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLT 280

Query: 280 DEDYERIHEIAQERGPKRTH 299
           D + E+I ++  +  P+R +
Sbjct: 281 DSEVEKITQLGLKHEPQRMY 300

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  122 bits (306), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 154/315 (48%), Gaps = 53/315 (16%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTK--EGGYKAIL------AALKAGYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W   K   G +   L      A    G  HID+A +     
Sbjct: 9   TLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEMYNTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            + KA++ +   RDE+F+T K +S   +   +P A L +SLK L L+YVDLY++H P   
Sbjct: 69  EVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLHSP--- 125

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTS 176
                       I + S G       +   + W+ M+KL  + K + IGV+NFSV  L  
Sbjct: 126 -----------FITKESCG-------YTMEEAWKQMEKLYKDGKAKNIGVSNFSVDDLKR 167

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    +I P  +Q+E + FL +    ++ FC++  IL+EAYSPLG         D GP
Sbjct: 168 ILKIC--EIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPTDRDPGP 225

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
                 I E++KK      Q+L+ W  KR    +  S  + RI+   +L  FDL+ E+ E
Sbjct: 226 FYQ--YIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTSEEVE 283

Query: 285 RIHEIAQERGPKRTH 299
           +I ++     P R +
Sbjct: 284 KITKLGLAHEPSRLY 298

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 152/290 (52%), Gaps = 40/290 (13%)

Query: 10  ATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQV----IGKA 65
            T  L  G K+P LGLG ++  KE     +  ALK GYR +DSA +  NE+     I K 
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 66  IRDS-GVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRVDQ 121
           + +S  V R ++F TTK+ +      SA  ++++SL R+  L+Y+DL+++H PL      
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT----- 121

Query: 122 IKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSLLKS 180
                      N E +         + TW+  Q+   T K +AIGV+N+ +  L  + + 
Sbjct: 122 -----------NKEKR---------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240
              KI P  +Q E +P+L   E+  +C +KG++++AYSPL       + +P + ++ +  
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219

Query: 241 HVE--PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERI 286
           + E   AQ+L++W L+ G   L K+  + R++ N++   F+LS  D +++
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  119 bits (297), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 150/306 (49%), Gaps = 52/306 (16%)

Query: 15  NTGAKIPLLGLGT---WRLTKEGGYK----------AILAALKAGYRHIDSAAVCMNEQV 61
            +G K+P++G G+   WR+ K  G K           +  A+KAG+ HID+A        
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  IGKAIRDSGVRRDELFVTTKL--WS---TQHRDPSAALDQSLKRLGLEYVDLYMMHWPLA 116
           +G  I +SGV R++L+VT K   WS    + + P  +L+ SL ++ ++YVDLY++H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPF- 130

Query: 117 FRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLT 175
                        I   + G        D  + W  M+++      + IGV+NF V  L 
Sbjct: 131 -------------INPETAGI-------DLKEAWRQMEEIYDRGWAKNIGVSNFDVESLE 170

Query: 176 SLLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL----GGDGGPLID 229
            +      K  P  +Q+E   ++      ++++C++ GI +E YSPL     G  GPL D
Sbjct: 171 YI--RTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDD 228

Query: 230 EPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD--LSDEDYERIH 287
             ++  ++KK      Q+L+ W ++ G   +  S  Q RI+ +L++FD  LS ED+  I 
Sbjct: 229 --ILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSIT 286

Query: 288 EIAQER 293
           E+ + +
Sbjct: 287 EVGKTK 292

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  117 bits (294), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 154/317 (48%), Gaps = 51/317 (16%)

Query: 13  TLNTGAKIP---LLGLGT-W--------RLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W          +KE   +   A    G  H+D+A      Q
Sbjct: 28  TLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQ 87

Query: 61  VIGKAIRDSGVRRDELFVTTKLWST--QHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR 118
            +G+A+R+S   RDE+F+T K   T   H       +  +K++G++YVDLY++H PL   
Sbjct: 88  ELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPLI-- 145

Query: 119 VDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSL 177
               K KN + +                 + W+ ++KL    K + IGV+NF V  L  +
Sbjct: 146 ---EKEKNGVTLE----------------EVWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 178 LKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG------GDGGPLID 229
           LK    K+ P  +Q+E H FL +    ++ F ++  I +EAY+PLG       D G   +
Sbjct: 187 LKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYN 244

Query: 230 EPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIES--NLEVFDLSDEDYERIH 287
              + E++KK     AQ+L+ W  +R    +  S    RI++  +L  FDL+DE+ ++I 
Sbjct: 245 --YVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKIT 302

Query: 288 EIAQERGPKRTH-NPPW 303
           E+  +  P R + N  W
Sbjct: 303 ELGLKHKPLRLYWNDVW 319

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  115 bits (289), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 148/305 (48%), Gaps = 52/305 (17%)

Query: 16  TGAKIPLLGLGT---WRLTKEGG-----YKAILA-----ALKAGYRHIDSAAVCMNEQVI 62
           +G  +P +G G+   WR+ K  G     Y   LA     A++ G+ HID+A      + +
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GKAIRDSGVRRDELFVTTKL--WSTQHRDPSAALDQ---SLKRLGLEYVDLYMMHWPLAF 117
           G  I ++ V R+ L++T K   WS + R  S  L+    SLK + L+YVDLYM+H P   
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVP--- 130

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTS 176
               I  K   +               D  + W  M+++ T K  R IGV+NF V  L  
Sbjct: 131 ---NITTKTAGI---------------DLKEAWLQMEEIYTRKMARNIGVSNFDVESL-E 171

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL----GGDGGPLIDE 230
            +KS   K  P  +Q+E   ++      +L +CRE  I++E YSPL     G  GPL  +
Sbjct: 172 YIKS-FAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPL--D 228

Query: 231 PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFD--LSDEDYERIHE 288
            ++  I+ K      Q+L+ W  + G  V+  +  + R+  +L +FD  LS ED+++I  
Sbjct: 229 EILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQITN 288

Query: 289 IAQER 293
           + +E+
Sbjct: 289 VGREK 293

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  114 bits (286), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 150/319 (47%), Gaps = 56/319 (17%)

Query: 10  ATATLNTGAKIP---LLGLGT-WRLTKEGGY--------KAILAALKAGYRHIDSAAVCM 57
           A  TLN G K+P   ++G GT W   KE  +        +   A    G  HID+A +  
Sbjct: 6   AFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYG 65

Query: 58  NEQVIGKAIRDSGVRRDELFVTTK--LWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPL 115
               +  A+R +   R E+F+T K  L +   +DP A L+ SLK   L+YVDLY++H P 
Sbjct: 66  TYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHSPF 125

Query: 116 AFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQL 174
                             ++ KP +  +      W  M++L  + K + IGV+NFSV  L
Sbjct: 126 V-----------------AKEKPGLTLE----GAWRQMEQLYKDGKAKNIGVSNFSVEDL 164

Query: 175 TSLLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLGGDGGPLI---- 228
             +L     +I P  +Q+E HPFL +    +L FC+++ I +EA++PL    GPL     
Sbjct: 165 KRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPL----GPLQVKTQ 218

Query: 229 -DE-----PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRI--ESNLEVFDLSD 280
            DE       I  +S K     AQ+++ W  KRG   +  S+   RI    NL  FDL D
Sbjct: 219 EDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLED 278

Query: 281 EDYERIHEIAQERGPKRTH 299
           E+  +I  +  +  P R +
Sbjct: 279 EEVTKITRLGLQHPPVRCY 297

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  114 bits (284), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 145/306 (47%), Gaps = 54/306 (17%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGGYKAILAALKA--------GYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W   +E       A +K         G  H+D A V     
Sbjct: 9   TLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
              +A++++   R+E+FVT K +S Q +   DP   LD  LKR GLEYVDLY++H P A 
Sbjct: 69  EFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFA- 126

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTS 176
                K KN   I                 + W  +++L  E K + IGV+NF V  L  
Sbjct: 127 ----SKEKNGFTIE----------------EAWAQLEELYHEGKAKNIGVSNFRVEDLEK 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    K+ P  +Q+E   FL +    ++ F ++  I +EAY+PLG            P
Sbjct: 167 ILKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKP 224

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
             D   I+++++K     AQ+L+ W  KRG   +  S    RIE   NL  FDL+ ++ +
Sbjct: 225 FYD--YIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVD 282

Query: 285 RIHEIA 290
            I ++ 
Sbjct: 283 EITKLG 288

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  111 bits (278), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 143/305 (46%), Gaps = 52/305 (17%)

Query: 16  TGAKIPLLGLGT---WRLTKEGG----------YKAILAALKAGYRHIDSAAVCMNEQVI 62
           T   IP+LG GT   WR+ K  G             ++ A+  G+ HID+A   +  + +
Sbjct: 14  THTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEV 73

Query: 63  GKAIRDSGVRRDELFVTTKL----WS-TQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
           G+A+R S + RD+LF+T K     W+      P  A  + L+ LG++Y DLYM+H P   
Sbjct: 74  GEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP--- 130

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
               I  +N  +               D  + W  +++L      +AIGV+NF +  L  
Sbjct: 131 ---DITKENAGI---------------DLQEAWRQVEELYEAGIAKAIGVSNFPLETLKQ 172

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG----GDGGPLIDE 230
           +      + +P   Q+E HP+L +    ++ +C+ K I++EAYSPL        GPL D 
Sbjct: 173 M--ESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAPLFRARPGPLDD- 229

Query: 231 PVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERIHE 288
            ++  + KK      Q+++ W + RG   L  S  + RI   L    F+L   D E I+E
Sbjct: 230 -ILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVELINE 288

Query: 289 IAQER 293
           +  ++
Sbjct: 289 VGSKK 293

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 154/315 (48%), Gaps = 57/315 (18%)

Query: 13  TLNTGAKI---PLLGLGT-WR-------LTKEGGYKAILAALKAGYRHIDSAAVCMNEQV 61
           TLN G KI    ++G GT W+       L+ E   +A  A    G  H+D+A        
Sbjct: 9   TLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPE 68

Query: 62  IGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAFR 118
           + KA+++S   R+E+F+T K +ST  +   +P  AL+ +L  LGL+YVDLY++H+P    
Sbjct: 69  LNKALKESSKPRNEIFITDK-FSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP---- 123

Query: 119 VDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLL 178
                       P   +    ++T W      EL+ K    K + IGV+NFS+  L  ++
Sbjct: 124 ---------EFDPEYKDLS--IETAW-----MELLYK--EGKAKNIGVSNFSIEHLERVM 165

Query: 179 KSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLGGDGGPLIDEP----- 231
           K  + K  P  +Q+E + FL +    ++ +C++ G  +EAYSPL     PL  +P     
Sbjct: 166 KIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL----APLQRKPKNFNE 219

Query: 232 -----VIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRI--ESNLEVFDLSDEDYE 284
                 I E+S K     +++L+ W  KRG   +  S    RI    NL  FDL+DE+ +
Sbjct: 220 LPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVD 279

Query: 285 RIHEIAQERGPKRTH 299
           +I ++  E+   R +
Sbjct: 280 KITKLGLEQPALRLY 294

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  109 bits (272), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 153/323 (47%), Gaps = 60/323 (18%)

Query: 14  LNTGAKIP---LLGLGTWRLTKEGG--------YKAILAALK-AGYRHIDSAAVCMNEQV 61
           LN G +IP   ++G GT    + G          + I  AL   G  HID+A        
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 62  IGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAFR 118
           + KA+++S   R E+F+T K +STQ +   DP   L+  LK LGL+YVDLY++H P    
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPFF-- 126

Query: 119 VDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSL 177
                              P         K W+ M+ L  E K ++IGV+NFSV  +  +
Sbjct: 127 ------------------DPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEI 168

Query: 178 LKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLGGDGGPLIDEP---- 231
           LK     I P  +Q+E + FL +    ++ +C++  I +EAYSPL    GPL   P    
Sbjct: 169 LKIAG--IKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPL----GPLQKRPENSN 222

Query: 232 ------VIREISKKLHVEPAQLLISWGLKRGC-AVLPKSKTQTRIES-NLEVFDLSDEDY 283
                  I E++ K     +Q+L++W   RG   +   SKTQ  I++ N+  F+L+ ++ 
Sbjct: 223 ELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEV 282

Query: 284 ERIHEIAQERGPKRTHNPPWFSF 306
           + + ++  E+   R +   W +F
Sbjct: 283 DTLTKLGLEQPALRIY---WTNF 302

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  108 bits (269), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 146/306 (47%), Gaps = 54/306 (17%)

Query: 13  TLNTGAKIP---LLGLGT-WRLTKEGGYK--------AILAALKAGYRHIDSAAVCMNEQ 60
           TLN G KIP   ++G GT W  T+E   K           A    G  HID+A +     
Sbjct: 9   TLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYP 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHR---DPSAALDQSLKRLGLEYVDLYMMHWPLAF 117
            +GKA+R++   R+E+++T K +ST  +   +P    +  LK LG++Y+DLY++H P   
Sbjct: 69  ELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSP--- 124

Query: 118 RVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTS 176
                    F+   RN          +   + W+ +++L  + K + IGV+NF+   L  
Sbjct: 125 ---------FITEGRNG---------FTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLER 166

Query: 177 LLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPLG--------GDGGP 226
           +LK    +I P  +Q+E   FL +    +  F +E  IL+EAYSPLG         D  P
Sbjct: 167 ILKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLP 224

Query: 227 LIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIE--SNLEVFDLSDEDYE 284
                 I E+++K     AQ+L+ W  KRG   +  S    R+    ++  FDL+  + E
Sbjct: 225 FYK--YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVE 282

Query: 285 RIHEIA 290
           +I E+ 
Sbjct: 283 KITELG 288

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score = 98.2 bits (243), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 150/316 (47%), Gaps = 52/316 (16%)

Query: 9   TATATLNTGAKIP---LLGLGT--WRLTKEGGY-----KAILAALKA-GYRHIDSAAVCM 57
           T+  TLN G KIP   ++G GT  ++   E  Y     K I  AL+  G  HID A +  
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 58  NEQVIGKAIRDSGVRRDELFVTTKLWSTQH--RDPSAALDQSLKRLGLEYVDLYMMHWPL 115
               +G+A+R+S   RDE+F+T K    +    +P   L  +L+++GLEYVDLY++H+P+
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 116 AFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQL 174
                              + K Y   D+   + W++M+ L  E   + IGV+NF V  L
Sbjct: 125 I------------------DPKLY---DFTLEEAWKMMEDLYNEGLAKNIGVSNFRVEDL 163

Query: 175 TSLLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL-------GGDGG 225
             L KS    I P  +Q+E + +L +    +  +C +  I +EA+ PL         D  
Sbjct: 164 EQLSKSW--VIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLL 221

Query: 226 PLIDEPVIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDY 283
           PL     ++++++K      Q+++ W  +R    +  S    R+    ++  F+L+ ++ 
Sbjct: 222 PL----YVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEV 277

Query: 284 ERIHEIAQERGPKRTH 299
           E I ++  +    R +
Sbjct: 278 EFITKLGSQHDTIRKY 293

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 87.4 bits (215), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/315 (28%), Positives = 146/315 (46%), Gaps = 56/315 (17%)

Query: 13  TLNTGAKIPLL---GLGTWRLTK----EGGYKAILAALKA-----GYRHIDSAAVCMNEQ 60
           TLN G  IP +   G+G  + TK      G K ++  LK      G+ HI +A    N  
Sbjct: 10  TLNNGNSIPAITTVGVGN-KWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNG 68

Query: 61  VIGKAIRDSGVRRDELFVTTKLWST--QHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFR 118
           ++  A++ S   R E+++T K  S       P  AL++SL RLG +YVDLY++H P    
Sbjct: 69  LLSAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNPCL-- 126

Query: 119 VDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLL 178
                         +S     ++  W   K  EL+ K  T K + IGV+NF +  L  L 
Sbjct: 127 -------------DSSPNGISLEKAW---KQMELLYK--TGKVKNIGVSNFRIEDLERL- 167

Query: 179 KSPNNKIIPAASQLETHPFLPHD--EMLAFCREKGILMEAYS---PLGGDGGPLIDEPVI 233
              + +I P  +++E H FL +    +  + +   +L+  YS   PL       +D P  
Sbjct: 168 --KDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFY 225

Query: 234 REI---SKKLHVEPAQLLISWGLKRGC-AVLPKSKTQTRIE-----SNLEVFDLSDEDYE 284
           R I   ++K +   AQ+L+ W     C  VLP   T T+++     S++  F+L+ E+ +
Sbjct: 226 RYIIGLAEKYNKTEAQILLHW---MNCLGVLP-VITNTKVKWYKEASDIISFELTSEELD 281

Query: 285 RIHEIAQERGPKRTH 299
            I E+ ++  P R H
Sbjct: 282 MITELGKKHKPHRKH 296

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 4/77 (5%)

Query: 14 LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIR----DS 69
          LN G +IP++G G + + KE     + +ALK GYRHID+A +  N++   + +R    ++
Sbjct: 15 LNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLDET 74

Query: 70 GVRRDELFVTTKLWSTQ 86
          G  R+ ++ TTKLW +Q
Sbjct: 75 GEARENIWFTTKLWDSQ 91

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (43%), Gaps = 42/202 (20%)

Query: 50  IDSAAVCMNEQV---IGKAIRDSGVRRDELFVTTKLWSTQHRDPSAAL----DQSLKRLG 102
           ID AA  + +Q    +G+A+  +   + E+F+T K  S+   + SA L    D +LK++ 
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKKIS 64

Query: 103 LEYVDLYMMHWPLAFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKTR 162
           +EYVD++ +H P  F+  Q    N                  D + T  L +   + K  
Sbjct: 65  VEYVDMHFLHSPFVFK--QANVLNL----------------KDAMHTDHLRR---SNKAN 103

Query: 163 AIGVANFSVPQLTSLLKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL 220
             G ++ +V +L  +LK+ + +  P  +Q++    L +    +   C+E  ILM  YS L
Sbjct: 104 NRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

Query: 221 G--------GDGGPLIDEPVIR 234
                     D  P  + P  R
Sbjct: 162 DPLQRKNARNDSQPFSNTPENR 183

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 23/109 (21%)

Query: 25  LGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQV---IGKAIRDSGVRRDELFVTTK 81
           +GT  + KE  +K + A  +AG   ID+A    NEQ    IG+ + +S   RD++ + TK
Sbjct: 47  MGT--MDKERAFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWM-ESRKLRDQIVIATK 103

Query: 82  L-----WSTQHRDPSA------------ALDQSLKRLGLEYVDLYMMHW 113
                 W    ++ SA            ++  SL++L  +++D+  +HW
Sbjct: 104 FSTDYKWYDVGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 67/331 (20%), Positives = 126/331 (38%), Gaps = 56/331 (16%)

Query: 15  NTGAKI-PLL------GLGTW----RLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ--- 60
           NTG K+ PL+      G  TW    +  KE  +K +  A   G R  D+A V  N Q   
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
           ++G+ +R   + R+ + + TKL      +           + L  V++  +     F   
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 121 QIKAK---NFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTS 176
           +   K    ++ I +   G P    D  + +T   +  +  E  TR +G +     +   
Sbjct: 131 RASVKRLGTYIDILQIHRGDP----DTPFEETMGALNDVVIEGLTRYVGASLMLATEFAE 186

Query: 177 L--LKSPNNKIIPAASQLETHPFLPHDE--MLAFCREKGILMEAYSPL--GGDGGPLIDE 230
           +  +   +       SQ   H     DE  ++ F +   I +  +SPL  G    PL  E
Sbjct: 187 MQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTE 246

Query: 231 PV--------------------------IREISKKLHVEPAQLLISWGLKRGCAVLPKSK 264
                                       + ++S K ++  + + ++W L++GC  +    
Sbjct: 247 TTRSNSDSVIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFS 306

Query: 265 TQTRIESNLEVFD--LSDEDYERIHEIAQER 293
           +  R+E  ++  D  L++E+ + + E  Q R
Sbjct: 307 SIERVEEAIDALDVNLTEEEMKYLEEPYQHR 337

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 29/47 (61%)

Query: 233 IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLS 279
           + E++KK +V  A +  +W +++GCA +    +  R++ N++  D+S
Sbjct: 277 VEEMAKKKNVSMAVIATAWVIQKGCAPILGMSSIARVDDNIKALDVS 323

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 21/104 (20%)

Query: 30  LTKEGGYKAILAALKAGYRHIDSAAVCMNEQV---IGKAIRDSGVRRDELFVTTKL---- 82
           + K   ++ +    +AG   ID+A  C NEQ    IG+ I+   +R D++ + TK     
Sbjct: 47  MNKNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRLR-DQIVIATKFIKSD 105

Query: 83  ------------WSTQH-RDPSAALDQSLKRLGLEYVDLYMMHW 113
                       +   H R    ++  SL++L  +++D+  +HW
Sbjct: 106 KKYKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 10/82 (12%)

Query: 41  AALKAGYRHIDSAAVCMNEQV-IGKAIRDSGVR--RDELFVTTKL--WSTQHRDPSA--- 92
            A + G   ID++    N ++ IGKA+ + G +  RD   + TK+   S    D SA   
Sbjct: 32  VAFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNV 91

Query: 93  --ALDQSLKRLGLEYVDLYMMH 112
             ++ +S KRL  +Y+DL  +H
Sbjct: 92  RRSVVRSCKRLNSDYLDLVYLH 113

>NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON} 
          Length = 339

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 125/332 (37%), Gaps = 69/332 (20%)

Query: 15  NTGAKIPLLGLG----------TWRLT-KEGGYKAILAALKAGYRHIDSAAVCMN---EQ 60
           N+G KI  L +G          +W +  K+  ++ +      G R  D+A    N   E+
Sbjct: 11  NSGLKISPLIIGCMTFGSTKWNSWLMEDKQEVFRLLKYCYDQGLRTFDTADQYSNGQSER 70

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120
           ++G+ +R   ++R+ + + TK++     D +  + QS+K    E          LA  V+
Sbjct: 71  ILGEFLRFYNIKRETVVIMTKIFF--EVDETLDVPQSIKTANDEI--------KLAV-VN 119

Query: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEKT-------------RAIGVA 167
           Q       +I   S     + T  D ++      + P E+T             R IG +
Sbjct: 120 QRGLSRKHIIAGVSNSCDRLGTYIDVLQIHRYDPETPMEETMRALNDVINSGEVRYIGAS 179

Query: 168 NFSVPQLT--SLLKSPN--NKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLG-- 221
                Q      +   N  +K +   SQ          E++ F +   I +  YSP    
Sbjct: 180 RMLATQFAEYQFIAGKNGWHKFVNWQSQYNLLYREDEREVIPFAKRHNIALTPYSPNAKG 239

Query: 222 -------------GDGGPLI------DEPVI---REISKKLHVEPAQLLISWGLKRGCAV 259
                        G G P +      D  ++   R+++ + +V  AQ+ +SW L +GC  
Sbjct: 240 ILTRPWGSSTERTGKGDPRLKMLMKCDREIVERVRQLADRKNVSMAQISLSWILHKGCYP 299

Query: 260 LPKSKTQTRIES---NLEVFDLSDEDYERIHE 288
           +    +  R++     L+   LS ED   + E
Sbjct: 300 IIGVNSIPRVQEAVVALQELSLSSEDISFLEE 331

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 233 IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL--SDEDYERIHE 288
           I E++KK +V  A +  +W + +GCA +    +  R++ N++  D+  ++E+ + + E
Sbjct: 277 IEELAKKKNVSMAVISAAWVISKGCAPIIGMSSIARVDDNIKALDVQFTNEEMKYLEE 334

>ACR244C Chr3 complement(789953..790855) [903 bp, 300 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR062W
           (TFA2)
          Length = 300

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 113 WPLAFRV-DQIKAKNFMLIPRNSE-----------GKPYVDTDWDYVKTWE 151
           WP  F V D+++ KN +L+ R  +           G P  + D D+VK WE
Sbjct: 185 WPQCFEVIDELEKKNRILVSRTKKDNSPRFVWYNFGGPLGEIDEDFVKMWE 235

>CAGL0I01584g Chr9 complement(125729..127897) [2169 bp, 722 aa] {ON}
           similar to uniprot|P46673 Saccharomyces cerevisiae
           YJR042w NUP85 nuclear pore protein
          Length = 722

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 146 YVKTWELMQK---LPTEKTRAIGVANFSVPQLTSLLKSPNNKIIPAASQLETHPFLPHDE 202
           Y+ + EL+Q+   L   KT  I V N   P  T+ LK   N I P    LE+        
Sbjct: 346 YIPSEELIQEYVGLAVSKT-PIDVTN---PWETACLKILQNDIFPVLPILESLDNCTASF 401

Query: 203 MLAFCREKGILMEAYSPLGGDGG 225
             A C  KG+L++ Y+ L  + G
Sbjct: 402 SAALCESKGLLIDRYTILEENSG 424

>CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 346

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 233 IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERIHE 288
           + E++KK +   A +  SW L +GC  +    +  R++  +    F+LSDED + I E
Sbjct: 280 VEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYIEE 337

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 22/99 (22%)

Query: 15  NTGAKIPLLGLGTWRL-----------TKEGGYKAILAALKAGYRHIDSAAVCMN---EQ 60
           NTG KI  + +G                KE  +  +      G R  D+A V  N   E+
Sbjct: 12  NTGIKISPIIVGCMSYGSKEWAPWVQDDKEKVFTILKHCYDRGLRTFDTADVYSNGYSER 71

Query: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLK 99
           ++G+ ++   +RR+ + + TKL+        A +D+SLK
Sbjct: 72  LLGEFLKKYNIRRETVVILTKLF--------APVDESLK 102

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 233 IREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL--SDEDYERIHE 288
           + E+SKK +V  A +  +W L +GCA +    + +R++  +   D+  ++E+ +++ E
Sbjct: 278 VEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETKQLEE 335

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 14/83 (16%)

Query: 15  NTGAKIPLLGLGT----------WRLT-KEGGYKAILAALKAGYRHIDSAAVCMN---EQ 60
           NTG KI  + +G           W +  KE  +K +  A   G R  D+A V  N   E+
Sbjct: 48  NTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSNGLSER 107

Query: 61  VIGKAIRDSGVRRDELFVTTKLW 83
           ++G+ +R   + R+ + + TK++
Sbjct: 108 ILGEFLRHYNINRETVVILTKVF 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,849,676
Number of extensions: 1392004
Number of successful extensions: 3984
Number of sequences better than 10.0: 133
Number of HSP's gapped: 3711
Number of HSP's successfully gapped: 144
Length of query: 308
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 199
Effective length of database: 40,982,805
Effective search space: 8155578195
Effective search space used: 8155578195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)