Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214225.435ON78278241860.0
KLTH0F16038g5.435ON79280315730.0
SAKL0G02552g5.435ON8344146913e-78
ZYRO0F10054g5.435ON6606895955e-66
NCAS0F033905.435ON8618225491e-58
TDEL0E019005.435ON7628035283e-56
Ecym_47615.435ON7986835125e-54
KAFR0E038305.435ON8457555022e-52
CAGL0A02838g5.435ON8287164651e-47
AER402C5.435ON8699044446e-45
TBLA0A028205.435ON9257583985e-39
NDAI0B056805.435ON8567413951e-38
Kpol_1016.55.435ON8127383832e-37
KLLA0E02201g5.435ON8354163602e-34
YDR369C (XRS2)5.435ON8544052942e-26
Smik_4.6355.435ON8634262745e-24
Suva_2.5415.435ON8694152585e-22
TPHA0J025905.435ON7756902532e-21
Skud_4.6385.435ON8431432442e-20
KNAG0C049005.435ON7694012433e-20
Skud_4.3498.223ON867115734.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21422
         (782 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...  1617   0.0  
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   610   0.0  
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   270   3e-78
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   233   5e-66
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   216   1e-58
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   207   3e-56
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   201   5e-54
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   197   2e-52
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   183   1e-47
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   175   6e-45
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   157   5e-39
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   156   1e-38
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   152   2e-37
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   143   2e-34
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   117   2e-26
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   110   5e-24
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   103   5e-22
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   102   2e-21
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...    99   2e-20
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    98   3e-20
Skud_4.349 Chr4 (598175..600778) [2604 bp, 867 aa] {ON} YDR089W ...    33   4.6  

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 1617 bits (4186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/782 (100%), Positives = 782/782 (100%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120
           VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120

Query: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQI 180
           QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQI
Sbjct: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQI 180

Query: 181 NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLWL 240
           NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLWL
Sbjct: 181 NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLWL 240

Query: 241 CDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFR 300
           CDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFR
Sbjct: 241 CDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFR 300

Query: 301 IHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRK 360
           IHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRK
Sbjct: 301 IHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRK 360

Query: 361 RTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIG 420
           RTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIG
Sbjct: 361 RTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIG 420

Query: 421 ALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILEN 480
           ALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILEN
Sbjct: 421 ALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILEN 480

Query: 481 DNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTREAKRPVSFAQAVKETKSHEVDRLEK 540
           DNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTREAKRPVSFAQAVKETKSHEVDRLEK
Sbjct: 481 DNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTREAKRPVSFAQAVKETKSHEVDRLEK 540

Query: 541 DIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKL 600
           DIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKL
Sbjct: 541 DIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKL 600

Query: 601 WPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATC 660
           WPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATC
Sbjct: 601 WPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATC 660

Query: 661 PSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFV 720
           PSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFV
Sbjct: 661 PSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFV 720

Query: 721 FDEEDSQRDHVDTYTDAVQSRSASGARYQQPEPSISASKNCAPQDSDESDDEPRFQFQSR 780
           FDEEDSQRDHVDTYTDAVQSRSASGARYQQPEPSISASKNCAPQDSDESDDEPRFQFQSR
Sbjct: 721 FDEEDSQRDHVDTYTDAVQSRSASGARYQQPEPSISASKNCAPQDSDESDDEPRFQFQSR 780

Query: 781 KR 782
           KR
Sbjct: 781 KR 782

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/803 (43%), Positives = 491/803 (61%), Gaps = 33/803 (4%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRYQY+   G ++ VSCCLK+G QY +GRS K+PLQIK DKSISR HV+LEV Q+  
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120
           + +   GKLTK+ G +VK  Q L+F AD+ V  EMGA P+K TV  + + WKIPHDL+++
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120

Query: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQI 180
           +SL  HL+ +DIQVTNSL+S TS+QIIK+  KS  NCLF+L+K IPI+ E FIGDFV+Q 
Sbjct: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFVSQF 180

Query: 181 NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLWL 240
            D   DFD++W+++ ++NA F   + +   F  ++F+VTN++ FAI+K IIDAGSG LWL
Sbjct: 181 ADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGNLWL 240

Query: 241 CDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFR 300
           C D+SNL  FI+ +I S+NV++L+HL     +++S EQ++ + +QEAKLLKNKA++LGF+
Sbjct: 241 CGDVSNLGTFIEKQIKSENVVILIHLIEEAPALAS-EQNNSMHIQEAKLLKNKARSLGFK 299

Query: 301 IHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRK 360
             DVNDIV AVL ++   LL+RVP      +   G  +  +   + I  AD P   NKRK
Sbjct: 300 TRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADI-VADAPNLRNKRK 358

Query: 361 RTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEF-AEGEPSPKKAR- 418
           R NRQ+ PL+SLAFFGGGS+   K      P  E+  E  +        E  P  KK R 
Sbjct: 359 RANRQIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSKKPRE 418

Query: 419 ----IGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEG 474
               + +         SE  + +  VQ  S+  +  +A + I      K    T      
Sbjct: 419 EKNTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVI-----SKEDESTHTDERN 473

Query: 475 HTILENDNNSLNIESGPLPKTK---STSLGNEAAQ----AQADAVQTREAKRPVSFAQAV 527
            T++ +  ++  +    + K +   S +L NEA      + AD  + +  KRP S  QA 
Sbjct: 474 KTLVNSAKDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHAD-TEVQAIKRPRSLIQAF 532

Query: 528 KETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSG--GS 585
           +E K HEV RL+K++ +V SEELTEEAINKLD LA VE  DLMR   E           +
Sbjct: 533 QEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTN 592

Query: 586 EQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDS 645
            QWA RKNFKKFVKLWPS SSR+SPD+ T+A+RN+A+LITR+YV L PY+G   N+ DD 
Sbjct: 593 PQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPYDGTRNNSADDG 652

Query: 646 FLKNSQDDLQEEATCPSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGPDGGLGQRNQH 705
           F    Q     E +  +  P  +  +LGVEV++ PAF F+SQ+  ++   +    + +  
Sbjct: 653 FGDACQQHAAAEQSNLTASP-GNLALLGVEVENGPAFAFQSQRAANSQA-NSLFNETDNR 710

Query: 706 TSVDKDSNRDQELFVFDEEDSQRDHVDTYTDAVQ---SRSASGARYQQPE----PSISAS 758
              ++   R+QELFV DE+DSQ   V  Y++ V    SR     +  QP+    P +++ 
Sbjct: 711 RVEERSPERNQELFVVDEDDSQ-PQVACYSNNVSQVPSRLEDADQSLQPDERRVPRVASL 769

Query: 759 KNCAPQDSDESDDEPRFQFQSRK 781
           +N    +SD+SDDEP+F+FQSR+
Sbjct: 770 RNTVQHESDDSDDEPQFRFQSRR 792

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  270 bits (691), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 152/414 (36%), Positives = 232/414 (56%), Gaps = 41/414 (9%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRY+Y   +G    +SCCLKQGL Y IGRSTK+PL IK+DKSISR H++L+V++   
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120
           + L   GKLT ++ + +   Q L F    ++  E+G  PI AT+  Q   WK+ HDL  +
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120

Query: 121 QSLSRH-LADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVTQ 179
               R     + I VT ++S+ T++QIIK +  ++SNCLFSL+K I I+RE F+ DF + 
Sbjct: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180

Query: 180 INDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTLW 239
           +     D+D  W  ++ ++  FPN+      F  I  +V ++  + +FK+ I+   G L 
Sbjct: 181 LYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGGELL 240

Query: 240 LCDDISNLDHFIKHKITSDNVILLVHL------NNGKSSISSTEQSSDLDVQEAKLLKNK 293
            C+++   + FI+    S +VI+L H+      N+  S+I  +E     D ++ + LK  
Sbjct: 241 YCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSE-----DARKLEELKAA 295

Query: 294 AQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVR------------NLPSK---------- 331
           A++LG+++HDVND+V AVL  +  +LLE++P +             LP K          
Sbjct: 296 AESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPD 355

Query: 332 -----APTGFPLEEATNKSVIKSADTPKPSNKRKRTNR-QVVPLDSLAFFGGGS 379
                AP    LE +T ++  +  +   P  KRKRTNR +V PLDSL FF GG+
Sbjct: 356 KVSETAPFKGQLENSTARNDFEIMEQKIPV-KRKRTNRSKVRPLDSLDFFAGGN 408

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  233 bits (595), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 191/689 (27%), Positives = 315/689 (45%), Gaps = 84/689 (12%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRYQY   +G   HVSCCL+ G  Y+IGRS+KN L IK+DKSISR HV +  D   +
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWD-GKD 59

Query: 61  VVLRVV--GKLTKVSGKSVKAGQHLQFTADE-EVLFEMGASPIKATVVKQQSFWKIPHDL 117
             L+++  GK+T VS K +K G+ + F      VL E+G  P+K  +    S W +P   
Sbjct: 60  RQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG- 118

Query: 118 SLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFV 177
             S+S    L +  I+V +S  S  ++ I+ D  +++S  L+ L+K IP++   F+    
Sbjct: 119 --SRSDHSALEELGIEVLSSELSRANL-IVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVS 175

Query: 178 TQINDVHADFDSRWDRMVVENA-QFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSG 236
            +++    +FDS W +++ + + ++ +++ + +    + FL   +         I+A  G
Sbjct: 176 QKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIEAAGG 233

Query: 237 TLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQN 296
                  +  L   +K K    NV++L      KS ++  E+ + L              
Sbjct: 234 KYSAVLSVEELREAVKRKGDLSNVVIL------KSHLTPAEELAPLG------------- 274

Query: 297 LGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPS 356
              +   V D+V A+L      L   V +  +  +     P+E              KP 
Sbjct: 275 ---KTFTVQDVVEAILKDEVNSLKNGV-IGEVAKRPEAEVPME--------------KPV 316

Query: 357 NKRKRTNR-QVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPK 415
            K++R NR +V PLD L+FF GG + +  Q  + +  + +  E+      E    +P  +
Sbjct: 317 TKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRKLE----DPKEE 372

Query: 416 KARIGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGH 475
                 + +P++P    E  KE   Q   + +     + S+     P     TLQ +E  
Sbjct: 373 SKESKEVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEP-----TLQVTE-- 425

Query: 476 TILENDNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTREAKRPVS--FAQAVKETKSH 533
                          P P + +    N     +      R+ + P      Q +++TK+H
Sbjct: 426 ---------------PPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNH 470

Query: 534 EVDRLEKDIVNVTSEELTEEAINKLDKLALVETKD--LMRADREYAVCGQSGGSEQWAGR 591
           EV RL   I+ V  EELTE+AIN+L  L LV+  D  + R DR   V   +     W  R
Sbjct: 471 EVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHNPN---WNNR 527

Query: 592 KNFKKFVKLWPSRSSRNSP--DSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKN 649
           KNFK FVK+WP    ++S   + +++ +RNRA L+TR+YVP R Y   +++ Q    L +
Sbjct: 528 KNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYD 587

Query: 650 SQDDLQEEATCPSIPPVSSTTILGVEVDD 678
             +   E  + P +       +  ++ DD
Sbjct: 588 FPEPQPEAQSVPQVEAPGPNNLFVMDEDD 616

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  216 bits (549), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 225/822 (27%), Positives = 369/822 (44%), Gaps = 129/822 (15%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MW+LRYQY   +G    +S C+++ + Y+IGRS KN L IK+DKSISR H+ L+ +   +
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120
           + +   GKLT +  + +  GQ L F     +  ++G  P+   +    S W IP+ L+  
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT-- 118

Query: 121 QSLSRHLADFDIQVTNSL--SSTTSIQIIKDS-SKSFSNCLFSLIKNIPILREHFIGDFV 177
                 L DF + V   +     T I +I D  + S    L+  +K+IP+ +  F     
Sbjct: 119 -QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTAC 177

Query: 178 TQINDVHADFDSRWDRM-----VVENAQFPNYKCECRPFTTIHFLV-----TNRRAFAIF 227
             ++    DFD+ W R+      +  + + + K   R F     L+     TN+ A    
Sbjct: 178 EILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTL 237

Query: 228 KHIIDAGSGTLWLCDDISNL----DHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLD 283
           K  ++ G     + +D S+L    D+    K T++  I LV   + K   S  +Q  DL+
Sbjct: 238 KTALNLGGA---IVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFK---SPNDQLPDLE 291

Query: 284 VQEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVR------NLPSKAPTGFP 337
                          F++    DI+ A+ D    KL+  +P R      ++       +P
Sbjct: 292 Y--------------FKLE---DIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYP 334

Query: 338 LEEATN---------------KSVIKSADTPK-----PSNKRKRTNRQ-VVPLDSLAFFG 376
            +  TN               K+V+ + D  +     P  K++R NRQ V PLDSLAFF 
Sbjct: 335 SDRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFA 394

Query: 377 GGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIGALRKPDIPNVSEERVK 436
           GG++ +          S    ET+Q T  E AE   S K      L +P   N       
Sbjct: 395 GGASPKIG--------SPAVQETAQATKDESAE---SDKFRTNNGLTQPS-GNSQPLIHS 442

Query: 437 EPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTK 496
           EP+V    K   E  AD +  +Q  P  +   +Q S+    LE+   + N E G +  T 
Sbjct: 443 EPIVL---KEVLE--ADHNKNIQEGPTTAVPVIQ-SKSTQPLEHTEQNKNSEIGSVAATP 496

Query: 497 STSL--GNEAAQAQADAVQTREA----------------KRPVSFAQAVKETKSHEVDRL 538
           +  +  GN   +     V + +A                + P SF QA++ETK+ EV RL
Sbjct: 497 TPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRL 556

Query: 539 EKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAVCGQSGGSE------QWAGR 591
           +  +V + ++ELTE AIN+L  L +VE  + L+R       C    G +      +W+ R
Sbjct: 557 KSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWSRR 616

Query: 592 KNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQ--NANNQDDSFLKN 649
           KNFKKFVK++P    +++    T+ +RN A LITR YVP++ + GQ  N  N D+   ++
Sbjct: 617 KNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFTGQYNNVPNDDEDMYEH 676

Query: 650 ---SQDDLQEEATCPSIPPVSSTTILG-------VEVDDEPAFLFRSQQEDDAYGPDGGL 699
               +++++      +IPPV +  I         +++D + A +  +Q +   +  D G 
Sbjct: 677 HDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPD---FSDDEGQ 733

Query: 700 GQRNQHTSVD-KDSNRDQELFVFDEEDSQRDHVDTYTDAVQS 740
               + +  + K +  +  LFV DE+D    ++  + + V S
Sbjct: 734 SFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDS 775

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  207 bits (528), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 212/803 (26%), Positives = 348/803 (43%), Gaps = 113/803 (14%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWIL+Y Y   +G    VS CL +   +SIGRS+KNPL IK+DKSISRNH+ +  D    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  VVLRVV--GKLTKVSGKSVKAGQHLQFTAD----EEVLFEMGASPIKATVVKQQSFWKIP 114
           ++ R++  G+LT   GK +K G+ + F       E ++ E+G  PIK  VV Q   + +P
Sbjct: 61  LI-RLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119

Query: 115 HDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIG 174
             LS       H+    ++     + +T+I I+ D  K    CLF LI    I    F+ 
Sbjct: 120 SQLSQFIDTLDHVG-IGVKADTVDNRSTTI-IVTDKIKFAYKCLFGLINGAVIRNSQFLV 177

Query: 175 DFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTI------HFLVTNRRAFAIFK 228
           +    ++     F+  WD + ++N  +  Y     P   I      + + ++    A  +
Sbjct: 178 EVTNILSKPTTTFEESWDSL-IQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQ 236

Query: 229 HIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAK 288
             ++ G+G L + ++   L   +K + ++D++I+L             E+++ +   + K
Sbjct: 237 EALERGNGELIVVENTEQLLDRLKQENSTDDLIVL-----------KAEETTKIPGDKIK 285

Query: 289 LLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRN------LPSKAPTGFPLEEAT 342
           L            H + D+V AV  +  + LL  VP         + S  PT    E ++
Sbjct: 286 L------------HTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSS 333

Query: 343 NKSVIKSADTP--------KPSNKRKRTNRQVVPLDSLAFFGGG--SAAESKQNPTEVPE 392
           ++S+     TP        KP  KR+R NR V PLDSL FF GG  S  E +Q  +  P 
Sbjct: 334 SQSLSNKEHTPEHTVTPAEKPPVKRRRYNR-VKPLDSLMFFAGGDYSTEEPEQEISTQPV 392

Query: 393 SERGHETSQNTTT---EFAEGEPSPKKARIGALRKPDIPNVSEERVKEPVVQTRSKRASE 449
           +    +T++ + T      E + S + +     +    PN+  +   +P+       A  
Sbjct: 393 NPAASDTAKTSITTQINVPENDASQESSAFDKFQ----PNIVLKNSAKPLTIDSPGDAH- 447

Query: 450 RSADTSILVQANPKRSRKTLQASEGHTILENDNNSLN---IESGPLPKTKSTSLGNEAAQ 506
              +T  +  AN        Q    H   E  +   N   +E+ P P  +  +L +  + 
Sbjct: 448 ---NTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKST 504

Query: 507 AQADAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVET 566
                     A         +K+ KS EV RL+  +V V ++ELTE+AIN+L  LA+V+ 
Sbjct: 505 VNN---PDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQP 561

Query: 567 KD--LMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPS----RSSRNSPDSATNALRNR 620
            D  + R   + A   ++     W GRKNFK FVK+       R   N  + +++ +RN 
Sbjct: 562 NDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNS 621

Query: 621 AHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATCPSIPPVSSTTILGVEVDDEP 680
            +L+TR+YVP + Y  +++    D     + +    + + P         ++    D EP
Sbjct: 622 GYLLTRQYVPSKIYTKESSKEMQD--FPEASEQTSRQFSVPQ--------VIDDPEDAEP 671

Query: 681 AFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFVFDEEDSQRDHVDTYTDAVQS 740
            F F                   +HTS    +N    LFV DE+DSQ D V    +++  
Sbjct: 672 -FTF------------------TRHTSGTPANNG---LFVVDEDDSQNDVVLAARESI-- 707

Query: 741 RSASGARYQQPEPSISASKNCAP 763
           R     +   P P  S S   +P
Sbjct: 708 RPEEAVQLVDPSPRRSRSLPYSP 730

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  201 bits (512), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 188/683 (27%), Positives = 324/683 (47%), Gaps = 81/683 (11%)

Query: 1   MWILRYQYVAGNGMDV--HVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQS 58
           MWI + QY      D    +S  +K    Y +GR++K+ L I  ++ +SR H++L+ +++
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  CNVVLRVVGKLTKVSGKSVKAGQHLQFTADEEVL-FEMGASPIKATVVKQQSFWKIPHDL 117
             + + ++G   K+  K+++ G   +F   +  L  E+G+  I+  ++  Q  +K+P DL
Sbjct: 60  I-IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118

Query: 118 SLSQ-SLSRHLADFDIQVTNSLSSTTSIQIIKD--SSKSFSNCLFSLIKNIPILREHFIG 174
            ++  +L++      I++  SLS  TS QI++     K +   LF+L+K +P++   F+ 
Sbjct: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178

Query: 175 DFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAG 234
              + +N     F+S+   +  E + FP +     P   ++F+V  +  F I K+ I+ G
Sbjct: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238

Query: 235 SGTLWLCDDISNLDHFIK--HKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKN 292
            GT++ C      + F+K    I S  VIL+   NN   +I  T++ +D ++     L  
Sbjct: 239 GGTVYNC---ITFEDFVKVTSTIPSSKVILIKCSNNISPAI-DTQKPTDHNI-----LLE 289

Query: 293 KAQNLGFRIHDVNDIVGAVLDHNFEKLL-------ERVPVRNLPSK-APTGFPLEEATNK 344
           KA ++GF+ HD  ++  AVL++NFE+ L       +R+   N   K   T   LE+    
Sbjct: 290 KAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKV 349

Query: 345 SVIKSA----DTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETS 400
           +V  ++    +T  P  K++R N  V PLDSL+FF GGS   S +      E +      
Sbjct: 350 NVSATSGLNLNTEGPPAKKRRIN-SVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQPAE 408

Query: 401 QNTTTE--FAEGEPSPKKARIGALRKPDIPNVSEERVKEPVV--QTRSKRASERSADTSI 456
            N   E   A  E  P K+ I  +    +P    E   EP+V  + RS   +E  AD   
Sbjct: 409 HNKIAETSIASIELLPTKSGIKEITDV-VPETENE--PEPMVSPKKRSPAKNESLAD--- 462

Query: 457 LVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTK----------STSLGNEA-- 504
                       ++A + H  ++    +L +E    P  K             + NE   
Sbjct: 463 ------------MRAGDNHVSIK---TTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKY 507

Query: 505 ---AQAQADAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKL 561
              A+++   + T+      S   A+KE K  EV R++  IV +  +ELTEEAI KL  L
Sbjct: 508 HLNAESKDSTLSTQSHS---SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTL 564

Query: 562 ALVETKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRA 621
           A+VE+ D++R  +   +  ++  +++   R+NFK+FVK+WP+  ++        A R   
Sbjct: 565 AVVESVDMLRKTQSRHM--KTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS- 621

Query: 622 HLITREYVPLRPYEGQNANNQDD 644
               R+ VPL+ YE  N N   D
Sbjct: 622 ---NRQCVPLKVYEPMNKNELTD 641

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  197 bits (502), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 206/755 (27%), Positives = 327/755 (43%), Gaps = 167/755 (22%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRY+    +G    VSCCL++   YSIGRS+KNPL IK+DKSISR H+ +  D  CN
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWD--CN 58

Query: 61  -----VVLRVV--GKLTKVSGKSVKAGQHLQFTADEE----VLFEMGASPIKATVVKQQS 109
                 VL VV  GKLT +    +K+ +   F  D+E    V+ ++G  P+   +     
Sbjct: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAF--DDETYSTVVVKLGTKPVVVRISWTPI 116

Query: 110 FWKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQ---------IIKDSSKSFSNCLFS 160
           FW           LS+    F+  + NS+   T +Q         +I D   ++S  +F+
Sbjct: 117 FW----------DLSKDFLQFEKSI-NSMGICTQMQSSNVRDISLVINDEKSNWSRIMFA 165

Query: 161 LIK-NIPILREHFIGDFV-TQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIH--F 216
           L+K N  +++   + +     + D   +FD  W ++      F NY        T++  F
Sbjct: 166 LLKQNCTLVKPVLLSEVCNVLLADCQTNFDEIWAQLF---ESFSNY--------TVYPGF 214

Query: 217 LVTNRRAFAIFKHIIDAGSGT------LWLCDDISNLDHFIKHKITSDNVILLVHLNNGK 270
            V        F+ +     G+      L+L   +S L    K   T+D+++  +   N  
Sbjct: 215 TVEGNDILRAFQDVQFYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN 274

Query: 271 SSISSTEQSSDLDVQEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPS 330
                  +  D    E +         G +I+ + +IV A+LD NF+ L   +   N   
Sbjct: 275 LLKCIALKQEDPAPDEIQ---------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSR 325

Query: 331 K---------------------APTGFPLEEATNKSVIKSADT---------------PK 354
           K                           L   T+ ++  +A+                P 
Sbjct: 326 KRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPS 385

Query: 355 PSNKRKRTNRQVVPLDSLAFFGGGSA---------------------AESKQNPTE---- 389
           P+ +R+   R V PLDSL+FF GGS                      ++ K N  E    
Sbjct: 386 PTKRRRLVRRTVKPLDSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLG 445

Query: 390 VPESERGHETSQN-----TTTEFAEGEPSPKKA--RIGALRKPD----IPNVSEERVKEP 438
           V  + R  +T+       T  +    +P+  ++    G LR  +    + N S +R   P
Sbjct: 446 VNNARRDEQTNDQVDVVQTALQSLSSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMP 505

Query: 439 VVQTRSKRASERSADTSILVQ---ANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKT 495
           +      +      DT++L+Q   +N   S++T    E     +N +N+L+  +  +   
Sbjct: 506 L------KPLSPDVDTNLLIQPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSR 559

Query: 496 KSTSLGNEAAQAQADAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAI 555
           KS     E+   + D   T+ +K P +F +AV+ TK+ EV R+   IV+V+  EL+EEAI
Sbjct: 560 KS-----ESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAI 614

Query: 556 NKLDKLALVETKDLM----RADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSPD 611
           NKL  L +VE+   +    RAD+  +V      ++ W GR+NFKKF K+WP    R+  D
Sbjct: 615 NKLSNLTIVESNPNLIRERRADKNDSV------NDMWKGRRNFKKFNKVWPQH--RDGYD 666

Query: 612 SATNALRNRAHLITREYVPLRPYEGQNANNQDDSF 646
           S    LRN A LI R YV L+PY+G+  +N    F
Sbjct: 667 S----LRNNAFLIIRNYVELKPYDGKRNDNDSSDF 697

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  183 bits (465), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 189/716 (26%), Positives = 318/716 (44%), Gaps = 106/716 (14%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MW+LRY YV   G    VSCC++Q +QY+IGRS+KN L IK+DKSISR HV L+   S N
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  VV-LRVVGKLTKVSGKSVKAGQHLQFTADE-EVLFEMGASPIKATVVKQQSFWKIPHDLS 118
            + L   GKLTK S K + + + + ++ADE ++   +G +P+K  + +    + IP+ LS
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120

Query: 119 LSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVT 178
             +     L    I V N+  ++TS+  + D        LF+   +I I     + +   
Sbjct: 121 QFRETLETLG-IQISVDNANVNSTSLITVGDFG---YRELFAACNDINIYSSGLLTEICN 176

Query: 179 QINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGTL 238
           ++ + H +FD+ W  M     +  + +     F  I      R  F    + ID      
Sbjct: 177 KLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGI------RGKFFFLLYKID------ 224

Query: 239 WLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDV----QEAKLLKNKA 294
           W    IS L  F+     S  +   +H N+    + S++Q+ ++ +    ++ K L    
Sbjct: 225 WFI--ISYLKPFLLK--LSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDT 280

Query: 295 QNLG----FRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSA 350
             +     ++  +  D+    + +   + +ER P+ +L  +       ++ +  +  +  
Sbjct: 281 LQIHSDDIYKFIESGDLYRNAIRY---QSMERKPIYDLEDETTNAIIPQKRSLANTSQPT 337

Query: 351 DTPKPSNKRKRTNR-QVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAE 409
           DT   S K+KR  R +V PL+SL+FF GG +          P     +E +Q+      +
Sbjct: 338 DTSLESTKKKRVRRHKVEPLNSLSFFAGGIS----------PVPGTNNEYNQSKVNGHLD 387

Query: 410 GEPSPKKARIGALRKPDIPN----VSEERVK--------EPVVQTRSKRASERSADTSI- 456
            E SP  A     R+  IP     +S  R++        EP +  RS        D  I 
Sbjct: 388 SEISPDSA--STTREQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIG 445

Query: 457 ---LVQAN---PKRSRKTLQASEGHTILENDNNSL-NIESGPLPKTKSTSLG-------N 502
              +V+     P R ++ +  +  +    N N SL  +E+         S+G        
Sbjct: 446 NDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKT 505

Query: 503 EAAQAQADAVQTREA---------------------------KRPVSFAQAVKETKSHEV 535
           E ++  A  + + E                            KR +   + V+ TK  EV
Sbjct: 506 ELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESEV 565

Query: 536 DRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAVCGQSGGSEQWAGRKNF 594
            RL   IV +   ELTEEAINKL+ L LVE   DL+R   +  +   +   +QW  RKNF
Sbjct: 566 KRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSD--ISANNTTQQQWKNRKNF 623

Query: 595 KKFVKLWPS-RSSRNSPDSATNALRNRAHLITREYVPLR--PYEGQNANNQDDSFL 647
           KKFVK+ P  +S ++S +S +  +R    ++TRE++  +  P +  N+++  + F+
Sbjct: 624 KKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFV 679

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  175 bits (444), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 228/904 (25%), Positives = 387/904 (42%), Gaps = 164/904 (18%)

Query: 1   MWILR--YQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEV-DQ 57
           MW+ +  YQ     G   ++SC L    ++ +GR++K+ L I+ +K +SR H+ LEV D 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59

Query: 58  SCNVVLRVVGKLTKVSGKSVKAGQHLQFTADEE-VLFEMGASPIKATVVKQQSFWKIPHD 116
             N++L  +G   KV G+    G  L F   +  V+ E+G+  ++  +   Q  +K+P+ 
Sbjct: 60  HVNILL--LGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117

Query: 117 L-SLSQSLSRHLADFDIQVTNSLSSTTSIQIIK--DSSKSFSNCLFSLIKNIPILREHFI 173
           L     +L   +    I+V  S S  T+  II+  +  + +   LF+L+K IPIL   F+
Sbjct: 118 LLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFL 177

Query: 174 GDFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDA 233
             F   +     DFD +   +  ++  F  +  +      +HF+V  +  F + K+ ++ 
Sbjct: 178 KQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEI 237

Query: 234 GSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNK 293
           G GT+  C DI++L   +  K    N  L +  ++G   IS+  +  D D +  ++L + 
Sbjct: 238 GGGTVHFCHDINDLSACL--KTIPINGALALKYDHG---ISAEVKKVD-DTRYCEVLHSH 291

Query: 294 AQNLGFRIHDVNDIVGAVLDHNFEKLLERVP------VRNLPSKAPTGFPLEE------A 341
               G ++  V+++  A+L     +LL + P      V  +PS       +++      +
Sbjct: 292 ----GIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPIS 347

Query: 342 TNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQ 401
              + IK  D P+    RKR  ++  PLDSL+FF GG    S+QN +    ++   + S 
Sbjct: 348 LGNTTIK--DLPRKDKTRKRL-KKPQPLDSLSFFAGGL---SRQNSSIGGTADLVKQESM 401

Query: 402 NTTTEFAEGEP----------SPKKAR------IGAL------RKPDIPNVSEERVKE-- 437
           +   +   G P          SPKK R      +G L      +  D P +S  +V    
Sbjct: 402 SLGADTHYGSPNDVQSLPATQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTE 461

Query: 438 ----PVVQTRSKRASE-------RSADTSILV-----QANPKRSRKTLQASEGHT-ILEN 480
               PV ++++K+  +        S   SI       Q +P    + L A  G+  IL  
Sbjct: 462 QEIIPVRESQAKKTPDPIGAFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNK 521

Query: 481 DNNSLNIESGP--LPKTKSTSLGNEAAQAQA-----------------DAVQTRE---AK 518
              SL+ E  P   P+ + T L +E     +                 +++++R+   ++
Sbjct: 522 QWKSLD-EQPPSKKPRMQETDLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSE 580

Query: 519 RPVSF-----AQAVKE---------TKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALV 564
           +PV+      A AV E          K  EV+R+   IV +  EELTE+AI +L  LA+V
Sbjct: 581 KPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIV 640

Query: 565 ETKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSR-NSPDSATNALRNRAHL 623
           +  D++R        G S  +     RKN+K F K+WP   +R NSP++     RN   +
Sbjct: 641 QPVDMLRQQHTVDTVGSSPLT---FARKNYKNFKKVWPKYMNRKNSPET-----RNATAI 692

Query: 624 ITREYVPLRPYEG--QNANNQDDSFLKNSQDDLQEEATCPSI------------PP---- 665
             R+Y+PL  YE   Q+    +D      +D++    +   +            P     
Sbjct: 693 SNRKYLPLELYETDLQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSL 752

Query: 666 VSSTTILGVE-VDDEPAFLFRSQQEDDAYGPDGGLGQRNQHTSVDKDSNRDQELFVFDEE 724
            S+  +LG +    EP F F S+  +D   P         H         D  LFV D+E
Sbjct: 753 FSNHALLGNDNAGPEPIFNFSSRSREDTNSPTASPAPNLTH---------DNTLFVVDDE 803

Query: 725 DSQRDHVDTYTDAVQSRSASGARYQQPEPSISASKN----------CAPQDSDESDDEPR 774
           +   D +   + A +      A  +  EP  +  ++           A  DSDE D EP 
Sbjct: 804 NEDGDGMADTSIAQRVSRERHATTKPAEPDTAEPRHTRRKHAPRPSAAAADSDE-DGEPT 862

Query: 775 FQFQ 778
           F F+
Sbjct: 863 FAFK 866

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 193/758 (25%), Positives = 310/758 (40%), Gaps = 134/758 (17%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEV--DQS 58
           MWI+ Y Y + +    +VSCCLKQ   YSIGRS K+PL +K+DKSISR HV      + +
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 59  CNVVLRVVGKLTKVSGKSVKAGQHLQFTADEE--VLFEMGASPIKATVVKQQSFWKIPHD 116
             + L   GKLT+V+ + +   + L F AD E     E+GA+P+          + IP +
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 117 LSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKD------SSKSFSNCLF-SLIKNIPILR 169
               Q     L D+   +        +I  + D      ++   S  L+ SL+    IL+
Sbjct: 121 F---QQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILK 177

Query: 170 EHFIGDFVTQIN----DVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFA 225
             F+   +  +N      + DF +  D   +E+ +  N +      T I  +V N     
Sbjct: 178 SSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTD 237

Query: 226 IFKHIIDA---GSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDL 282
           +   I         T+   DD   ++    H  + + +ILL           +T  S  +
Sbjct: 238 LIYFIAAMEVINLPTITTEDDTIFINTVKSH--SEERLILL-----------TTSNSRHI 284

Query: 283 DVQEAKLLKNKAQNLGFRIHDVNDIVGAVLD---HNFEK-LLERVPVRNLPSKAPTGFPL 338
           +  +    K+  Q  G +  ++N ++  +     H  E+   E + + N         P 
Sbjct: 285 ETIKVHTFKDFYQ--GIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPY 342

Query: 339 EEATNK--------SVIKSADT-----------PKPSNKRKRTNRQ-VVPLDSLAFFGGG 378
            E  NK        S++K                KP  KR+R NR+ V PLDSL FF GG
Sbjct: 343 IEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGG 402

Query: 379 SAAESKQ-------------NPTEVPESERGHE--------TSQNTTTE----------- 406
           +   ++              NP  V    + ++         SQ  T E           
Sbjct: 403 NTNPTQNNLSQTESDLKNVANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPT 462

Query: 407 -------FAEGE----PSPKKARIGALRKP-------DIPNVSEERVKEPVVQTRSKRAS 448
                   +  E    PS  +    +L++P       +IP++ +E     +V  +   AS
Sbjct: 463 SITKQMSLSNNETLQYPSNSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAAS 522

Query: 449 ERSADTSILVQANPKRSRKTLQASEGHTILE----NDNNSLNIESGPLPKTKSTSLGNEA 504
               D  IL      RS+K L  S    + +     D +S   +     KT S  + N  
Sbjct: 523 TSKKDVKILA----ARSKKPLNDSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNK 578

Query: 505 AQAQADAVQ------------TREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTE 552
              QA++++             + +  P +F  A+++ K+ E DRL    V +  EELTE
Sbjct: 579 PDDQANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTE 638

Query: 553 EAINKLDKLALVETK-DLMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSP- 610
           EAINK   LA+VET  D++ ++ +      +    +W GRKNFK FVK  P    +  P 
Sbjct: 639 EAINKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPS 698

Query: 611 --DSATNALRNRAHLITREYVPLRPYEGQNANNQDDSF 646
             +   + +RN A L+ REYVP++ ++  N  N+   F
Sbjct: 699 GDNGVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEF 736

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 191/741 (25%), Positives = 324/741 (43%), Gaps = 122/741 (16%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWILRYQY   +G    VS CL++ + YSIGRS+KNPL IK+DKSISR H+ ++ + S  
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTA--DEEVLFEMGASPIKATVVKQQSFWKIPHDLS 118
           + L   GKLT V  + +   + L F     +E+   +G +P+   +  Q     IP+   
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN--- 117

Query: 119 LSQSLSRHLADFDIQVTNS-LSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFV 177
           + +     L  + I+VT+  L   + I  +  +   +   L +L   IP+ +  ++ +  
Sbjct: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177

Query: 178 TQINDVHADFDSRWDRM-VVENAQF-PNYKCECRP---FTTIHFLVT-NRRAFA------ 225
             +   +  FD+   ++  +E+ +  P++         F    F++T N+ + +      
Sbjct: 178 NMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKS 237

Query: 226 -IFKHIIDAGSGTLWLCDDISNLDHFIKHKITSD--NVILLVHLNNGKSSISSTEQSSDL 282
            I +  +    G   +  D + L + +   +++   N++++   +NGK  I + E  +  
Sbjct: 238 FILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVK 297

Query: 283 DV------QEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGF 336
           D+       + KLLK+     G        +V       FE     V ++  P +A    
Sbjct: 298 DIFDSFVKNDPKLLKSNLTETG--------VVSPKAPEIFENEKLMVEIQEPPIEAAI-- 347

Query: 337 PLEEATNKSVIKSADTPKPSN-----KRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVP 391
             EE+T+   +K    P+P       KR+   ++V PL+SL FF GGS        T  P
Sbjct: 348 -TEESTSSKNLKHT-PPEPVTTHIVKKRRLARKRVKPLESLDFFVGGST-------TGTP 398

Query: 392 ESERGHETSQNTTTEFAEGEPSPKKARIGALRKPDIPNVSEERVK---------EPVVQT 442
                 ETS  T  +            I   + PD+  +  E+++         EP    
Sbjct: 399 -----FETSSTTLQQ-----------EIIEPKVPDVAPILNEQIQQSQVNKSINEPAKDI 442

Query: 443 RSKRASERSADTSILVQANPKRSRKTLQASEG----HTIL-------ENDNNSLNIESGP 491
            S   S+R    ++      K  ++  Q  +     H  +       E +  S + E  P
Sbjct: 443 YSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHIDISPHGNSNEQEKRSNSSEKSP 502

Query: 492 LPKTKSTSLGNE-AAQAQADAVQTRE-AKR-----PVSFAQAVKETKSHEVDRLEKDIVN 544
           +   +     +E  + A+A  +  RE +KR     P S  + +++ K+ EV RL+  I +
Sbjct: 503 MITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAH 562

Query: 545 VTSEELTEEAINKLDKLALVETK-DLMRADREYAVCGQSGGS-----------EQWAGRK 592
           V +EELTE+AIN+   LA+VE+   L+R         +S  S               GR+
Sbjct: 563 VDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRR 622

Query: 593 NFKKFVKLWPSRSSRNSPDS--------ATNALRNRAHLITREYVPLRPYE-------GQ 637
           NFK+FVK++P +  +N  DS        A++ +RN A LITR YVPL+ Y        G+
Sbjct: 623 NFKRFVKVYP-KYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGK 681

Query: 638 NANNQDDSFLKNSQDDLQEEA 658
           N  N ++   K   +   EEA
Sbjct: 682 NGFNDEEMLEKEYVEYDNEEA 702

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 173/738 (23%), Positives = 323/738 (43%), Gaps = 105/738 (14%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEV--DQS 58
           MW+LRYQY   +G    +SCC++    Y +GRS+KN L +++DKSISR  + ++   D+ 
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 59  CNVVLRVVGKLTKVSGKSVKAGQHLQF-TADEEVLFEMGASPIKATV---VKQQSFWKIP 114
           C ++++ +GK+T V  + +  G+ L F + ++ V  ++G +PI   +   VK+ ++ K  
Sbjct: 61  C-IMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWEVKRCNYMKTD 119

Query: 115 HDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSN----CLFSLIKNIPILRE 170
            D      +   L  +  Q T   +S +   II++   + S+    C +S+I +  ++  
Sbjct: 120 MD------MVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKC-YSMIHDTILINS 172

Query: 171 HFIGDFVTQINDVHADFDSRWDRMVVENAQFPNYKCE----CRPFTTIHFLVTNRRAF-- 224
             + D +T    +   FDS W ++    +   N+        +    +H  + +  ++  
Sbjct: 173 KTLRDILTNNIIMTKKFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPESYNC 232

Query: 225 AIFKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLD- 283
             F+  ++          +I++L+ +++ +      +LL        S +  E  S L+ 
Sbjct: 233 EYFEKFLEEIGCIPRKFLNINDLETYLETQFKGGEFLLL--------SSAKLENQSRLER 284

Query: 284 ----------VQEAKLLKNKAQNLGFRIHDVNDIVGAVLDH-NFEKLLERVPVRNLPSKA 332
                      +   L  +  Q++     +  +++  VL     E+  E VP+       
Sbjct: 285 FISIPLESFLDKLLFLDLDFGQSINRSKEESKNVIEPVLKEVGVEQTTEAVPIS------ 338

Query: 333 PTGFPLEEATNKSVIKSADTPKPSNKRKRTNR-QVVPLDSLAFFGGG-SAAESKQNPTEV 390
                          K+ +  +P  K++R NR +V PLDSL FF GG ++  + Q P  V
Sbjct: 339 ---------------KNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPV 383

Query: 391 PES-----ERGHETSQ-------NTTTEFAEGEPSPKKARIGALRKP--DIPNVSEERVK 436
            E+     ++  E  +       N  TE  E       +     +KP  D+ +  E+R++
Sbjct: 384 EEANNITRKKDKEVIKSQGKGEINIETEMDESGNGELLSTASEFKKPKSDVQHKLEKRMQ 443

Query: 437 EPVVQTRSKRASERSADTSILVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTK 496
             + ++  K    +  +   + Q     S K    S+  ++L      +  +      TK
Sbjct: 444 VAIDRSPEKIKKPKLEENISIQQL---LSNKVKSTSDTSSVL------IETQIAKESNTK 494

Query: 497 STSLGNEAAQAQADAVQTREAK--RP-VSFAQAVKETKSHEVDRLEKDIVNVTSEELTEE 553
           +   G    +   D   T + +  RP V    A+++ K  E  R++  IV +   ELTEE
Sbjct: 495 AIEYGKVRQKTLTDYKHTSDERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEE 554

Query: 554 AINKLDKLALVETKDLMRADREYAVCGQSGGSEQ---WAGRKNFKKFVKLWP--SRSSRN 608
           AINK   L +V+    +  D+   +   +  ++    W+G+KNFKKFVK+ P   RS  N
Sbjct: 555 AINKFSDLTVVDINTRLFKDKSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGN 614

Query: 609 S--PDSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKNSQDDLQEEATCPSIPPV 666
               DS +  +RN A LITR +VP++ Y   + N+  +     S  ++ ++    +    
Sbjct: 615 GQHADSCSTFIRNSAMLITRNFVPMKQYSKLDNNSNSNEMTDFSNIEVNKKPVEKNREAY 674

Query: 667 SSTTILGVEVDDEPAFLF 684
           SS   +     DEP+F F
Sbjct: 675 SSDDSV-----DEPSFTF 687

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/416 (26%), Positives = 205/416 (49%), Gaps = 47/416 (11%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60
           MWI+ + +         V   L+ G++YSIGRS K   +I++DKSISR H+ ++ D S +
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS-D 59

Query: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120
           +++   GKLTK + + +   + +    ++  +  +G  PI   V      WKIPH L L+
Sbjct: 60  LIITNKGKLTKFNEEIIPLDETI-VVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELN 118

Query: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFI---GDFV 177
           ++ S  ++DF ++++ S S  T+ QI  DSS S+S CLF+L+K +P++   F+   G  +
Sbjct: 119 ETKSL-VSDFGVKLSESFSKKTTTQICSDSS-SYSGCLFALLKGVPVVSIEFLNQMGKLL 176

Query: 178 TQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGT 237
            Q N  + DF S +  ++  +  FP+Y+      + +  +V  ++ +   ++ I+ G G 
Sbjct: 177 QQGN--YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGD 234

Query: 238 LWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNL 297
             L  + S LD F+               N+  + +  +  S  ++ +  KLL+   +++
Sbjct: 235 AKLLANSSELDKFLS-------------TNHEPAVVLGSSISQKMNSESTKLLEEFDKSI 281

Query: 298 -------GFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSA 350
                  G ++ ++N  V  +L++    L +R  V +L S +P      ++   SV    
Sbjct: 282 AETSLRHGVKLLNINQFVNILLENKINGLKKR-DVVDLTSPSPVQQKKIQSAKASV---- 336

Query: 351 DTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTE 406
                + K+ ++   +  LDSL FFGGG+         EV ++E  HE   + T+E
Sbjct: 337 -----NGKKTKSKPNIQSLDSLNFFGGGNL--------EVTQNEEKHEPVISHTSE 379

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 112/251 (44%), Gaps = 36/251 (14%)

Query: 395 RGHETSQNTTTE--FAEGEPSPKKARIGALRKPDI----PNVSEERVKEPVVQTRSKRAS 448
           R  +T+ N   E       PS  +  I  ++ PDI    P +S   + EP        A 
Sbjct: 485 RIGDTASNVNAEGVLPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEP------GGAE 538

Query: 449 ERSADTSILVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTKSTSLGNEAAQAQ 508
             SA  +++         K++ A   + I +N  N   ++S P          +  A+ +
Sbjct: 539 HVSAKKNLISDGG-----KSIDAQSSNRIEQNMGNMTELDSRP----------HSVARLE 583

Query: 509 ADAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKD 568
            D +Q R +   ++   A+ ETK  EV RL++ I+ V   ELTE A+      A + T  
Sbjct: 584 TD-LQVRSSTNIIT---AIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQ 639

Query: 569 LMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREY 628
           +    R  A    S G+ +W GRKNFKKF K WPS   R +    ++   N ++ I REY
Sbjct: 640 I--KPRVLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSD---NTSNQIGREY 694

Query: 629 VPLRPYEGQNA 639
           + +R Y+ + A
Sbjct: 695 ITMRKYDSRKA 705

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 105/405 (25%), Positives = 183/405 (45%), Gaps = 57/405 (14%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58
           MW++RYQ    +G    +SCCL+    YSIGRS+KNPL IK+DKSISR H+    E++ S
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 59  CN-----VVLRVVGKLTKVSGKSVKAGQHLQFTADE---EVLFEMGASPIKATVVKQQSF 110
            +     + L   GKLT ++ K +K G+     A +     + E+G +PI+         
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167
           W IP  L+  +++   L+++ I    S++   +  +I D  KS  N    L++L+  IP+
Sbjct: 121 WNIPPHLTQFRTM---LSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177

Query: 168 LREHFIGDFVTQI---NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAF 224
            +  F+ +    +   +  +  FD  W+ M + N ++  +  +     +    + N R  
Sbjct: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDM-ISNPEYNVFDFDPNILLSKFMRLNNIRVL 236

Query: 225 AIFK------HIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLN---NGKSSIS- 274
              K       ++   +  L+  D+I +L  ++     S   ++L   +   NGK   + 
Sbjct: 237 TTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTI 296

Query: 275 STEQSSDLDVQEAKLLKNKAQNLGFRIHDVNDIVGAVLDHN-FEKLLERVPVRNLPSKAP 333
            T  +S +D   + ++  K  +               LD+  F+++ E +      S+AP
Sbjct: 297 KTMLTSIIDGTLSAVINMKGAS------------SRTLDNGKFDQISEGMSTILKTSRAP 344

Query: 334 TGFPLEEATNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGG 378
                         +   +P  S KRK   R+V+PLDSL FF GG
Sbjct: 345 --------------EVEASPVVSKKRKLNRRRVLPLDSLDFFAGG 375

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 16/130 (12%)

Query: 520 PVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAV 578
           P +F +A++ETK+ EV R++  IV +  EEL+EEAIN+L  LA+VE + +L+R   +   
Sbjct: 556 PHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEG 615

Query: 579 CGQSGGSEQWAG---------RKNFKKFVKLWPSRSS-----RNSPDSATNALRNRAHLI 624
              S  +E+W           RKNFK FVK+ P   +     +N+  S+ + +RN A LI
Sbjct: 616 NKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSS-DFIRNAAFLI 674

Query: 625 TREYVPLRPY 634
           TR YVPL+ Y
Sbjct: 675 TRNYVPLKKY 684

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 187/426 (43%), Gaps = 60/426 (14%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSC- 59
           MW++RYQ +  +G    +SCCL+    YSIGRS+KNPL IK DKSISR H+ L+   +  
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 60  ------NVVLRVVGKLTKVSGKSVKAGQHLQFTA---DEEVLFEMGASPIKATVVKQQSF 110
                 ++ L   GKLT ++ K +K G+     A         E+GA+PI+  V  +   
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167
           W IP  L+        L+ F I    S++   +  +I D   S  N    L +L +NIP+
Sbjct: 121 WNIPSHLA---QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPL 177

Query: 168 LREHFIGDFV-----TQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRR 222
            +   +           I D+   FD RW+ +V    + P Y           F      
Sbjct: 178 KKSQLLVKLCNTLLSASITDL--TFDERWNDIV----KSPEYDV---------FDANPDL 222

Query: 223 AFAIFKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNVIL--LVHLNNGKSSISSTEQSS 280
            F+ F  + D     + +   ISN + ++   +   N+ L   V +N+    + S + S+
Sbjct: 223 LFSKFMKLSD-----ITILTTISN-EPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPST 276

Query: 281 DLDVQEAKLLKNKAQNL----GFRIHDVNDIVGAVLDH---NFEKLLERVPVRNLPSKAP 333
              +  +   K   Q L          + D + +V++    +FE      PVR+ P K  
Sbjct: 277 KYLILTSMNKKENGQILCTTKCLLTSLIKDTLASVINTKSVSFEAPNNETPVRD-PEKLS 335

Query: 334 TGFPLEEATNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGG---SAAESKQNPTEV 390
           +   +        I++  +P    KR+   R+V+PLDSL FF GG    A+   ++ T+V
Sbjct: 336 SASKIHHT-----IETEASPVILKKRRLNRRRVLPLDSLNFFAGGLNVKASSESKDITDV 390

Query: 391 PESERG 396
            ES  G
Sbjct: 391 KESRCG 396

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (56%), Gaps = 17/150 (11%)

Query: 520 PVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVET-KDLMRADREYAV 578
           P SF QA+++TK  EV R++  IV +  +EL+EEAIN+L++LA+VE   DL+R   +Y +
Sbjct: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611

Query: 579 -----CGQSGGS----EQWAGRKNFKKFVKLWPS----RSSRNSPDSATNALRNRAHLIT 625
                  + GG+    ++W  RKNFK FVK WP     +    +    ++ +R  A LIT
Sbjct: 612 NTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLIT 671

Query: 626 REYVPLRPYEGQNANNQDDSFLKNSQDDLQ 655
           R YVPL+ Y  +N   + D   K   DD+ 
Sbjct: 672 RNYVPLKKYSKKNKVTKWD---KEESDDMH 698

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 108/415 (26%), Positives = 184/415 (44%), Gaps = 69/415 (16%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58
           MW++RYQ +  +G    +SCCL+    YSIGRS+KN L IK+DKSISR HV    E++ S
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 59  CN-----VVLRVVGKLTKVSGKSVKAGQHLQFTADE---EVLFEMGASPIKATVVKQQSF 110
            N     + L   GKLT ++ K +K G+    +  +       E+G +PI+         
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167
           W IP +L+  Q++   L+ F I    S+   ++  +I D   +  +    L++L+  IP+
Sbjct: 121 WNIPSNLAQFQTI---LSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPL 177

Query: 168 LREHFIGDFVTQI---NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAF 224
            +   + D    +   + ++  FD  W+ MV                        N+  F
Sbjct: 178 KKSQLLVDLCNSLLSSSVMNLKFDETWNNMV------------------------NKPLF 213

Query: 225 AIFKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNV-----ILLVHLNNGKSSISSTEQS 279
            +F +            D++  L   I ++    N+     + L H +     ++   + 
Sbjct: 214 KVFDYDPSVLFSKFMRLDNVITLTT-IGNESGLPNILRRLNVRLFHFD----CLNDLYKH 268

Query: 280 SDLDVQEAKLL----KNKAQNLGFRIHDVNDIVGAVLDHNFEKLL--ERVPVR----NLP 329
            DL     K L     NK +N G ++  + +++ +++D     ++  + VP      N P
Sbjct: 269 VDLLKPSEKYLILTFTNKREN-GQKLCTLQNLITSIIDDTLPSVINTKAVPFEVQENNTP 327

Query: 330 SKAPTGFPLEEATNKSV--IKSADTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAE 382
            K    F    A +K+V   ++  TP    KR+   R+V PLDSL FF GG +A+
Sbjct: 328 EKV---FEGHTAISKTVHTPETEATPAVLKKRRLNRRRVQPLDSLNFFAGGLSAD 379

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 20/166 (12%)

Query: 516 EAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMR--- 571
           ++  P SF +A+++TK+ EV R++  IV +  +EL+EEAIN+L+ LA+VE + +L+R   
Sbjct: 569 QSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPR 628

Query: 572 -----ADREYAVCGQSGGSEQ-WAGRKNFKKFVKLWPSRSSRNSPDSATNA----LRNRA 621
                  R  A   + G   Q W  RKNFK F K+WP+  +    D   N     +R+ A
Sbjct: 629 SVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAA 688

Query: 622 HLITREYVPLRPYEGQ------NANNQDDSFLKNSQDDLQEEATCP 661
            LITR YVPL+ Y  +      +  N DD       ++L+ +   P
Sbjct: 689 FLITRNYVPLKKYSKKDRASNWDKENNDDVLALTEMENLESDTHIP 734

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 170/690 (24%), Positives = 297/690 (43%), Gaps = 104/690 (15%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSC- 59
           M ILRY+ V  +G    VSCCL   ++Y+IGRS+KN   IK+DKSISR HV L    S  
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 60  --NVVLRV--VGKLTKVSGKSVKAGQHLQFT-ADEEVLFEMGASPIKATVVKQQSFWKIP 114
             NV++++   GK+T +  K +   + LQFT  D+++   +G SPI   +  Q+      
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSI 120

Query: 115 HDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKN---IPILR-E 170
            D+  S S    L + +I   + L+       I     S+++ L  L  N   IPI+  E
Sbjct: 121 EDIQNSDS-KLILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPIVTIE 179

Query: 171 HFIGDFVTQINDVHADFDSRWDRMVVENAQFPNYKCECR-PFTTIHFLVTNRRAFAIFKH 229
              G  +   N    DF S WD++    ++  N    C    +T +++    +     K 
Sbjct: 180 ELRG--IANAN----DFYSYWDKIY---SRKKNKGKACMLDLSTCYYISEVDKYVDYVKV 230

Query: 230 IIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSS-DLDVQE-A 287
            I + +  + +  D  +L   I+  I+  N+     L+N    I+  E++  ++ V   A
Sbjct: 231 AIRSLNAEIKILKDKDDLVKDIRKNISKGNISKFFVLSND---ITQGEEAPFNISVTSIA 287

Query: 288 KLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVI 347
           KLL+        + +++ DIV     H++      +P      K+P         + ++I
Sbjct: 288 KLLE------AVKTNNMKDIVM----HDYSSFKIEIPRE---VKSP--------KDDNII 326

Query: 348 KSADTPKPSNKRKRTNR-QVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTE 406
           +  + P P  KR+R NR +V PLD+L+FF GG + ++    T+     + H+        
Sbjct: 327 EKQEPPAP--KRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSNDVQSHQ-------- 376

Query: 407 FAEGEPSPKKARIGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSIL-------VQ 459
             E E     ++I +++  D+ +  ++   +   + +  +A  ++AD  +        + 
Sbjct: 377 --ETEKDVNNSKIESIQ--DVESNQDQTKYDKSTELQKSKAVSKNADDKLQDSTAEKPIN 432

Query: 460 ANPKRSRKTLQASEGHTILENDNNSLN--IESGPLPK------TKSTSLGNEAAQAQA-D 510
            NP     +   S     +EN N +L+  +E   + K      TK+  L N+    Q  +
Sbjct: 433 FNPTTKTPSFSPSINDKAIENSNANLDPTMEKTRVNKKPASLDTKNNLLDNKLIAEQINE 492

Query: 511 AVQTREAKRPV-------------------SFAQAVKETKSHEVDRLEKDIVNVTSEELT 551
           A+  +    PV                      + ++  KS  VDR+   IV V   EL 
Sbjct: 493 ALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVDRVNSKIVTVDENELN 552

Query: 552 EEAINKLDKLALVETKD-LMRAD---REYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSR 607
           EE +NK   + +V+  D LM+     ++         +  +  RK++K F K  P   S+
Sbjct: 553 EEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNANIDHNSNFKNRKDYKLFKKSIPKWQSK 612

Query: 608 NSPDSATNALRNRAHLIT---REYVPLRPY 634
            +    +    N  +L+    R  +PLR Y
Sbjct: 613 LNKQHHSMTSDNGENLVVSKNRNKIPLRKY 642

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 85/143 (59%), Gaps = 14/143 (9%)

Query: 510 DAVQTREAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKD 568
           + +Q R++  P+SF +A++ETK+ EV+R +  IV +  +EL+EE IN+L  LA+VE  +D
Sbjct: 538 ELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNED 597

Query: 569 LMR--------ADREYAVCGQSGGSEQ-WAGRKNFKKFVKLWPSRSSRNSPDSA----TN 615
           L+R        + R  A   +SG   Q W  RKNFK F+K+WP    +N  +      ++
Sbjct: 598 LLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSD 657

Query: 616 ALRNRAHLITREYVPLRPYEGQN 638
            +R+ A LITR YVPLR Y   N
Sbjct: 658 FIRSAAFLITRNYVPLRKYSKNN 680

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 111/237 (46%), Gaps = 21/237 (8%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58
           MW++RYQ    +G   H+SCCL+    YSIGRS+KN L IK+DKSISR H+    E++  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 59  CNVV---LRVV--GKLTKVSGKSVKAGQHLQFTADEE---VLFEMGASPIKATVVKQQSF 110
            N+    L ++  GKLT ++ K +K G+     A E       E+G SP    V      
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167
           W IP  L+        L+ F I   +S+       +I D   S  N    L++L+  IP+
Sbjct: 121 WNIPSHLT---EFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177

Query: 168 LREHFIGDFVTQINDV---HADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNR 221
            +   + D    +      +  FD  W + V+ + +F  +  +    ++  F+  NR
Sbjct: 178 KKLRLLVDVCKTLLPASVRNLKFDEMW-KDVLNSPEFNVFNFDASVLSS-KFMKLNR 232

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 106/401 (26%), Positives = 181/401 (45%), Gaps = 43/401 (10%)

Query: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTK-NPLQIKSDKSISRNHVELEVDQSC 59
           MWILRY Y + +   V+VSCCL++   YSIGRS+K N L IK+DKSISR H+  +     
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  NVVLRVVGKLTKVSGKSVKAGQ--HLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDL 117
            V +   GKLT ++   +K  +   +  +A +E   ++G++P+   +V +  F  +    
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120

Query: 118 SLSQSLSRHLADFDIQVTNSLSSTTSIQ--IIKDSSKSFSNCLFSLIKNIPILREHFIGD 175
              QSL + +  +    T+ ++   +++   IK     + + L +LI+    L +  + D
Sbjct: 121 DTGQSL-KLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKADLVD 179

Query: 176 FVTQ----INDVHADFDSRWDRMV--VENAQFPNYKCE---CRPFTTIHFLVTNRRAFAI 226
            + Q     N+  + FD  W+R V   +  ++PN+K +    R FT I+F   N    + 
Sbjct: 180 LMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYF-DNNDSDISG 238

Query: 227 FKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNV--ILLVHLNNGKSSISSTEQSSDLDV 284
            +  ++   GTL       N + F K+  T++ +  +LL+     + S    E  + +D 
Sbjct: 239 VRSCVEFCGGTLL---SFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKID- 294

Query: 285 QEAKLLKNKAQNLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNK 344
                           I        AV ++N   L+     R L  +  T    +E   +
Sbjct: 295 ----------------ICSTGSFFKAVTENNVSTLVH----RELFLRRYTDITQKEM-RR 333

Query: 345 SVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQ 385
                 DT  P  KR+   R+V PL+ L FF GG  A + +
Sbjct: 334 PKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATTTK 374

>Skud_4.349 Chr4 (598175..600778) [2604 bp, 867 aa] {ON} YDR089W
           (REAL)
          Length = 867

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 11/115 (9%)

Query: 636 GQNANNQDDSFLKNSQDDLQEEATCPSIPPVSSTTILGVEVDDEPAFLFRSQQEDDAYGP 695
            Q +NN+D+ F +  +  +  E  C  IPPV +T  + +E+             DD    
Sbjct: 512 AQRSNNEDNKFRQLMKSFVTNEFQCSLIPPVLTTWKICLEL----------IHSDDLQND 561

Query: 696 DGGLGQRNQHTSVDKDSNRDQELFVFDEEDSQRDH-VDTYTDAVQSRSASGARYQ 749
              L  R+Q+     DS    E F   ++  + +  + T T+  Q  S SG R Q
Sbjct: 562 LFQLLLRDQYKMSPNDSLSPDEFFQLGKDHIEEEFELSTSTNVSQGSSNSGRRVQ 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,157,272
Number of extensions: 3839611
Number of successful extensions: 14400
Number of sequences better than 10.0: 260
Number of HSP's gapped: 15109
Number of HSP's successfully gapped: 296
Length of query: 782
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 664
Effective length of database: 39,950,811
Effective search space: 26527338504
Effective search space used: 26527338504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)