Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214185.436ON48448425520.0
KLTH0F16016g5.436ON48448417880.0
SAKL0G02574g5.436ON48448713830.0
AER403C5.436ON48046710571e-139
Ecym_47605.436ON47847310041e-131
KLLA0E02223g5.436ON4804669781e-127
ZYRO0F10076g5.436ON4824779281e-120
TDEL0E018905.436ON4744689231e-119
Kpol_1062.285.436ON4654924553e-50
TPHA0E017505.436ON4594732859e-27
TBLA0A028105.436ON4814892503e-22
CAGL0M06853g2.304ON4665092033e-16
SAKL0E07194g2.304ON4951811962e-15
Ecym_33422.304ON4952251911e-14
YNL026W (SAM50)2.304ON4841721712e-12
KNAG0H019402.304ON4562071695e-12
Smik_14.3042.304ON5001331642e-11
NDAI0G007102.304ON4912381633e-11
Kpol_1003.512.304ON4781811623e-11
TBLA0B060602.304ON5031851615e-11
Suva_14.3192.304ON4842261615e-11
KAFR0H032502.304ON4623051562e-10
AGR392C2.304ON4951331543e-10
Kwal_27.114562.304ON4962251525e-10
KLTH0G10824g2.304ON4952511518e-10
Skud_14.3022.304ON4841701491e-09
ZYRO0A02310g2.304ON4921861482e-09
TPHA0G008302.304ON4781831437e-09
TDEL0G023402.304ON4942251429e-09
NCAS0G038602.304ON4611761402e-08
NCAS0G037502.304ON4611761402e-08
KLLA0E08735g2.304ON4922261349e-08
TBLA0C024603.408ON107692760.98
Smik_9.113na 1ON469143751.4
Kpol_1043.775.711ON657160751.6
KNAG0D013307.470ON23569694.8
Suva_9.127na 1ON469149696.0
Kwal_23.6529na 2ON598119688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21418
         (484 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   987   0.0  
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   693   0.0  
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   537   0.0  
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   411   e-139
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   391   e-131
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   381   e-127
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   362   e-120
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    360   e-119
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   179   3e-50
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    114   9e-27
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    100   3e-22
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    83   3e-16
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    80   2e-15
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    78   1e-14
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    70   2e-12
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    70   5e-12
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    68   2e-11
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    67   3e-11
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    67   3e-11
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    67   5e-11
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    67   5e-11
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    65   2e-10
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    64   3e-10
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    63   5e-10
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    63   8e-10
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    62   1e-09
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    62   2e-09
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    60   7e-09
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    59   9e-09
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    59   2e-08
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               59   2e-08
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    56   9e-08
TBLA0C02460 Chr3 complement(578682..581912) [3231 bp, 1076 aa] {...    34   0.98 
Smik_9.113 Chr9 complement(195794..196653,196724..197273) [1410 ...    33   1.4  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...    33   1.6  
KNAG0D01330 Chr4 complement(225176..225883) [708 bp, 235 aa] {ON...    31   4.8  
Suva_9.127 Chr9 complement(211483..211973,212005..212923) [1410 ...    31   6.0  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    31   8.9  

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/484 (100%), Positives = 484/484 (100%)

Query: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60
           MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL
Sbjct: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60

Query: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120
           QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA
Sbjct: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120

Query: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180
           RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT
Sbjct: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180

Query: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240
           LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM
Sbjct: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240

Query: 241 NLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGV 300
           NLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGV
Sbjct: 241 NLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGV 300

Query: 301 KIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPT 360
           KIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPT
Sbjct: 301 KIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPT 360

Query: 361 GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQ 420
           GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQ
Sbjct: 361 GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQ 420

Query: 421 FFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS 480
           FFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS
Sbjct: 421 FFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS 480

Query: 481 LSLY 484
           LSLY
Sbjct: 481 LSLY 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/484 (68%), Positives = 399/484 (82%)

Query: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60
           M L  FS+ LQ+ +E  ++Q+SSLKPLYFTSISVDG+    PLS+  YNSVLEPVL QPL
Sbjct: 1   MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL 60

Query: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120
           QTL+QSL+NF EIKKKLIYTG+F DVKISLD + S + L+ L +D +K  +LE P+PTIA
Sbjct: 61  QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIA 120

Query: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180
           RI L P+  N+   TS T DT+ S+G RYS +N  GKAE++TLQ ++ Y PF++T  EK 
Sbjct: 121 RIRLTPINLNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKV 180

Query: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240
           L+AK+++PLQKNPSVKAVFD NYANIDL+GQPF+EK+DQHRQ+QVSVNVGVQKQW+  K 
Sbjct: 181 LEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKT 240

Query: 241 NLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGV 300
            L+PV YNGFSVVARNL +V  EAS AIRQF+APF+KNSFVSQL++DNRKFFGLFPASG+
Sbjct: 241 GLAPVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGL 300

Query: 301 KIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPT 360
           K ++NNEYVLS+ F+K +G  ++ +EGF+K A+  EA R+FF NKIINSL++ACGGI   
Sbjct: 301 KFSINNEYVLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSA 360

Query: 361 GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQ 420
           G S+SLVHH+DKFYLGG++SLKGFERN+VGQHGG  FYKL +ASSFKLP TP  SPLRLQ
Sbjct: 361 GKSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQ 420

Query: 421 FFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS 480
           FF NAG+V N+KPT  SCAASSG+SLLYKS LANMDLTYA PL+NR QD+ KPGFSFGVS
Sbjct: 421 FFFNAGDVQNKKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVS 480

Query: 481 LSLY 484
           LSLY
Sbjct: 481 LSLY 484

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/487 (53%), Positives = 342/487 (70%), Gaps = 6/487 (1%)

Query: 1   MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL 60
           M  P  S   Q++ +   L +S+ KPLY TS+SVDG+ +  PLSDA Y S+L+PVLSQPL
Sbjct: 1   MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL 60

Query: 61  QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIA 120
           Q ++ ++ NF+EIKKKL +TG+F DVKI+LD D SG     L ++  KE  +E P+PT+A
Sbjct: 61  QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVA 120

Query: 121 RILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKT 180
           +I L P  +NKLC TS T+D + S+G R SF+NALGKAE + LQS++ Y+PF     EK+
Sbjct: 121 KIDLIPALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKS 180

Query: 181 LDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKM 240
           LD K ++PLQKNPS+KAV D NYA IDL  QPF+   DQH+Q+Q S N+GVQK WL +K 
Sbjct: 181 LDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKT 240

Query: 241 NLSPVFYNGFSVVARNLH---DVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPA 297
             +P+ +NG S V RNL+   D+ N  S +I+QFN  F+K+SFVSQ+  D RKF GLFP 
Sbjct: 241 GNAPILFNGVSTVIRNLYGFNDIAN-VSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPI 299

Query: 298 SGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGI 357
           SG +  L NEYVL+Q F K+    +  +  F+K  LS E   S+  N+I +SLD +CG I
Sbjct: 300 SGSRFNLVNEYVLTQAFSKNK--TVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAI 357

Query: 358 LPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPL 417
           +PTG+ A++VH MD+FYLGGL SLKGFE N VG  GGNFFY+L + SS++LP     SPL
Sbjct: 358 IPTGSKAAIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPL 417

Query: 418 RLQFFLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSF 477
           R Q F NAG+  N++    S AA++G SL+YK+ LANMDLTYALPL+ R QDVAKPGFSF
Sbjct: 418 RFQVFFNAGDSLNKRELPQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSF 477

Query: 478 GVSLSLY 484
           GV LS +
Sbjct: 478 GVELSFF 484

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 214/467 (45%), Positives = 303/467 (64%), Gaps = 10/467 (2%)

Query: 19  LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLI 78
           L KS  KPLY TS+ V+  K   PLSD    S+L PVL++PLQ+L  +LA+   I+K L+
Sbjct: 19  LGKSQTKPLYITSVQVEDGKDY-PLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLM 77

Query: 79  YTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSST 138
           YTG++ D+ I+LD D S    + L   A KE  +E P+P  A + + P  + +L   ++T
Sbjct: 78  YTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVTTT 137

Query: 139 NDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAV 198
            D+  S G R + VN  G AE+ +LQ++V Y PF     +K +D + +VP Q NPS+KAV
Sbjct: 138 RDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAV 197

Query: 199 FDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNLH 258
           FD NYA +DL+ QP++ + DQH+QRQ+  N+G+QKQWL+ ++  SP  + G S+V RNLH
Sbjct: 198 FDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRL-YSPTAFAGVSIVGRNLH 256

Query: 259 DVP-NEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKD 317
            +  + AS  +  +    LK SFV+Q +  NRK  G FP  G+K    NE VLSQ     
Sbjct: 257 GIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV--- 313

Query: 318 SGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSAS-LVHHMDKFYLG 376
           +G     +E FNK  ++ E   SF +N +  SLD++CG ++ T  +A  +VH MD+FYLG
Sbjct: 314 AGTPQ--EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLG 371

Query: 377 GLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN-EKPTS 435
           GL+SLKGF RN+VG  GG+ FY+L + SS  LP TP  SPLRLQ F NAG+V +  +   
Sbjct: 372 GLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIP 431

Query: 436 VSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482
              AA++G+SL+Y+SP+AN+DLTYALPL++R  D+AKPGFSFGV+++
Sbjct: 432 EDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/473 (46%), Positives = 298/473 (63%), Gaps = 10/473 (2%)

Query: 13  EAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTE 72
           +  E  L K   KPL+ TS+ V+ + KL PLS++ + S+L+PVLSQP Q L  +L+    
Sbjct: 11  DGHEAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGT 69

Query: 73  IKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKL 132
           I+KKL+YTG++ DV I+LD+D S      L + A KE  LE PVP  A+I L P  +  L
Sbjct: 70  IEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPL 129

Query: 133 CFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKN 192
              ++T D+  + G   S +N   +AE + LQ E+   PF     EK L  K +VPLQK 
Sbjct: 130 SLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKL 189

Query: 193 PSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSV 252
           PS+KAVFD NYA +DL  Q ++ + DQH+Q Q+  N+G+Q+Q ++S     P+ Y+G S+
Sbjct: 190 PSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISI 249

Query: 253 VARNLHDV-PNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLS 311
           + RNL D+   E S +I  +     K S+V Q++ +N+KF G  P SG K  L NE VL 
Sbjct: 250 LGRNLLDLKKTEVSSSINSW-VESSKVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLG 308

Query: 312 QRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASL-VHHM 370
           Q    +       + GF K A S E   SF +N II SLD++ G I    + + L VH M
Sbjct: 309 QTVAGEKQ-----ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIM 363

Query: 371 DKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN 430
           D+FYLGGL+SLKGF+RN+VG  GGN FYK+   SSF +P TP  SPLRLQ F+NAG+V N
Sbjct: 364 DQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFN 423

Query: 431 -EKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482
            E+      A ++GISL+Y+S LA++DLTYALPLS RAQDVAKPGFSFGVS++
Sbjct: 424 SERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIA 476

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 292/466 (62%), Gaps = 8/466 (1%)

Query: 25  KPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTGMFS 84
           K +YFT ++VDG+ +L P+SD  Y S+   +L+ PLQ ++ +  +  +I+KKL++TG+F 
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 85  DVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSSTNDTVPS 144
             +I+LD D      + L ++  K L +E P+PTIA++ L P  +NK   +++T DT  S
Sbjct: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136

Query: 145 LGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVFDTNYA 204
            GAR  ++N  G AE ++LQ +V Y PF     E+ L AK+ +P  KNPSVKA    N+ 
Sbjct: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196

Query: 205 NIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNLHDVPN-- 262
            +DL  QPF+ + D+H+Q Q  ++ G++K +L +        +NG ++VARN++   +  
Sbjct: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256

Query: 263 EASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDM 322
             S +I+QF   F K+SF+S+L  D+R+F+  FP SG ++ L +EY+LSQ F   +   +
Sbjct: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFT--NSKPL 314

Query: 323 ALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGN-SASLVHHMDKFYLGGLASL 381
             +  F+K ++S E  R FF  K++ SL +  G I P  N S  LVH +D FYLGG  SL
Sbjct: 315 PHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSL 374

Query: 382 KGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN---EKPTSVSC 438
           KGFERN VG  GG +FYKL ++SSFKLP TP  SPLRLQ F+N G+V N   +       
Sbjct: 375 KGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKP 434

Query: 439 AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484
           A S+GISL+Y +  AN+DL+Y+LPL  R  D+AKPG +FG+ LS +
Sbjct: 435 ALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  362 bits (928), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/477 (41%), Positives = 285/477 (59%), Gaps = 4/477 (0%)

Query: 10  LQQEAEEHL-LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLA 68
           L   A EH+ L  +  KPLY + I +DG+    PLSD+   ++    L+QPLQ++E S+ 
Sbjct: 8   LIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSIN 67

Query: 69  NFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLE 128
            F +I+KKL++TG+FSDV I+LDKD     L  L+++  +   +E+P+ T A++LLK  +
Sbjct: 68  IFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPD 127

Query: 129 FNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVP 188
           +N +  T++ +D   SL    ++ N LG+A+   L+    + P  +    K       +P
Sbjct: 128 YNTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLP 187

Query: 189 LQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYN 248
           L K PSV+A+ +       L  +PFV  +D+H Q+Q +V  G QK+W+ +     P+ Y 
Sbjct: 188 LVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYT 247

Query: 249 GFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEY 308
           G SVV RNL++    AS     F  PF K SFV+    D R+F G FP SG +  LNNEY
Sbjct: 248 GVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEY 307

Query: 309 VLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVH 368
           V+SQ   + S   +  D  FNK A  LE   S +K+KI  S  +  GGI P G+ A  VH
Sbjct: 308 VISQ--SQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVH 365

Query: 369 HMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEV 428
            +D+F LGGL SLKGF  N VG  G NFFYKL ++ S KL  TP +SPLRLQ+F N G  
Sbjct: 366 PLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNA 425

Query: 429 SNEKPTSV-SCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484
           S++  T   S AA++G+SL+YK+P A +DLTYA PL++R QD++KPG S GVSL+ +
Sbjct: 426 SSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 192/468 (41%), Positives = 289/468 (61%), Gaps = 5/468 (1%)

Query: 19  LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLI 78
           +Q S  KPLY + IS+DG+  L PLS + Y ++L+  LS P+Q +  SL  F +I++KL+
Sbjct: 10  IQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLL 69

Query: 79  YTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLE-FNKLCFTSS 137
            TG++ DV+I+L++D      +  ++D+ KE  +ESP+ T ARI+LKP   +N    T+S
Sbjct: 70  CTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTS 129

Query: 138 TNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKA 197
             D   S+    S++N LG+A+  +    +KY P  +    K+L     +PL KNPSV+A
Sbjct: 130 LVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRA 189

Query: 198 VFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNL 257
             + +   ++   + ++ + D H + Q S++ G+QK+W+  + N  P FY G +   R++
Sbjct: 190 SLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDI 249

Query: 258 HDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKD 317
             +  +AS     ++  F K S  S+   D RK++G FP SG ++ +NNEYV+SQ   K 
Sbjct: 250 SGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQ--TKG 307

Query: 318 SGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHMDKFYLGG 377
           S   +  ++ F+K   SL+   S +KNK+ NSLD+  GGI+P       VH MDK+YLGG
Sbjct: 308 SSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE-VHPMDKWYLGG 366

Query: 378 LASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSNEKPTSV- 436
           L S+KGF+ N VG  G +FFYK+ + +S KL  TP  SPLRL FF+N G   N+  T+  
Sbjct: 367 LDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATN 426

Query: 437 SCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484
           S AA++GISL YK+P ANMDLTYA PL++R+QD+ KPGFSFGV+ S +
Sbjct: 427 SYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 143/492 (29%), Positives = 236/492 (47%), Gaps = 41/492 (8%)

Query: 3   LPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQT 62
           + +F E L+ E  +  +  S  KPLY + +SV+ +    PLS +   +VLE V+S P+Q 
Sbjct: 1   MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQN 60

Query: 63  LEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARI 122
           ++ +L +F +IK+ L++TG+++DV ++L  D  G+ L    +    ++ +ES VPT A I
Sbjct: 61  VDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATI 120

Query: 123 LLKPLEFN---KLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEK 179
            LKP +     +  FT+++ND   S+     + N LG A+   +    KY     + ++K
Sbjct: 121 RLKPNDLVTNLQTTFTTTSNDC--SVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQK 178

Query: 180 TLDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQR-QVSVNVGVQKQWLTS 238
               + ++P  K PS++ V   + +          E K  H QR   +   G+QK WL  
Sbjct: 179 YFKGEFILPFTKVPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKD 228

Query: 239 KMNLSPVFYNGFSVVARN-------LHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKF 291
            +N  PVFY+G S+V            DVP+           P  ++ +++    D+ K+
Sbjct: 229 DLNTFPVFYSGLSIVNNKPIFNGEIPIDVPSPEQ-------TPSYQSGWLTTFSKDSTKW 281

Query: 292 FGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLD 351
            G FP SG  + L NEYVLSQ    DS N   ++   N+   + E   S   +++I ++ 
Sbjct: 282 LGSFPNSGECLNLKNEYVLSQL---DSDNK-PINTNINRFEANFEKYVSILNSRVITTVL 337

Query: 352 IACGGILPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRT 411
           +  G   P   S          ++G     +      +  +  +  +K    SSFKLP T
Sbjct: 338 MNGGFQFPIDESTRST------FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNT 391

Query: 412 PQQSPLRLQF-FLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDV 470
              SPLRLQ   L   +          CAA +G+SL+YK+   NM L+Y +PL   +   
Sbjct: 392 ELDSPLRLQISALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSP 451

Query: 471 AKPGFSFGVSLS 482
           A  GFSF ++++
Sbjct: 452 ATSGFSFDIAIT 463

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  114 bits (285), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 114/473 (24%), Positives = 219/473 (46%), Gaps = 36/473 (7%)

Query: 22  SSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTG 81
           S  KP+Y T + V        LSD  Y ++L  V+S P+++++     F  I+  LI +G
Sbjct: 9   SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSG 68

Query: 82  MFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFN--KLCFTSSTN 139
           ++ +V + LD D   + L    + + +++ +ES VP  A + + PL     K   T +T+
Sbjct: 69  LYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128

Query: 140 DTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVF 199
           +T  S+     ++N  G ++  T++        K+   +K++DAK  +PL +N S++ + 
Sbjct: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTIL 188

Query: 200 DTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARN--- 256
           ++  +         + K      +Q  +N+G+ K  L   +   P+FY+G ++  +    
Sbjct: 189 ESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTL 239

Query: 257 --LHDVPNEAS--GAIRQ--FNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVL 310
             L D  +E    G I     N+  LK+ +++    D+R +   FP+ G    L +++VL
Sbjct: 240 GPLSDEESETEIIGNISDEVINSLSLKSEYIT----DSRFYTSKFPSGGHLFKLVHQHVL 295

Query: 311 SQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHM 370
           +   E +S ++  + +  +   +S E   S   ++I +S  I  G +     S     + 
Sbjct: 296 N---ETNSISN-EIKKNISNINMSFEKHISTLNDQITSSF-IFDGHVGVPLQSTFANLNS 350

Query: 371 DKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQF-FLNAGEVS 429
            +F+       K   +N +        +K+ + SSF++P  P  SP+R Q   L   +  
Sbjct: 351 GEFWDNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSK 405

Query: 430 NEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482
                  + +A +G+SL+YK   + M L+Y +PL     D    G SF V+++
Sbjct: 406 RMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 209/489 (42%), Gaps = 54/489 (11%)

Query: 22  SSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTG 81
           +S KPLY + +++    +   +SD+   S+L PVLS PLQ L+ +L  F  I+ KL  T 
Sbjct: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78

Query: 82  MFSDVKISLDKD-TSGNGLKDLHQD-AIKELSLESPVPTIARILL---KPLEFNKLCFTS 136
           +F DVKISLD +  + + +K L  D ++ ++ ++SP+P  A I +   KPL      +T 
Sbjct: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTI 138

Query: 137 STNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVK 196
           S N ++ S    +  +N+L +A+   + +   Y            D     PL    SVK
Sbjct: 139 SNNKSIFSWSKNW--INSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVK 196

Query: 197 AVFDTNYANIDLHGQPFVEKKDQ---------HRQRQVSVNVGVQKQWLTSKMNLSPVFY 247
           +V     + I L  +P  + KD           +  +    VGV+          S   Y
Sbjct: 197 SV-----SGISLF-KPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----------SSNLY 240

Query: 248 NGFSVVARNLHDVPNEASGAIRQFNAPFLKN-------SFVSQLVIDNRKFFGLFPASGV 300
            G ++       + +E +      N   L+N       S +S+   D+R F    P  G 
Sbjct: 241 TGLAINGA----IKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGS 296

Query: 301 KIALNNEYVLSQRFE-KDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACG-GIL 358
              +  EYVL+   + K    ++      ++  ++ E   + F++ I+ SL +  G  I 
Sbjct: 297 YFNIYYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIK 356

Query: 359 PT---GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQS 415
           P+    N  +     ++F +      +  E+N      G  FY + + +S  L    + S
Sbjct: 357 PSINMFNWETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFS 411

Query: 416 PLRLQFFLNAGEVSNEKPTSVSCAASSG-ISLLYKSPLANMDLTYALPLSNRAQDVAKPG 474
           PLR Q  +     +N  P        +G + L+YKS  A  D+ Y LP+   A    K G
Sbjct: 412 PLRFQNSIQLERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAG 471

Query: 475 FSFGVSLSL 483
           F+   S+S 
Sbjct: 472 FAMNASISF 480

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 124/509 (24%), Positives = 200/509 (39%), Gaps = 101/509 (19%)

Query: 12  QEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATY--NSVLEPVLSQPLQTLEQSLAN 69
           Q  +  LL ++   P+  T +  +G + ++P +  TY  N++L+        TL+Q + N
Sbjct: 21  QNFQNGLLNRNLNTPVSVTKVITNGTETIKPQTLQTYLDNTILQAT------TLKQLVKN 74

Query: 70  FTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARI-LLKPLE 128
              +  KL+  G+  DV  +   +           + +   S E+P+P I  I  L  L 
Sbjct: 75  ADFLSAKLVQHGLAQDVYQNFSTN-----------EKVMSPSAENPIPIIDVISQLNILP 123

Query: 129 FNKLCFTSSTN--DTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVV 186
             K    + TN  +        +   N  G  E + L         + TA   ++ A  V
Sbjct: 124 VKKFVAKTGTNVGNNEGEGYLEFQLRNVFGNGESLRLDM------LRGTAKNSSMLASFV 177

Query: 187 VPLQKNPSVKAVFD-------TNYANI---DLH---GQPFVEKKDQHRQRQVSVNVGVQK 233
            P+  NP    V D        N  NI   DLH   G+  ++ +  + Q++++      +
Sbjct: 178 KPI--NPY--HVLDLNIYKHSKNLGNICPLDLHFNGGKMSIKSELGNTQKRIN------Q 227

Query: 234 QWLTSKMNLSPVFYNGFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFG 293
           +W          FY G   V R      + AS  +        K+S      ID R    
Sbjct: 228 EW----------FYEG---VTRTTKVTSDHASDTLLFQAGTDFKSSIGHTYAIDTRDSV- 273

Query: 294 LFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIA 353
           + P  G    LNNE  L + +               K    L   +S+FKN  I +    
Sbjct: 274 MAPNRGNLFKLNNEVALGKYW---------------KSQFELSKVQSWFKNDFITTTTTL 318

Query: 354 CGGILPTGN---SASLVHHMDKFYLGGLASLKGFERNAVGQH------GGNFFYKLHVAS 404
            GG L  GN       +H  DKF  GG   ++ F+   VG        GG+ F    V+ 
Sbjct: 319 KGGYL--GNFHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSI 376

Query: 405 SFKLP-RTPQQSPLRLQFFLNAGEVSNE--KPT-------SVSCAASSGISLLYKSPLAN 454
             KLP +  + S  RL +F N G++ N   KP        S   + S G  ++ + P+A 
Sbjct: 377 FSKLPIKKFEDSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVAR 436

Query: 455 MDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
            +L ++LPL+   +D  + GF FG+ +S 
Sbjct: 437 FELNFSLPLTVSTEDSLRKGFQFGLGMSF 465

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 18/181 (9%)

Query: 320 NDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHM-DKFYLGGL 378
           N++AL + F K  L      S+F N  I       GG +   +  S   HM DKF+ GG 
Sbjct: 315 NELALGK-FWKTTLEFSQTNSWFTNDFITMTGTLKGGYISNFHPKSQPLHMGDKFHNGGS 373

Query: 379 ASLKGFERNAVG------QHGGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNE 431
             ++GF+   +G        GG+ F    V+   +LP R   +S  RL +F+N G + N 
Sbjct: 374 NDVRGFQAMGLGPKDLYDSMGGDAFVAYGVSLFSRLPVRRWYESNFRLHWFVNGGRLINH 433

Query: 432 KPTSVS-C--------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482
             T++S C        + S+G+ L++K P+A  +L + +P+S  + D  + GF +G+ L+
Sbjct: 434 NNTNLSSCIKSLAQEHSTSTGVGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLT 493

Query: 483 L 483
            
Sbjct: 494 F 494

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 98/225 (43%), Gaps = 33/225 (14%)

Query: 276 LKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSL 335
            KNS    +  D+R    +FP+ G  I L NE  L   +               K  L  
Sbjct: 286 FKNSISHAISRDSRDN-AIFPSRGQYIKLFNELSLGTYW---------------KSILEF 329

Query: 336 EAQRSFFKNKIINSLDIACGGILPTGNSAS-LVHHMDKFYLGGLASLKGFERNAVGQH-- 392
              +S+     I       GG +   NS +  +H  DKF+ GG   ++GF++  +G    
Sbjct: 330 TDAKSWLDKDFITMSTTIKGGYIANLNSDNKFIHMKDKFHSGGSNDVRGFQQMGLGPRDI 389

Query: 393 ----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPTSVS------C--- 438
               GG+ F    ++   +LP      S  RL +FLN G + N   + +S      C   
Sbjct: 390 YDSIGGDTFVAYGISVFSRLPVNKWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEH 449

Query: 439 AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
           + ++GI +L+K P+A  +L + LPL+  + D  + GF +G+ LS 
Sbjct: 450 SIATGIGILFKHPVARFELNFTLPLAAHSSDSVRKGFQYGIGLSF 494

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 86/172 (50%), Gaps = 18/172 (10%)

Query: 330 KCALSLEAQRSFFKNKIIN-SLDIACGGILPTGNSASL-VHHMDKFYLGGLASLKGFERN 387
           K  L L + +S+  +  I  S  I  G +    +  SL VH  DKF  GG + ++GF+  
Sbjct: 312 KTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTF 371

Query: 388 AVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPTSV-SC- 438
            +G        GG+ F    ++   +LP +  ++S  RL +F N G++ N   TS+ +C 
Sbjct: 372 GLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCI 431

Query: 439 -------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
                  + S+GI L+ + P+A  +L + LP++    D+ + GF FG+ L+ 
Sbjct: 432 GQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAF 483

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 90/207 (43%), Gaps = 32/207 (15%)

Query: 296 PASGVKIALNNEYVLSQRFEKDSGNDMALDEG--FNKCALSLEAQRSFFKNKIIN-SLDI 352
           P  G    +NNE               A+D G  F K  L L   +S+F    I  S  +
Sbjct: 262 PTKGTMYKINNEL-------------GAMDNGSSFWKTVLELNHVKSWFPRDFITLSTTL 308

Query: 353 ACGGILPTGNSASLVHHMDKFYLGGLASLKGFERNAVG-QH-----GGNFFYKLHVASSF 406
             G I     + S +H  DKF  GG   ++ F+ N +G +H     GG+ F    V+   
Sbjct: 309 RSGYIKNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMHHSMGGDAFIAYGVSLFS 368

Query: 407 KLP-RTPQQSPLRLQFFLNAGEVSNE---------KPTSVSCAASSGISLLYKSPLANMD 456
           K+P +  Q S  RL ++ N G++ N          +  ++  + S G  ++ + P+A  +
Sbjct: 369 KIPLKRFQDSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEHSTSIGAGIVMRHPMARFE 428

Query: 457 LTYALPLSNRAQDVAKPGFSFGVSLSL 483
           L + +PL++   D+ + GF FG+    
Sbjct: 429 LNFGVPLTSHVGDLQRKGFQFGLGFEF 455

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 69/133 (51%), Gaps = 16/133 (12%)

Query: 367 VHHMDKFYLGGLASLKGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRL 419
           VH  DKF  GG   ++ F+   +G        GG+ F    V+   +LP +  ++S  RL
Sbjct: 367 VHICDKFQSGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSMFSRLPWKKVEKSNFRL 426

Query: 420 QFFLNAGEVSNEKPTSVS-C--------AASSGISLLYKSPLANMDLTYALPLSNRAQDV 470
            +F N G++ N   TS+S C        + S+GI L+ + PLA  +L ++LP++    D+
Sbjct: 427 HWFFNGGKLINHDNTSLSNCIGQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHENDL 486

Query: 471 AKPGFSFGVSLSL 483
            + GF FG+ L+ 
Sbjct: 487 MRKGFQFGLGLAF 499

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 104/238 (43%), Gaps = 37/238 (15%)

Query: 276 LKNSFVSQLVIDNRKFFGL----FPASGVKIALNNEYVLSQRFEKDSGNDMALDEG--FN 329
            KNS  S  V D+R    L    FP++G      NE           GN  +   G  F 
Sbjct: 260 WKNSLGSNFVWDSRNNSVLDPNAFPSNGQLFKWFNELNFI-------GNRSSTANGGPFW 312

Query: 330 KCALSLEAQRSFFKNKIIN-SLDIACGGI--LPTGN-----SASLVHHMDKFYLGGLASL 381
           K  L     RS+  N  I  +     G I  L T N     S+S +H  DKF  GG   +
Sbjct: 313 KNQLEFTQIRSWLPNDFITMNCTFRTGYIKQLLTKNEVQKGSSSFLHISDKFQNGGPNDI 372

Query: 382 KGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPT 434
           + F+   +G        GG+ F    ++   KLP +   +S  RL +FLN G++ N    
Sbjct: 373 RSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLPIKDWSKSNFRLHWFLNGGKLINHNGM 432

Query: 435 SVS-C--------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
           S++ C        + S+G+ +L + P+A  +L +++PL+    D  + GF FGV LS 
Sbjct: 433 SINNCFTDLSRQHSISTGVGILLRHPMARFELNFSVPLTIHQGDDVRKGFQFGVGLSF 490

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 86/181 (47%), Gaps = 18/181 (9%)

Query: 320 NDMALDEGFNKCALSLEAQRSFFKNKIINSLDI-ACGGILPTGNSASLVHHMDKFYLGGL 378
           N++AL++ F K  +   + +S++++     +     G I    ++   +H  DKF+LGG 
Sbjct: 298 NELALNQYF-KSQMEFSSSKSWYQDNFFTLMGTYKFGWITKIDDNDKPLHISDKFHLGGS 356

Query: 379 ASLKGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNE 431
             ++GF+   +G        GG+ F    ++   KLP +    S  RL  F N G++ N+
Sbjct: 357 NDVRGFQLMGLGPKQINDAIGGDMFSAYGISLFSKLPFKKFSDSNFRLHAFFNGGKLVNQ 416

Query: 432 KPTSVSCAASS---------GISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482
              +      S         G  +++K P+A  +L + LPL++ + D  + GF +G+ +S
Sbjct: 417 NTNTFDRNLQSLFKENSLAIGTGIIFKHPVARFELNFTLPLTSYSTDHVRKGFQYGIGMS 476

Query: 483 L 483
            
Sbjct: 477 F 477

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 24/185 (12%)

Query: 319 GNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIAC----GGILPTGNSASLVHHMDKFY 374
           GN+ A D  F K  L +   +SFF++  I    +AC    G I     ++  +H  DKF 
Sbjct: 322 GNEFAPDRFF-KTNLEIVKNKSFFRDDFIT---MACTFKTGYIHNFFPNSKAIHRNDKFQ 377

Query: 375 LGGLASLKGFERNAVGQH------GGNFFYKLHVASSFKLPRTP-QQSPLRLQFFLNAGE 427
            GG   ++GF+   +G        GG+ F     +   K+P      S  R  +F+N G+
Sbjct: 378 NGGANDIRGFQFMGLGPKDRFDSVGGDAFISYGFSVMNKIPIWKFYDSNFRFHWFVNGGK 437

Query: 428 VSNEK---------PTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFG 478
           + N             S   + S G+ ++++ P+A  +L +A+P+   + D+ + GF +G
Sbjct: 438 LINSNGKGLLNTFNDLSKQNSMSVGMGIVFRHPMARFELNFAIPVVTHSGDITRKGFQYG 497

Query: 479 VSLSL 483
           + LS 
Sbjct: 498 IGLSF 502

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 97/226 (42%), Gaps = 34/226 (15%)

Query: 276 LKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSL 335
           L+       V+D R  F + P  G  +  +NE    + +               K  L L
Sbjct: 274 LRTVLGHTFVLDKRNHF-MCPTKGSMLKWSNELSPGKHW---------------KTQLEL 317

Query: 336 EAQRSFFKNKIIN-SLDIACGGILPTGNSASL-VHHMDKFYLGGLASLKGFERNAVGQH- 392
              +S+  +  I  S     G +    +  SL VH  DKF  GG   ++ F+   +G   
Sbjct: 318 NNVKSWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQNGGPNDIRSFQTFGLGPRD 377

Query: 393 -----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPTSVS-C------- 438
                GG+ F    V+   +LP +  Q+S  RL +F N G++ N    S+S C       
Sbjct: 378 LYDAIGGDAFVSYGVSVFSRLPWKKVQKSNFRLHWFFNGGKLINHDNMSLSNCIGQLSKE 437

Query: 439 -AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
            + S+GI L+ + P+A  +L ++LP++    D+ + G  FG+ L+ 
Sbjct: 438 HSTSTGIGLVLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAF 483

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 126/305 (41%), Gaps = 48/305 (15%)

Query: 208 LHGQPFVEKKDQHRQRQVSVNVGVQ--------KQWLTSKMNLSPVFYN-GFSVVARNLH 258
           ++G PF   K       V  NVGV+        K W  +K   +   Y+ G  +V RN +
Sbjct: 176 INGDPFWSSKLD--IFDVWKNVGVKDLGLYMGTKSWFDAKNTWN---YDLGLEMVKRNFN 230

Query: 259 DVPNEASGAIRQF----NAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRF 314
              N +S  +  +       F K +  S +V D R      P  G    +NN+       
Sbjct: 231 HKLN-SSKVVSDYLLIQEGEFYKTTLRSTMVWDGRNG-KTAPTKGRLFKINNDLGFGT-- 286

Query: 315 EKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVHHMDKFY 374
                N++     F +        +S+ K+  I   +    G +    S   +H  DKF 
Sbjct: 287 -----NNLQ----FWRHVTEFNLVKSWLKDDFITMSNTIKFGYIKNL-SQDYIHFTDKFQ 336

Query: 375 LGGLASLKGFERNAVG-QH-----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGE 427
            GG   ++ F+   +G +H     GG+ F    V+   KLP +    S  RL +F N G+
Sbjct: 337 NGGPNDIRSFQSMGIGPRHNSYSLGGDAFLSYGVSIFSKLPIQKFHDSNFRLHWFFNGGK 396

Query: 428 VSNEKPTSV-SC--------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFG 478
           + N    S+ +C        + S+G+ ++ + P+A  ++ +A+P+++   D+ + GF FG
Sbjct: 397 LINHDNASIWNCMQNLTIENSTSAGVGVVLRHPMARFEMNFAVPITDHQDDLTRKGFQFG 456

Query: 479 VSLSL 483
           +    
Sbjct: 457 LGFEF 461

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (49%), Gaps = 18/133 (13%)

Query: 367 VHHMDKFYLGGLASLKGFE------RNAVGQHGGNFF--YKLHVASSFKLPRTPQQSPLR 418
           +H  DKF+ GG   ++GF+      ++A    GG+ F  Y L + S   + R    S  R
Sbjct: 362 IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSLFSRLPVQRWAG-SDFR 420

Query: 419 LQFFLNAGEVSNEKPTSV---------SCAASSGISLLYKSPLANMDLTYALPLSNRAQD 469
           L +FLN G + +    S+           + S G  LL++ P+A  +L + LPL+  + D
Sbjct: 421 LHWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVARFELNFTLPLATHSSD 480

Query: 470 VAKPGFSFGVSLS 482
            A+ GF +G+ +S
Sbjct: 481 TARKGFQYGIGVS 493

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 97/225 (43%), Gaps = 33/225 (14%)

Query: 276 LKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSL 335
           +KNS    +  D R    +FP +G  + ++NE  L++               F K +   
Sbjct: 287 IKNSLCHSIFWDTRDK-PIFPLAGSFLKISNEIALNK---------------FWKSSFEF 330

Query: 336 EAQRSFFKNKIINSLDIACGGILPTGNSASL-VHHMDKFYLGGLASLKGFERNAVG---- 390
              RS+  N    +     GG +   +  +  +H  DKF+ GG   ++ F+   +G    
Sbjct: 331 SNVRSWCNNDFFTASGTVKGGYINNFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDL 390

Query: 391 --QHGGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPT----SVSCAAS-- 441
               GG+ F    V+   +LP +   +S  RL  F N   + N   T    S+S  AS  
Sbjct: 391 YDSMGGDAFVSYGVSIFSRLPIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEH 450

Query: 442 ---SGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
              +G+ L++  P+A  +L + +PL+  + D  + GF +G+ LS 
Sbjct: 451 STSTGVGLVFGHPVARFELNFCVPLTAHSSDSIRKGFQYGIGLSF 495

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 101/251 (40%), Gaps = 32/251 (12%)

Query: 249 GFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEY 308
           G   + R+       +S ++       +KNS    +  D R    +FP +G    L NE 
Sbjct: 260 GVESLWRSTQATSTHSSDSLLLLAGDEVKNSLSHSVFWDTRDR-PIFPLAGSFYKLTNEL 318

Query: 309 VLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVH 368
             S+ +               KC       +S+ KN    +     GG +   +++  +H
Sbjct: 319 SPSKYW---------------KCFFEASKVKSWRKNDFFTASFTLKGGYINNFSASKPLH 363

Query: 369 HMDKFYLGGLASLKGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQF 421
             DKF+ GG   ++ F+   +G        GG+ F    V+   +LP +    S  RL  
Sbjct: 364 ISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDSNFRLHA 423

Query: 422 FLNAGEVSNEKPTSV-SC--------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAK 472
           F N   + N     + +C        + S+GI L+   P+A  +L + +PL+    D A+
Sbjct: 424 FFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAHTSDSAR 483

Query: 473 PGFSFGVSLSL 483
            GF +G+ LS 
Sbjct: 484 KGFQYGIGLSF 494

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 80/170 (47%), Gaps = 18/170 (10%)

Query: 330 KCALSLEAQRSFFKNKIIN-SLDIACGGILPTGNSASL-VHHMDKFYLGGLASLKGFERN 387
           K  L L   +S+  +  I  S     G +    +  SL +H  DKF  GG   ++ F+  
Sbjct: 312 KTQLELNNVKSWLNDDFITFSTTFKTGYLENISSQRSLPIHICDKFQSGGPNDIRSFQTF 371

Query: 388 AVGQH------GGNFFYKLHVASSFKLPRTP-QQSPLRLQFFLNAGEVSNEKPTSVS-C- 438
            +G        GG+ F    V+   +LP    ++S  RL +F N G++ N    S+S C 
Sbjct: 372 GLGPRDLYDTIGGDAFVSYGVSVFSRLPWEKVKKSNFRLHWFFNGGKLINHDNMSLSNCM 431

Query: 439 -------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSL 481
                  + S+G+ L+ + P+A  +L ++LP++    D+ + GF FG+ L
Sbjct: 432 GRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGL 481

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 84/186 (45%), Gaps = 28/186 (15%)

Query: 320 NDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGN------SASLVHHMDKF 373
           N+++L + F K  + L   +S+F++  +        G L TG       ++  ++  DKF
Sbjct: 312 NELSLGK-FWKSQIELSKAQSWFRDDWL-----TVNGTLKTGYIHNFHPTSQSLNICDKF 365

Query: 374 YLGGLASLKGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAG 426
             GG   ++ F+   +G        GG+ F    V+   +LP      S  RL +FLN G
Sbjct: 366 QNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVFTRLPFHKISHSNFRLHWFLNGG 425

Query: 427 EVSNE---------KPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSF 477
           ++ N          K  S   + S G  L+ K P+A  +L +ALP++    D  + GF +
Sbjct: 426 KLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKHPVARFELNFALPVTCHTGDCIRKGFQY 485

Query: 478 GVSLSL 483
           G+ LS 
Sbjct: 486 GIGLSF 491

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 320 NDMALDEGFNKCALSLEAQRSFFKNKIIN-SLDIACGGILPTGNSASLVHHMDKFYLGGL 378
           N++AL+  + K  + +    SF KN +I  +  +  G I    ++   +H  D+F LGG 
Sbjct: 296 NEVALNR-YLKSQIEVNTAMSFLKNSLITVNGTMRLGYISNISSTLRPLHIGDRFQLGGG 354

Query: 379 ASLKGFERNAVGQH------GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNE 431
             ++ F+   +G        GGN +    ++    LP ++   S  ++  F+N G++ N 
Sbjct: 355 NDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPFKSLMTSNFKIHTFINGGKLINH 414

Query: 432 KPTSVSC-----------AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVS 480
             ++ +            + S+G+ +++K P+A  +L + LPL     D+ + GF +G+ 
Sbjct: 415 NSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELNFTLPLITHKSDMVRKGFQYGIG 474

Query: 481 LSL 483
           +S 
Sbjct: 475 ISF 477

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 93/225 (41%), Gaps = 33/225 (14%)

Query: 276 LKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSL 335
           +K S    L IDNR    + P+ G  + L NE  + Q               F K  + +
Sbjct: 285 IKCSLGHTLAIDNRDN-PIAPSRGSLLKLTNELAIGQ---------------FWKGQIEV 328

Query: 336 EAQRSFFKNKIINSL-DIACGGILPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQH-- 392
               S+ K+  + S   +  G I    +S   ++  DKF+ GG   ++ F    +G    
Sbjct: 329 SQNNSWLKDDFLGSCCTLRSGYIQNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDL 388

Query: 393 ----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNE---------KPTSVSC 438
               GG+ F    V+   +LP +    S  RL +F N G++ N          +  +   
Sbjct: 389 YDSIGGDAFVAYGVSFFSRLPIKRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEH 448

Query: 439 AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
           + S G  +L +  +A  +L + LPL+  + D  + GF +G+ +S 
Sbjct: 449 STSVGFGILLRHQVARFELNFTLPLTCHSGDALRKGFQYGIGISF 493

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query: 328 FNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASL----VHHMDKFYLGGLASLKG 383
           + K  L L   +S+F N  +    ++C     TG   SL    VH  DKF  GG   ++ 
Sbjct: 290 YWKNQLELSHLKSWFDNDFVT---MSCN--FKTGYIHSLSSQSVHISDKFQSGGPNDIRS 344

Query: 384 FERNAVG--QH----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPTSV 436
           F+   +G   H    GG+ F    V+   +LP      S  RL  F+N G + +    ++
Sbjct: 345 FQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQAL 404

Query: 437 S-CAA--------SSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
           + C A        S+G+ ++ + P+A  +L +++PL+  + D  + G  FGV LS 
Sbjct: 405 TDCLAALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query: 328 FNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASL----VHHMDKFYLGGLASLKG 383
           + K  L L   +S+F N  +    ++C     TG   SL    VH  DKF  GG   ++ 
Sbjct: 290 YWKNQLELSHLKSWFDNDFVT---MSCN--FKTGYIHSLSSQSVHISDKFQSGGPNDIRS 344

Query: 384 FERNAVG--QH----GGNFFYKLHVASSFKLP-RTPQQSPLRLQFFLNAGEVSNEKPTSV 436
           F+   +G   H    GG+ F    V+   +LP      S  RL  F+N G + +    ++
Sbjct: 345 FQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQAL 404

Query: 437 S-CAA--------SSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
           + C A        S+G+ ++ + P+A  +L +++PL+  + D  + G  FGV LS 
Sbjct: 405 TDCLAALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 90/226 (39%), Gaps = 35/226 (15%)

Query: 276 LKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSL 335
           +K+S V  +  D R    + P+SG      NE  L +               F K  L  
Sbjct: 283 VKHSVVHSITRDTRDNI-IAPSSGQMWKFINEVSLGK---------------FWKTNLEY 326

Query: 336 EAQRSFF-KNKIINSLDIACGGILPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQH-- 392
              +S+F +N I  S  +  G I         +H  DKFY GG   ++ F+   +G    
Sbjct: 327 NFTKSWFNRNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDI 386

Query: 393 ----GGN--FFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSNEKPTSVS--------- 437
               GG+    Y L + S     R    S  RL  F N G + N    + +         
Sbjct: 387 YDYVGGDTSLSYGLSLFSRLPFKRF-YDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQ 445

Query: 438 CAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSL 483
            + S+G  L+++ P+A  +L + +P++    D  + GF +G+ +S 
Sbjct: 446 HSLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISF 491

>TBLA0C02460 Chr3 complement(578682..581912) [3231 bp, 1076 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1076

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 81  GMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESP-VPTIARILLKPLEFNKLCFTSSTN 139
            MFS + ++ D       +K L    I+E    S  +  +   ++K   +NK+ FT+ TN
Sbjct: 633 SMFSTI-LNEDLKHQSKIIKKLEMKIIQENKHSSKLIKPLKHFIIKDERYNKIDFTNETN 691

Query: 140 DTVPSLGARYSFVNALGKAEIVT--LQSEVKY 169
           D+  SL   ++ +N + K +++T  L +E+KY
Sbjct: 692 DSSNSLPVCFTVLNEMLKLKLITKELVNELKY 723

>Smik_9.113 Chr9 complement(195794..196653,196724..197273) [1410 bp,
           469 aa] {ON} YIL074C (REAL)
          Length = 469

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 17/143 (11%)

Query: 150 SFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVFDTNYANIDLH 209
           SF+N L +   +T Q +    PF       T D K+++    NP+   +F      ++ H
Sbjct: 33  SFMNTLPRRVSITKQPKA-LKPFS------TGDMKILLLENVNPTAIKIFKDQGYQVEFH 85

Query: 210 GQPFVEKKDQHRQRQVSVNVGVQ-KQWLTSKM-----NLSPVFYNGFSVVARNLHDVPNE 263
                E +   R + V   +G++ K  LT K+     NL  V   G   +  N  D+   
Sbjct: 86  KSSLPEDELIERIKDVHA-IGIRSKTRLTEKVLQHARNLVCV---GCFCIGTNQVDLKYA 141

Query: 264 ASGAIRQFNAPFLKNSFVSQLVI 286
           AS  I  FN+PF  +  V++LVI
Sbjct: 142 ASKGIAVFNSPFSNSRSVAELVI 164

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 25/160 (15%)

Query: 48  YNSVLEPVLSQPLQTLEQSLANFTE------IKKKLIY--TGMFSDVKISLDKDTSGNGL 99
           Y  V + V  +  Q L  ++   TE      IK K+I   TG +SD  + +D +   NGL
Sbjct: 251 YMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTILQMDNNK--NGL 308

Query: 100 KDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSSTNDTVPSLGAR-----YSFVNA 154
            D+ +  I+  +L++P+  I      P   +K     + N  VPS G       Y   + 
Sbjct: 309 PDMFKKEIETGNLKTPLNVIT-----PESISKEVAVQNPNMVVPSAGVHIILPSYYCPSE 363

Query: 155 LGKAEIVTLQSEVK-YIPFKNTALEKTLDAKVVVPLQKNP 193
           +G  +  T    V  ++P++   L  T D    +P++  P
Sbjct: 364 MGLLDANTADGRVMFFLPWQGKVLAGTTD----IPMKTVP 399

>KNAG0D01330 Chr4 complement(225176..225883) [708 bp, 235 aa] {ON}
           Anc_7.470 YJR099W
          Length = 235

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%)

Query: 115 PVPTIARILLKPLEFNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKN 174
           P P +A +LL P++ NK    S+ N     +  + +F NA G   ++ +    K++  K 
Sbjct: 49  PRPMVAIVLLFPIQKNKPAVGSAENKGTTPIWLKQNFKNACGLYALLHILVNNKHLLTKG 108

Query: 175 TALEKTLDA 183
           +AL + L++
Sbjct: 109 SALLEYLES 117

>Suva_9.127 Chr9 complement(211483..211973,212005..212923) [1410 bp,
           469 aa] {ON} YIL074C (REAL)
          Length = 469

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 65/149 (43%), Gaps = 29/149 (19%)

Query: 150 SFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVFDTNYANIDLH 209
           SF+N L +   +T Q +    PF       T D K+++    NP+   +F      ++ H
Sbjct: 33  SFMNTLPRRVSITKQPKA-LKPFS------TGDMKILLLENVNPTAIKIFKEQGYQVEFH 85

Query: 210 G-----QPFVEK-KDQHRQRQVSVNVGVQ-KQWLTSKM-----NLSPVFYNGFSVVARNL 257
                 +  +EK KD H        +G++ K  LT K+     NL  +   G   +  N 
Sbjct: 86  KSSLPEEELIEKIKDAHA-------IGIRSKTRLTEKILQHARNLVCI---GCFCIGTNQ 135

Query: 258 HDVPNEASGAIRQFNAPFLKNSFVSQLVI 286
            D+   AS  I  FN+PF  +  V++LVI
Sbjct: 136 VDLKYAASKGIAVFNSPFSNSRSVAELVI 164

>Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR034C
           (LYS14) - transcription factor involved in lysine
           biosynthesis [contig 358] FULL
          Length = 598

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 11/119 (9%)

Query: 70  FTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEF 129
           FT ++ K++   + +DV   +D+  S     D+H+  +  L L+  + T  R     LE 
Sbjct: 393 FTGLETKVL--SLLADVAALIDRKESVEEHDDMHELMLNALELDHEIVTYLR--ESELER 448

Query: 130 NKLCFTSSTNDTVPSLGARYSFVNAL-------GKAEIVTLQSEVKYIPFKNTALEKTL 181
           +K+C     + T PS+  +Y     +       G   ++ L+  V  IP ++T ++  L
Sbjct: 449 DKICAQLLQDVTDPSISLQYQSYKTMRATNMIFGLTGVLQLKRRVIGIPQRSTIVKDLL 507

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,619,507
Number of extensions: 2335793
Number of successful extensions: 6602
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6773
Number of HSP's successfully gapped: 55
Length of query: 484
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 371
Effective length of database: 40,524,141
Effective search space: 15034456311
Effective search space used: 15034456311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)