Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214155.437ON38938920300.0
KLTH0F15994g5.437ON39037512091e-165
SAKL0G02596g5.437ON4003838271e-107
Suva_2.5425.437ON4423815581e-66
KAFR0E038205.437ON3963625332e-63
NDAI0B056905.437ON4233775133e-60
AER404C5.437ON3863555052e-59
Skud_4.6395.437ON4423675065e-59
YDR370C5.437ON4423735031e-58
Smik_4.6365.437ON4463964971e-57
TDEL0B021805.437ON4183224653e-53
NCAS0F034005.437ON4153844566e-52
ZYRO0F10098g5.437ON3733564362e-49
KLLA0E02245g5.437ON4033594363e-49
CAGL0A02860g5.437ON4022864312e-48
Kpol_1016.45.437ON4133733762e-40
TBLA0A028005.437ON4534013609e-38
KNAG0C048905.437ON4053883571e-37
TPHA0J026005.437ON4413692702e-25
NDAI0I032603.570ON3773081231e-06
YGL246C (RAI1)3.570ON3871621033e-04
SAKL0F00726g3.570ON383122980.001
Suva_7.153.570ON389162980.001
Smik_7.153.570ON387122970.002
KLTH0G00660g3.570ON383142960.002
Kwal_47.192763.570ON386121950.003
NCAS0E002403.570ON380167950.003
Skud_7.213.570ON389162950.004
ZYRO0E09592g3.570ON380120940.005
CAGL0C01925g3.570ON400210930.006
KLLA0E12893g3.570ON384120930.006
Kwal_27.100121.506ON1018119890.025
KAFR0J001603.570ON380100860.040
TPHA0G036503.570ON37799840.065
Ecym_26003.570ON384121790.31
NCAS0G034101.506ON1056146770.55
TDEL0D063803.570ON37863741.2
AFR263C3.570ON376101722.2
TBLA0E001803.570ON37864712.7
KNAG0D029703.570ON386102703.1
Kpol_380.83.570ON379126678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21415
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   786   0.0  
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   470   e-165
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   323   e-107
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   219   1e-66
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   209   2e-63
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   202   3e-60
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   199   2e-59
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   199   5e-59
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   198   1e-58
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   196   1e-57
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   183   3e-53
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   180   6e-52
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   172   2e-49
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   172   3e-49
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   170   2e-48
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   149   2e-40
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   143   9e-38
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   142   1e-37
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   108   2e-25
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     52   1e-06
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    44   3e-04
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    42   0.001
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    42   0.001
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    42   0.002
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    42   0.002
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    41   0.003
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    41   0.003
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    41   0.004
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    41   0.005
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    40   0.006
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    40   0.006
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...    39   0.025
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    38   0.040
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    37   0.065
Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar...    35   0.31 
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....    34   0.55 
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    33   1.2  
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    32   2.2  
TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}...    32   2.7  
KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.5...    32   3.1  
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    30   8.5  

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/389 (96%), Positives = 377/389 (96%)

Query: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLL 60
           MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLL
Sbjct: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLL 60

Query: 61  DDKLGMPELVQDLCEFTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLER 120
           DDKLGMPELVQDLCEFTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLER
Sbjct: 61  DDKLGMPELVQDLCEFTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLER 120

Query: 121 WKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTD 180
           WKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTD
Sbjct: 121 WKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTD 180

Query: 181 QGIHSGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFN 240
           QGIHSGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVE            AEMDCFN
Sbjct: 181 QGIHSGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFN 240

Query: 241 SSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYT 300
           SSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYT
Sbjct: 241 SSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYT 300

Query: 301 RSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTL 360
           RSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTL
Sbjct: 301 RSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTL 360

Query: 361 RKNLTIKLRKMPETPAPTKGTIFKVPKKK 389
           RKNLTIKLRKMPETPAPTKGTIFKVPKKK
Sbjct: 361 RKNLTIKLRKMPETPAPTKGTIFKVPKKK 389

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 214/375 (57%), Positives = 284/375 (75%), Gaps = 1/375 (0%)

Query: 5   LQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLDDKL 64
            + LSL+D  +E   +C+ F+ A I+ FP   L FFDEV+E+ T+TH +D+D+F L  K 
Sbjct: 5   FEKLSLEDLPDEACVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQ 64

Query: 65  GMPELVQDLCEFTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQL 124
             P L +DL  FT + KLA    Y+GHDLL+H+D++ P+TP QLEDM+GV  FL +W+  
Sbjct: 65  SAPHLKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGD 124

Query: 125 HGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTDQGIH 184
           HG+ +   +DFTIVCSRHNLIDLIM PFSDEDVH  +++ NGYL++ PD Q+QK D GI+
Sbjct: 125 HGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIY 184

Query: 185 SGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTR 244
           S ++ I++ICYTGFELE+L+T T     +S+FYSLV+            AEMDCFN + R
Sbjct: 185 SSESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKR 244

Query: 245 SYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQL 304
           SYTEIKC++GLKVKS +HRRKLLRMWVQTSLVPST+LL+G+RDPYYHQL+SFECYTR +L
Sbjct: 245 SYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304

Query: 305 YRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNL 364
           Y+KFNN+ L++++K YNYNA ISVQWFRH++++LCQ I P++EK   E V+F+LTL K L
Sbjct: 305 YQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQL 364

Query: 365 TIKLRKMPETPAPTK 379
            ++LRK+ ETP+  K
Sbjct: 365 ELRLRKI-ETPSTAK 378

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  323 bits (827), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 247/383 (64%), Gaps = 12/383 (3%)

Query: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLL 60
           +  ++  LSLQ  ++   ANCK F H+ ++ FP     FF E +E+ T T ++ + ++L 
Sbjct: 8   LTADISKLSLQHGSQNT-ANCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLF 66

Query: 61  DDKLGMPELVQDLCEFTES-GKLANKGK--YIGHDLLDHFDEYVPITPKQLEDMAGVQAF 117
           DDKLG+  L  D+CE+  +  K A+K K  Y+G+DLL+ F++Y+P++  +L +M G+  F
Sbjct: 67  DDKLGLRPLKDDICEYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNF 126

Query: 118 LERWKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQ 177
           +  W++ +G+ +     FTIV +RH+LIDLIM PFS E+ +L +   +G L +S D    
Sbjct: 127 IGNWEEKNGKKYGSENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKP 186

Query: 178 KTDQGIHSGDTKIKKICYTGFELENLITA--TSKPDVRSSFYSLVEXXXXXXXXXXXXAE 235
           K D GI S DT+++K+CYTGFELENL+T      P + + FYS+VE            AE
Sbjct: 187 KVDSGIRSKDTRVRKLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAE 246

Query: 236 MDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTS 295
           MD +N  T +Y E+KCS   ++K++ HRRKLLRMW+QT LVP T+LLVG RDPYY+QL +
Sbjct: 247 MDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDA 306

Query: 296 FECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEV- 354
            + YTR ++Y+KF+ + L   RK YN+N+T++VQW  HVI ++ ++    ++K   +E  
Sbjct: 307 LKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITEL----VDKNLTDEPL 362

Query: 355 -NFRLTLRKNLTIKLRKMPETPA 376
            +F+LTL ++L + L K+  TPA
Sbjct: 363 QSFKLTLTRDLQLSLTKLANTPA 385

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  219 bits (558), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/381 (33%), Positives = 211/381 (55%), Gaps = 18/381 (4%)

Query: 10  LQDRTEEVHANCKNFQHAQINQFPKNVLP-FFDEVQEVATITHLLDTDEFLLDDKLGMPE 68
           L++ +E       +F H  I  FP    P  F E +EVA  T   D   ++   K  +P 
Sbjct: 57  LEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPN 113

Query: 69  LVQDLCEFTESGKL-ANKGK--YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWK-QL 124
           L +D+    ES  L A K K  Y+G DL  + DE VP+T  +L+ +A   +++E W+   
Sbjct: 114 LKEDISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNN 173

Query: 125 HGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKI---QFSNGYLNLSPDAQY--QKT 179
            G+ F     FT+V +RH+++DL M PF   +    I      NG+++LS + +Y  + +
Sbjct: 174 SGKPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKAS 233

Query: 180 DQGIHSGDTKIKKICYTGFELENLITATSKPDVRSS----FYSLVEXXXXXXXXXXXXAE 235
            +GI+SGD  IKKIC++GFE EN +T  +K    S+     +S+VE             E
Sbjct: 234 KEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCE 293

Query: 236 MDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTS 295
           MD FN  +++ TE+KC   L ++++ HR+KLL+ W+QT L+P+++++VG+RD Y  QL  
Sbjct: 294 MDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLD 353

Query: 296 FECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK-GSKEEV 354
            + Y+R  L+RKFN+  L + +K  NYNA ++V+W +H I+ +C +++  I +    +  
Sbjct: 354 IQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPE 413

Query: 355 NFRLTLRKNLTIKLRKMPETP 375
            F + +  N TI + K+   P
Sbjct: 414 PFEINIDANGTIIITKLSTIP 434

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  209 bits (533), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 202/362 (55%), Gaps = 17/362 (4%)

Query: 22  KNFQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTES 79
           K FQH  I  FP +   FF   +EVAT     + + +E   D    +P L +D+ +  + 
Sbjct: 33  KRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDI---LPLLNKDISKIAQG 89

Query: 80  GKLAN----KGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADF 135
               +    K KYIG DL   F+ +  ++ ++L+      A++++W+  H   + +N  +
Sbjct: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKY 149

Query: 136 TIVCSRHNLIDLIMMPF--SDEDVHLKIQFSNGYLNLSPDAQYQKT-DQGIHSGDTKIKK 192
           TIV +RH++++LIM  F  S E +       NG L  S D     T ++GI + +  +KK
Sbjct: 150 TIVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKK 209

Query: 193 ICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCS 252
           ICY+GF LE+L+T + K       +S+ E             EMD +N  T++YTE+KC 
Sbjct: 210 ICYSGFALEDLLTKSQK----EPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCY 265

Query: 253 SGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQR 312
           + LK+ S  HR+KLL+ W+QT ++PS++L+ GIR PY  +L   E Y+R  LYR+FNN+ 
Sbjct: 266 APLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRN 325

Query: 313 LTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIK-LRKM 371
           L   +K+ N+NA I+V+W  H I+ +C++I   ++  + +    ++   +N++I+ L K+
Sbjct: 326 LPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKI 385

Query: 372 PE 373
           P+
Sbjct: 386 PQ 387

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  202 bits (513), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 207/377 (54%), Gaps = 27/377 (7%)

Query: 22  KNFQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKL--GMPELVQDLCEFT 77
           K F+H  I+ +PK    FF+  ++VA      L  +D+  L  +L   + +L    C   
Sbjct: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLN 101

Query: 78  ESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTI 137
           E+  L  K  Y+G DL D ++ ++P+ P +L+ +     ++E W+  +   +     FTI
Sbjct: 102 EARDL--KLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTI 159

Query: 138 VCSRHNLIDLIMMPFSD---EDVHLKIQF---SNGYLNLSPDAQYQKTDQGIHSGDTKIK 191
           V +RH+++++ M  F+    +D  L + +   SNG L  S D   +K D GI+S D  ++
Sbjct: 160 VSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVN-KKDDGGIYSKDGVVR 218

Query: 192 KICYTGFELENLITATSKPDVRS------------SFYSLVEXXXXXXXXXXXXAEMDCF 239
           KI Y+GF LE+L+T T+K D  +            + ++++E             EMD +
Sbjct: 219 KISYSGFALEDLLT-TNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSY 277

Query: 240 NSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECY 299
           N   + +TE+KC + LK+ +  HRRKLL+ WVQT ++P++++L+GIRDP + +L   E +
Sbjct: 278 NPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWF 337

Query: 300 TRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGS-KEEVNFRL 358
           +R  LYR+ NN+ L   + + NYNA I+VQW +H I+ +C+++   I+K       +F++
Sbjct: 338 SRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQI 397

Query: 359 TLRKNLTIKLRKMPETP 375
            +  +  I+++K+   P
Sbjct: 398 RINASRAIQIKKLKSVP 414

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  199 bits (505), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 187/355 (52%), Gaps = 7/355 (1%)

Query: 17  VHANCKNFQHAQINQFPKN-VLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCE 75
           V+ N K F H  I +  K   +  F E +EV T         + LDDK  +P L  ++CE
Sbjct: 23  VNVNMKKFPHGPITRRGKERSIRIFSESREVGTA--FRQGLVYDLDDKKNLPLLNDEICE 80

Query: 76  FTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADF 135
           +      +    Y+G DL    + + P+T ++L  + G+  F+ +W+  +  ++   + F
Sbjct: 81  YISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKF 140

Query: 136 TIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICY 195
           TIV  RH+++D++M+PF +E   L      G   ++     + T  GI+S  +  +KICY
Sbjct: 141 TIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPSQRPT--GINSPSSATRKICY 198

Query: 196 TGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGL 255
           TGFELE L+TATS  + R SFYS +E             EMD +N   + YTEIK S   
Sbjct: 199 TGFELERLLTATSGTE-RGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDF 257

Query: 256 KVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTV 315
            V++  H  KLL++W QT+L+PST++LVG RDP  H L +   Y+  Q+  K   +  T 
Sbjct: 258 NVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTR 317

Query: 316 MRKNY-NYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLR 369
              +Y N+N  ++  W  + I+++C+ +   ++  S    +F + + KNL +K+R
Sbjct: 318 SHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  199 bits (506), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/367 (30%), Positives = 196/367 (53%), Gaps = 16/367 (4%)

Query: 23  NFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTESGKL 82
           +F H  I+   +   P  D  Q+   +    +   +    K  +P L   + E  ES  L
Sbjct: 70  SFVHTSIHDLSRK--PPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESSLL 127

Query: 83  ANKGK---YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWK-QLHGRSFCDNADFTIV 138
             + +   Y+GHDL  + D++VP+T  +L+ ++   +++E WK   HG++F     FTIV
Sbjct: 128 EARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIV 187

Query: 139 CSRHNLIDLIMMPFSDEDVH---LKIQFSNGYLNLS--PDAQYQKTDQGIHSGDTKIKKI 193
            +RH+++DL M  F   +     +      G ++ S  P   +Q + +GI+S D  +KKI
Sbjct: 188 SARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKI 247

Query: 194 CYTGFELENLIT----ATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEI 249
           CY+GFE E+ +T    AT     +   +S+VE             E+D FN  +R+ TE+
Sbjct: 248 CYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTEL 307

Query: 250 KCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFN 309
           KC   L + ++ HR+KLL+ W+QT L+P++++++G+RD +  QL   + Y+R  LY+KFN
Sbjct: 308 KCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFN 367

Query: 310 NQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK-GSKEEVNFRLTLRKNLTIKL 368
           +  L   +K  N+NA ++V+W  H I+ +C++++  I    S    +F +++  N TI +
Sbjct: 368 HPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANGTIAI 427

Query: 369 RKMPETP 375
            K+   P
Sbjct: 428 TKLNTVP 434

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  198 bits (503), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 123/373 (32%), Positives = 206/373 (55%), Gaps = 28/373 (7%)

Query: 23  NFQHAQINQF----PKNVLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTE 78
           +F H  ++ F    P+++   F E +EVA  T   +   + +  K  +P L + + E  E
Sbjct: 70  SFLHTGMHNFLTKPPRDI---FHESKEVALFT---NGRAYTILRKDLIPNLKESIAELYE 123

Query: 79  SGKLANKGK---YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLH-GRSFCDNAD 134
           S  L  K +   Y+GHDL  + DE+VP+T  +L+ ++   +++E W   + G+ F     
Sbjct: 124 SSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKK 183

Query: 135 FTIVCSRHNLIDLIMMPFS--DEDVHLKIQFSNGYL-----NLSPDAQYQKTDQGIHSGD 187
           FT+V +RH+++DL M  F+  +    L + +    L     N+  D+Q  K  +GI+S D
Sbjct: 184 FTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSK--EGIYSND 241

Query: 188 TKIKKICYTGFELENLITATSK-PDVRSS---FYSLVEXXXXXXXXXXXXAEMDCFNSST 243
             +KKICY+GFE EN +T  SK  D+  S    +SLVE             EMD FN  +
Sbjct: 242 PNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVS 301

Query: 244 RSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQ 303
            + TE+KC + L + ++ HRRKLL+ WVQT L+P++++++G+RD +  QL   + Y+R  
Sbjct: 302 ETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDL 361

Query: 304 LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFI-EKGSKEEVNFRLTLRK 362
           L +KFN+  L   +K  NYNA I+V+W  + I+ +C++++  I +  S +  +F + +  
Sbjct: 362 LCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGIDT 421

Query: 363 NLTIKLRKMPETP 375
           N  I + K+  TP
Sbjct: 422 NNAIVITKLKTTP 434

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  196 bits (497), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 207/396 (52%), Gaps = 25/396 (6%)

Query: 2   LPNLQDLSLQDRTEEVHANCK-------NFQHAQINQFP-KNVLPFFDEVQEVATITHLL 53
           + +L ++SLQ     ++ + K       +F H+ +++FP K     F E +EVA  T   
Sbjct: 42  VSSLGNMSLQQSENHINGHPKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT--- 98

Query: 54  DTDEFLLDDKLGMPELVQDLCEFTESGKLANKGK---YIGHDLLDHFDEYVPITPKQLED 110
           +   +    K  +P L  D+ E  E   L  + +   Y+GHDL  +  ++VP+T  +L+ 
Sbjct: 99  NGQAYTTVRKDILPNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDS 158

Query: 111 MAGVQAFLERWK-QLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLN 169
           +    +++E W+   HG  F     FT+V +RH+++D+ M  F   +    +  +     
Sbjct: 159 ILPCISYIENWRLNNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAG 218

Query: 170 LSPDAQYQKTD-----QGIHSGDTKIKKICYTGFELENLITATSKP-DVRSS---FYSLV 220
           L   ++ QK D     +GI+S D  +KKICY+GFE EN +T   K  D+  S    +S+V
Sbjct: 219 LISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVV 278

Query: 221 EXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTN 280
           E             EMD FN  + + TE+KC + L + ++ HRRKLL+ W+QT L P+++
Sbjct: 279 ESKLSEEIGLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSD 338

Query: 281 LLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQ 340
           +++G+RD +  QL   + Y+R  L  KFN+  L   ++  NYNA ++V+W  H I+ +C+
Sbjct: 339 IMIGLRDSHSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICE 398

Query: 341 MIKPFIEKGS-KEEVNFRLTLRKNLTIKLRKMPETP 375
           ++   I   S K   +F +++  N TI + K+   P
Sbjct: 399 LLGANISDYSCKNPESFEISIDSNNTIAITKLKNIP 434

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  183 bits (465), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 168/322 (52%), Gaps = 8/322 (2%)

Query: 24  FQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTESGK 81
           F+H+ ++ FP +   FF+  +EVAT    +L   D      K   P L        E+  
Sbjct: 55  FEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDS---SKKPLYPCLQMFAALIAENRG 111

Query: 82  LANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSR 141
             NK  YIG DL    + Y P+   +L+       ++++W++       ++   TI+  R
Sbjct: 112 PKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPR 171

Query: 142 HNLIDLIMMPFSDEDVHLK-IQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICYTGFEL 200
           H+++DL+M  F D++V +       G L  S D   ++ + G++S ++  +KICY+GF L
Sbjct: 172 HHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERN-GLNSKNSMTRKICYSGFAL 230

Query: 201 ENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGLKVKST 260
           E+ +T TS  +    FYS+VE             EMD +N     YTE+KC + L V+ T
Sbjct: 231 EDKLT-TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDT 289

Query: 261 YHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNY 320
            HRRKLL+ WVQ  L+P ++L++G RD    QL     Y+R  LY+KFNN  +    K  
Sbjct: 290 AHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYL 349

Query: 321 NYNATISVQWFRHVIQQLCQMI 342
           N+NA I+V+W  H I+ +C ++
Sbjct: 350 NFNANIAVEWCFHCIESICDLV 371

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  180 bits (456), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 200/384 (52%), Gaps = 39/384 (10%)

Query: 24  FQHAQINQFPKNVLPFFDEVQEVATITH--LLDTDEFLLDDKLGMPELVQDLCEF---TE 78
           F H+ I+ FP    PF++   +VA   +  L    ++ +     +P L  D+ +    + 
Sbjct: 31  FSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSA 85

Query: 79  SGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIV 138
           S     K  Y+G DL D F+ +VP++ K L+ +    +F++ W++     +     F IV
Sbjct: 86  SEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIV 145

Query: 139 CSRHNLIDLIMMPFSD-----------EDVHLKIQFSN---GYLNLSPDAQY--QKTDQG 182
            +RH+++++ M  F+            +D  L + ++    G L  + D        ++G
Sbjct: 146 STRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEG 205

Query: 183 IHSGDTKIKKICYTGFELENLITATSKP---------DVRSSFYSLVEXXXXXXXXXXXX 233
           I+S +  +K+ICY+GF LE+L+T T+               + +++VE            
Sbjct: 206 IYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDICILLR 265

Query: 234 AEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQL 293
            E+D FN + + +TE+KC S LK+ +  HRRKLL+ WVQT ++P +++L+GIRD  + +L
Sbjct: 266 CELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGEL 325

Query: 294 TSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK---GS 350
              E Y+R +L  K NN+ L   + ++N+NA ++ QW +H I+ +C+++   +++    +
Sbjct: 326 EDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISN 385

Query: 351 KEEVNFRLTLRKNLTIK-LRKMPE 373
            +    R+  R+N+ IK L K+P+
Sbjct: 386 PQGFQIRIDSRRNIRIKCLSKVPK 409

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  172 bits (436), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 186/356 (52%), Gaps = 13/356 (3%)

Query: 24  FQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTESGK 81
           FQH+   +FP      F + +E +      L D+    + D +G+      L   +    
Sbjct: 21  FQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDS----ISDSIGLKSPGNKL---SHDRS 73

Query: 82  LANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSR 141
            +NK  ++G DL   +++++P++P+ L+   G   ++ +W+  +  S+   + F ++  R
Sbjct: 74  CSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVISPR 133

Query: 142 HNLIDLIMMPFSDEDVH-LKIQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICYTGFEL 200
           H L++L M  F       L     +G + LS     +K+ Q      T  KKI ++G+ L
Sbjct: 134 HYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGYAL 193

Query: 201 ENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGLKVKST 260
           E+L+T   + +    F++++E             E+D +N  T ++TE+KC + L + + 
Sbjct: 194 EDLLTRGPRVE-DDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNA 252

Query: 261 YHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNY 320
           YHR KLL+ W+Q ++ P  +LL+G+R+ +   L   + +T  +LYRK N++ L    K +
Sbjct: 253 YHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRF 312

Query: 321 NYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLRKMPETPA 376
           NYNA ++VQW +H I+ +C+++   +++ S +   F+LT+ ++  I+L K+   PA
Sbjct: 313 NYNADLAVQWCQHCIRSICKLVGENVDRSSPQ--CFKLTIDESHKIQLEKLKHVPA 366

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  172 bits (436), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/359 (30%), Positives = 180/359 (50%), Gaps = 19/359 (5%)

Query: 20  NCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTES 79
           +CK F H  +N           + +EV   +++++    L ++    P L  ++C + + 
Sbjct: 43  SCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKD 102

Query: 80  GKLANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFT 136
            K  NK     +IG DL   +D+YVP+    L  +  ++   +R+++       +    T
Sbjct: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKT-----LNPEKTT 157

Query: 137 IVCSRHNLIDLIMMPFSDEDVHL--KIQFSNGYLNLSPDAQYQKTDQGIHSGDTKI-KKI 193
            V  RH++ID+IM PF DE + L   +Q     L +S D    K + GIH       KKI
Sbjct: 158 FVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNIL-ISVDKSKDKPN-GIHETRNSFNKKI 215

Query: 194 CYTGFELENLITATSKPD---VRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIK 250
           CYTGF LE+L+  +           +YS+V             AEMD  N+ T +YTEIK
Sbjct: 216 CYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIK 275

Query: 251 CSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNN 310
            S   K+ +TYHRRKLLRMW+QT+L+P ++LL+G R+ Y ++L   + Y    +Y K NN
Sbjct: 276 SSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINN 335

Query: 311 QRLTVM-RKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKL 368
             +     K Y +N  ++  WF+H+ Q L Q +    ++ +     F++ +  NLT+ +
Sbjct: 336 SSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQEST--STTFKVQIDTNLTLSI 392

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  170 bits (431), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 163/286 (56%), Gaps = 6/286 (2%)

Query: 88  YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSRHNLIDL 147
           ++G  L ++ D+Y P+T K+L+       +L++++  HG+ + ++ DF IV +RH++IDL
Sbjct: 111 FLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDL 170

Query: 148 IMMPFSDE--DVHLKIQFSNG-YLNLSPDAQYQKTDQ-GIHSGDTKIKKICYTGFELENL 203
            ++PFS +  +V+L   ++ G  L +S D      D+ G+++ +  +KKIC++GF LE++
Sbjct: 171 AILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDI 230

Query: 204 ITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGLKVKSTYHR 263
           +T ++  + R+  + +VE             E+D +N  T  YTE+KC +     +  HR
Sbjct: 231 LTESANDEERNPTFLIVENEIANTRLLMR-CEIDAYNPITSHYTELKCYAKYNFGNPNHR 289

Query: 264 RKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYN 323
           RKLL+ W+QT ++P+T++++G+RD     L    CY R+ LY K  ++ L       NY+
Sbjct: 290 RKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYD 349

Query: 324 ATISVQWFRHVIQQLCQMIKPFIEKGSKEEVN-FRLTLRKNLTIKL 368
             ISV W+R +I  L   I   ++K  ++E   F + +  N  I++
Sbjct: 350 PAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  149 bits (376), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 179/373 (47%), Gaps = 20/373 (5%)

Query: 24  FQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLD-DKLGMPELVQDLCEFTESGKL 82
           F H+    FP+     F E + VA        D+  ++ +   +P L +D+   +    L
Sbjct: 46  FVHSNARSFPQKTKDLFLESKTVA----FFQKDQLFINVEDAALPLLKKDIANISGKSVL 101

Query: 83  ANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLH-GRSFCDNADFTIV 138
            +K     Y+G DL    D+Y P+    L+       F+  W+  H G  +  +AD+TI+
Sbjct: 102 NSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTIL 161

Query: 139 CSRHNLIDLIMMPFSDE---DVHLKIQF-SNGYLNLSPD---AQYQKTDQGIHSGDTKIK 191
             RH++ +++M  F DE    V+L   +  NG + LS D   +       G++S +   +
Sbjct: 162 SPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTR 221

Query: 192 KICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKC 251
           KICY+GF  E+L+      + R  F S+VE             E+D +N+ T  +TE+KC
Sbjct: 222 KICYSGFAFEDLVLEDIAENARPIF-SVVESKLTESINLLLRNELDGYNNVTNMFTELKC 280

Query: 252 SSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQ 311
            + LK    +  +++L+ WVQT L+P +++++GIRD     L     Y R  L R FNN 
Sbjct: 281 FAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338

Query: 312 RLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLRKM 371
            L     ++N+NA I+V+W +  ++ +  ++       S    +F+L +  + TI ++K+
Sbjct: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVS-SSIADSNHPCSFKLKIDNHKTISIQKL 397

Query: 372 PETPAPTKGTIFK 384
              P   +  I K
Sbjct: 398 SRIPQTVQRQIPK 410

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  143 bits (360), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 115/401 (28%), Positives = 195/401 (48%), Gaps = 54/401 (13%)

Query: 22  KNFQHAQI--NQFPKNVLPFFDEV----QEVATITHL----LDTDEFLLDDKLGMPELVQ 71
           K +Q   I  N F K     F ++    +EVAT  HL    ++TD  +   K G+P L  
Sbjct: 36  KKYQGGSIRFNSFVKPSKTHFSDLYRTSKEVATY-HLGNLNINTDPTIEHTK-GVPCLKD 93

Query: 72  DLCEFTESGKLANK---GKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHG-- 126
           D+C+      L +K    KYIG DL   +++Y  +  + L D      +++ + + H   
Sbjct: 94  DICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANE 153

Query: 127 -RSFCDNADFTIVCSRHNLIDLIMMPF---SDEDVHL--------KIQFSNGYLNLSPDA 174
            + +  + +F I+ SRH++ DL++ PF   SD +V +        +I  S  Y +  PD 
Sbjct: 154 KKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPD- 212

Query: 175 QYQKTDQGIHSGDTKIKKICYTGFELENLIT---ATSK------------PDVRSSFYSL 219
            +++  Q  +S    ++KI  +GF  E+L+     +SK            P + ++++S+
Sbjct: 213 -WRENKQFYNS----MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSV 267

Query: 220 VEXXXXXXXXXXXXAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPST 279
           VE            +EMD +N  T SYTE+KC + L + S +HR+KLL+ WVQ   +P++
Sbjct: 268 VENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNS 327

Query: 280 NLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLC 339
           +LLVG RD     L     ++R  L  K ++     +R + N   T +  W+ HV+  + 
Sbjct: 328 DLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAIT 387

Query: 340 QMIKPFIEKGSKE----EVNFRLTLRKNLTIKLRKMPETPA 376
            + + +++K  K      V FRL + KN TI L  + + PA
Sbjct: 388 SLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPA 428

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  142 bits (357), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 184/388 (47%), Gaps = 18/388 (4%)

Query: 1   MLPNLQDLSLQDRTEEVHANCKNFQHAQINQFPKNVLPFFDEVQEVATITH-LLDTDEFL 59
           +L +   LS+ D+        K F H    ++       F + +EVA  T   L  ++  
Sbjct: 13  LLNSFHRLSINDQKR---VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGN 69

Query: 60  LDDKLGMPELVQDLCEFTESGKLANKG----KYIGHDLLDHFDEYV-PITPKQLEDMAGV 114
             +   +P L +D+    +S      G    KY+G  L   F++YV  ++P  L+     
Sbjct: 70  TTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPC 129

Query: 115 QAFLERWKQLHG--RSFCDNADFTIVCSRHNLIDLIMMPFS-DEDVHLKIQFSNG-YLNL 170
             ++  W +     + F ++    IV  RH+L++L M  F+ D D  L      G ++ L
Sbjct: 130 LDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVL 189

Query: 171 SP--DAQYQKTDQGIHSGDTKIKKICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXX 228
           S   D   +  ++GI   D + + +CY+GF +   I + ++  + S F+           
Sbjct: 190 SQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICK-IWSLNRGIIPSQFF-YYGTPIRRGH 247

Query: 229 XXXXXAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDP 288
                 EMD +N     YTE+KC   L +KS+YH+ KLLR WVQT + P T++++G R+ 
Sbjct: 248 LATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNA 307

Query: 289 YYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFI-E 347
           Y   L      +R  LYRKFNN+       N+NYNA ++V+W ++ ++ + ++I+  + +
Sbjct: 308 YDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQ 367

Query: 348 KGSKEEVNFRLTLRKNLTIKLRKMPETP 375
           K   E   F +T+ +   I +RK+   P
Sbjct: 368 KSVLEPQAFVVTVYRGHDIGIRKLKGVP 395

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 168/369 (45%), Gaps = 22/369 (5%)

Query: 23  NFQHAQINQFPKNVLPFFDEVQEVAT-----ITHLLDTDEFLLDDKLGMPELVQDLCEFT 77
           ++ +A I +   N+   F E + VA      IT + + +  L+++    P L +D+   +
Sbjct: 69  SYSNAHIGKSQPNI---FQEAKGVALYYDKRITKITNNEAELINES-NPPFLTKDISNLS 124

Query: 78  ESGKLANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNAD 134
           E   L +K     Y+G++L D  +++ P+    L+       +L R  ++       N  
Sbjct: 125 EISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYL-RTLKISEEDKLYNTP 183

Query: 135 FTIVCSRHNLIDLIMMPFSDEDVHLK------IQFSNGYLNLSPD--AQYQKTDQGIHSG 186
           +T +  RH+L +L+M  +   +  L        +  +  + +S D   +   + Q     
Sbjct: 184 YTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQ 243

Query: 187 DTKIKKICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCFNSSTRSY 246
           ++  KK+  +GF  E L+    +   +  FY + E            +EMD +N+ T ++
Sbjct: 244 NSFSKKVINSGFTFEELVIENFQECHKPYFY-ISENRLTPKSTFIIRSEMDSYNNKTETF 302

Query: 247 TEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYR 306
           TE+KC + L +    HR+KLL+ W QT L P+ ++++GIRD     L     Y+R  +Y+
Sbjct: 303 TELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQ 362

Query: 307 KFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTI 366
           K  +  L   + ++++   I +QW  H I  +           +   + +++ + K+ +I
Sbjct: 363 KLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYKVIIDKHKSI 422

Query: 367 KLRKMPETP 375
            ++K+   P
Sbjct: 423 IIKKLSIVP 431

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 121/308 (39%), Gaps = 75/308 (24%)

Query: 106 KQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLK---IQ 162
           K L+  +G++ F +  KQ+  R           CS   L+  IM+    +D+  K   I 
Sbjct: 55  KYLDLSSGIKKFKDCSKQIEDR-----------CSLRGLLKTIMINEQRKDIPTKADIIT 103

Query: 163 FSNGYLNLSPDA----QYQKTDQGIHSGDTKI--KKI------------CYTGFELENLI 204
           F      L   A    +Y   D  I S D +I  K +            CYTG++ E+L 
Sbjct: 104 FRGVMRKLISAAFDTPEYNPVDLRIVSFDGQIFIKDVTKQETQDPIDLNCYTGYKFESLA 163

Query: 205 TAT------------SKPDVRSSF---YSLVEXXXXXXXXXXXXAEMDCF-------NSS 242
           T +             +P   SS    Y  V             AE+DC          +
Sbjct: 164 TLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSSKLVLGAEIDCIFDFKEENKDN 223

Query: 243 TRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYT 300
            R Y E+KCS+ +   +  HR  RKL + W+Q  LV    ++ G RD  Y  L S E   
Sbjct: 224 LRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDENY-TLKSVE--- 279

Query: 301 RSQLYRKFNNQRLTVMRKNYNYNATIS----VQWFRHVIQQLCQMIKPFIEKGSKEEVN- 355
                 +F+ + + ++ K +N     S    ++W+  + + L ++I     + S +E+  
Sbjct: 280 ------EFSTEEVPILLKEHNPKMNTSCIDAIKWYGLLTEWLLKLIP----RDSGDEIRP 329

Query: 356 FRLTLRKN 363
           +RL    N
Sbjct: 330 YRLVFENN 337

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 72/162 (44%), Gaps = 25/162 (15%)

Query: 234 AEMDC---FNSSTRS----YTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC   F  + R     Y E+KC+  +   S  H+  RKL R W+Q  LV    ++ G
Sbjct: 220 AEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYG 279

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATI----SVQWFRHVIQQLCQ 340
            +D +Y   T  E          F+ + + V+ KN N         +++W+  + + L +
Sbjct: 280 FKDDHYVLKTVEE----------FSTEEVPVLLKNNNPQVGSACLEAIKWYGLLTEWLLK 329

Query: 341 MIKPFIEKGSKEEVNFRLTLRKNLTIKLRKMPETPAPTKGTI 382
           MI P  E    +   F+L    N  ++L ++ E+     G I
Sbjct: 330 MI-PRDEDPHSQIRAFKLVFENN-HLRLSEIEESDEEYSGLI 369

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 23/122 (18%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLK--VKSTYHRRKLLRMWVQTSLVPSTNLLVG 284
           AE+DC          + + YTE+KC+ G+    ++    RK+ + W+Q  LV    ++ G
Sbjct: 214 AEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYG 273

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYN---YNATI-SVQWFRHVIQQLCQ 340
            RD  +  L S E         +F+ Q + ++ KN N    NA + +++W+    + L +
Sbjct: 274 FRDDNFI-LKSVE---------EFSTQEIPIILKNNNPQMTNACVDAIKWYGAFTEWLLK 323

Query: 341 MI 342
            I
Sbjct: 324 TI 325

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 25/162 (15%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC          + + Y E+KC+  +   S  H+  RKL R W+Q  LV    ++ G
Sbjct: 220 AEVDCVFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYG 279

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATIS----VQWFRHVIQQLCQ 340
            +D +Y   T  E          F+ + + V+ KN N     S    ++W+  + + L +
Sbjct: 280 FKDDHYVLKTVEE----------FSTEEVPVLLKNNNPQVGSSCLEAIKWYGLLTEWLLK 329

Query: 341 MIKPFIEKGSKEEVNFRLTLRKNLTIKLRKMPETPAPTKGTI 382
           M+ P  E        F+L    N  +KL ++ E      G +
Sbjct: 330 MV-PREEDPHARIRAFKLVFENN-HLKLSEIEENDDEYSGLV 369

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 23/122 (18%)

Query: 234 AEMDC---FNSSTRS----YTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC   F  + R     Y E+KC+  +   S  H+  RKL R W+Q  LV    ++ G
Sbjct: 220 AEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYG 279

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYN---YNATI-SVQWFRHVIQQLCQ 340
            +D +Y   T  E          F+ + + V+ KN N    +A + +++W+  + + L +
Sbjct: 280 FKDDHYVLKTVEE----------FSTEEVPVLLKNNNPQMGSACLEAIKWYGLLTEWLLK 329

Query: 341 MI 342
           MI
Sbjct: 330 MI 331

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 23/142 (16%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLK--VKSTYHRRKLLRMWVQTSLVPSTNLLVG 284
           AE+DC        + + + Y E+KC+ G+    ++    RK+ + W+Q  LV    ++ G
Sbjct: 214 AEVDCVFDFTEDSSDNLKHYAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIYG 273

Query: 285 IRDPYYHQLTSFECYTRSQ--LYRKFNNQRLTVMRKNYNYNATI-SVQWFRHVIQQLCQM 341
            RD  +  L S E Y+  +  L  K NN +LT        NA + +V+W+  + + L   
Sbjct: 274 FRDENF-ILRSVEEYSTQEVPLLLKNNNPQLT--------NACMDAVRWYGALTEWLLSS 324

Query: 342 IKPFIEKGSKEEVNFRLTLRKN 363
           I    E+ ++    +RLT   N
Sbjct: 325 IPR--EESAEHIRAYRLTFENN 344

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 21/121 (17%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLK--VKSTYHRRKLLRMWVQTSLVPSTNLLVG 284
           AE+DC        +++ + Y E+KC+ G+    ++    RKL + W+Q  LV    ++ G
Sbjct: 214 AEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYG 273

Query: 285 IRDPYYHQLTSFECYTRSQ--LYRKFNNQRLTVMRKNYNYNATI-SVQWFRHVIQQLCQM 341
            RD ++  L S E Y   +  L  K NN +LT        NA + +V+W+    + L   
Sbjct: 274 FRDEHF-ILRSVEEYGSHEIPLLLKNNNPQLT--------NACMDAVRWYGAFTEWLLSS 324

Query: 342 I 342
           I
Sbjct: 325 I 325

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 71/167 (42%), Gaps = 36/167 (21%)

Query: 187 DTKIKKICYTGFELENLITATSKPDVRSSFYSLVEXXXXXXXXXXXXAEMDCF------- 239
           D + KKIC  G E   ++    K  V S+   L              AE+DC        
Sbjct: 186 DKRSKKICNNGDEYVTVV----KTGVGSAKLVL-------------GAEIDCVFDFKEDG 228

Query: 240 NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFE 297
             + + Y E+KC++ +   +  H+  RK+ R W+Q  LV    ++ G RD  Y  L + E
Sbjct: 229 KDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIE 287

Query: 298 CYTRSQ--LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMI 342
            Y+  +  +  K NN ++  M          +++W+    + L ++I
Sbjct: 288 EYSTDEIPILLKNNNTKMNSM-------CLDAIKWYGLFTEWLLKII 327

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 25/162 (15%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC          + + Y E+KC+  +   S  H+  RKL R W+Q  LV    ++ G
Sbjct: 220 AEVDCVFDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYG 279

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATIS----VQWFRHVIQQLCQ 340
            +D  Y   T  E          F+ + + V+ KN N     S    ++W+  + + L +
Sbjct: 280 FKDDQYVLKTVEE----------FSTEEVPVLLKNNNPQMGSSCLEAIKWYGLLTEWLLK 329

Query: 341 MIKPFIEKGSKEEVNFRLTLRKNLTIKLRKMPETPAPTKGTI 382
           MI P  E    +   F+L    N  ++L ++ E      G +
Sbjct: 330 MI-PRDEDPHAQVRAFKLIFENN-HLRLSEIEENDDEYSGLV 369

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 19/120 (15%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC          + + Y E+KCS+ +   +   +  RK+ R W+Q  LV    ++ G
Sbjct: 212 AEVDCIFDFKEEGKDNLKHYAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYG 271

Query: 285 IRDPYYHQLTSFECYTRSQ--LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMI 342
            RD   + L + E YT ++  +  K NN  +       N +   +++W+  + + L +MI
Sbjct: 272 FRD-NNNVLKTVEEYTTTEVPVLLKSNNPAM-------NSSCLDAIKWYGTLTEWLLKMI 323

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 82/210 (39%), Gaps = 35/210 (16%)

Query: 114 VQAFLERWKQLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLNLSPD 173
           +   +E  K+ + +S  D   F  + S+  LI   M P +   V L+I   +G L +   
Sbjct: 83  LDTLMEYEKKKNKKSNVDIITFRGIMSK--LIRASMEPPNFNKVDLRIVSYDGQLFIKDV 140

Query: 174 AQY-----QKTDQGIHS----GDTKIKKICYTGFELENLITATSK-PDVRSSF------- 216
           + Y     +    G++S    G ++ +   YTG++ E + T     P V           
Sbjct: 141 SDYNAATNESNSSGVNSRQQAGTSRQQIDTYTGYKFEGIATLDKPLPYVEREVIEKRPRK 200

Query: 217 -------YSLVEXXXXXXXXXXXXAEMDCF-------NSSTRSYTEIKCSSGLKVKSTYH 262
                  Y  V             AE+DC          + + YTE+KCSS +   +   
Sbjct: 201 ILNNGDEYITVVRTGVGECKVVLGAEIDCIFDFKEEGKDNLKHYTELKCSSQISTTNDVR 260

Query: 263 R--RKLLRMWVQTSLVPSTNLLVGIRDPYY 290
           R  +K+ R W+Q  LV    ++ G RD  Y
Sbjct: 261 RFEKKMFRAWLQCFLVGVPRVIYGFRDDQY 290

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 19/120 (15%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC        + + + Y E+KC++ +   S  H+  RKL + W+Q  LV    ++ G
Sbjct: 216 AEVDCIFDFKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYG 275

Query: 285 IRDPYYHQLTSFECYTRSQ--LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMI 342
            RD  +  L + E +T S+  L  K NN ++  +          +++W+    + L   I
Sbjct: 276 FRDDNF-MLKTVEEFTTSEVPLILKNNNPQMQTV-------CVDAIKWYGAFTEWLLTSI 327

>Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa]
           {ON} YKL197C (PEX1) - member of the AAA-protein family
           [contig 43] FULL
          Length = 1018

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 17/119 (14%)

Query: 97  FDEYVPITPKQLEDMAGV--QAFLERWKQLHGRSFCDNADFTIVCSRHNLID-------- 146
           FDE+  I PK+  D  GV  +   +   Q+ G    D        SR +LID        
Sbjct: 777 FDEFDSIAPKRGHDSIGVTDRVVNQMLTQMDGAEGLDGVYVLAATSRPDLIDSALLRPGR 836

Query: 147 -----LIMMPFSDEDVH-LKIQFSNGYLNLSPDAQYQKTDQGIHS-GDTKIKKICYTGF 198
                L  +P  DE +  L+   ++G ++L P+ Q  +  +  H      ++ +CY  F
Sbjct: 837 LDKSILCGLPNEDERLEILQAVVASGGMHLEPNCQLDRIAEATHGMSGADLQGLCYNAF 895

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 244 RSYTEIKCSSGLKVKSTYH-----RRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFEC 298
           + Y E+KC+  L   S+Y       +KL + W+Q  L+    +  G RD  Y+ LTS E 
Sbjct: 230 KHYLELKCTRSL---SSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRDRSYN-LTSIEE 285

Query: 299 YTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQL 338
           Y    + + F N+ +     +       ++QW+  +I  L
Sbjct: 286 YLTEDVPKLFTNRGVKAQCMD-------AIQWYGEIIGWL 318

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 246 YTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQ 303
           Y E+KC++ +   +   +   KL + W+Q  L+  T +  G RD  Y  L + E +  S 
Sbjct: 229 YIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQY-LLKTIEEFATSD 287

Query: 304 LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMI 342
           +   F N   T+       N   +++W+    + L +MI
Sbjct: 288 IPLIFKNHNPTLAS-----NCVNAIKWYGVFTEWLMKMI 321

>Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar to
           Ashbya gossypii AFR263C AFR262C
          Length = 384

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 22/121 (18%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLK--VKSTYHRRKLLRMWVQTSLVPSTNLLVG 284
           AE+DC        + + + Y E+KCS  +     +     KL + WVQ  LV    ++ G
Sbjct: 214 AEVDCVFDFKEVGSDNLKHYAELKCSKAVNTVADARTFELKLFKTWVQCFLVGINRIIYG 273

Query: 285 IRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYN--YNATI-SVQWFRHVIQQLCQM 341
            RD          C  +S    +F+ Q + V+ KN     NA + +++W+    + L   
Sbjct: 274 FRDE--------NCILKS--VEEFSTQEIPVLLKNNPRLTNACLDAIKWYGAFTEWLLDT 323

Query: 342 I 342
           I
Sbjct: 324 I 324

>NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1.506
           YKL197C
          Length = 1056

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 59/146 (40%), Gaps = 28/146 (19%)

Query: 97  FDEYVPITPKQLEDMAGV--QAFLERWKQLHGRSFCDNADFTIVCSRHNLID-------- 146
           FDE+  I PK+  D +GV  +   +   Q+ G    D        SR +LID        
Sbjct: 798 FDEFDSIAPKRGHDSSGVTDRVVNQLLTQMDGAEGLDGVYVLAATSRPDLIDSALLRPGR 857

Query: 147 -----LIMMPFSDE--DVHLKI----QFSNGYLNLSPDAQYQ---KTDQGIHSGDTKIKK 192
                L  +P  DE  D+   I    + S   L L+P    Q   K  QG    D  ++ 
Sbjct: 858 LDKSILCNIPNEDERHDIICAITGHGRTSKSKLKLAPGVILQPIIKKTQGYSGAD--LQG 915

Query: 193 ICYTGF--ELENLITATSKPDVRSSF 216
           +CY  +   +  L+ + +K D  +SF
Sbjct: 916 LCYNAYLKAVHRLLASNTKEDNNASF 941

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 234 AEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNLLVG 284
           AE+DC          + + Y E+KCS+ +  ++   +  +K+ + W+Q  LV    ++ G
Sbjct: 212 AEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIYG 271

Query: 285 IRD 287
            RD
Sbjct: 272 FRD 274

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 51/101 (50%), Gaps = 12/101 (11%)

Query: 244 RSYTEIKCSSGLKV--KSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTR 301
           + Y E+K +  ++    +T   +KL  +W+Q  LV    +++G RD  +  L S E ++ 
Sbjct: 231 KHYVELKVAKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRDEKF-VLKSVEEFST 289

Query: 302 SQLYRKFNNQRLTVMRKNYNYNATI-SVQWFRHVIQQLCQM 341
           S++          +++     NA + +++W+  + + LC++
Sbjct: 290 SEI--------PLLLKSTGLRNACVDAIKWYGALTKWLCEL 322

>TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 10/64 (15%)

Query: 234 AEMDC---FNSSTRS-----YTEIKCSSGL--KVKSTYHRRKLLRMWVQTSLVPSTNLLV 283
           AE+DC   F  S+++     Y E+KC+  +    ++    +K+ R W+Q  LV    ++ 
Sbjct: 210 AEVDCIFDFKESSKTNNIYHYAELKCTQQICTAQQARGFDKKIFRTWLQCFLVGIPRIIY 269

Query: 284 GIRD 287
           G RD
Sbjct: 270 GFRD 273

>KNAG0D02970 Chr4 (535257..536417) [1161 bp, 386 aa] {ON} Anc_3.570
           YGL246C
          Length = 386

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 14/102 (13%)

Query: 246 YTEIKCSSGLK--VKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRS- 302
           Y E+KC+  ++    +     K+ R W+Q  LV    ++ G R+  Y  L + E YT + 
Sbjct: 236 YLELKCTMDIRNEADAAAFEGKMFRTWLQCFLVGVPRIIYGFRNRQY-LLQTVEEYTTAD 294

Query: 303 --QLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMI 342
             Q+    N Q  +  R         +++W+    + L Q+I
Sbjct: 295 IPQMVGSHNPQLHSAFRD--------AIRWYGRFTEWLLQVI 328

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 49/126 (38%), Gaps = 26/126 (20%)

Query: 187 DTKIKKICYTGFELENLITATSKPDVRSSF----------------YSLVEXXXXXXXXX 230
           D KI    Y+G++ ENL+T  SKP   +S                 Y  V          
Sbjct: 149 DGKIAPPVYSGYKFENLVTV-SKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVGNCKL 207

Query: 231 XXXAEMDCF-------NSSTRSYTEIKCSSGLKVKSTYHR--RKLLRMWVQTSLVPSTNL 281
              AE+D           + + Y E+K ++ +   S   +  +K+ + W+Q  LV    +
Sbjct: 208 MLGAEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRI 267

Query: 282 LVGIRD 287
           + G RD
Sbjct: 268 IYGFRD 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,003,544
Number of extensions: 1908159
Number of successful extensions: 4566
Number of sequences better than 10.0: 52
Number of HSP's gapped: 4639
Number of HSP's successfully gapped: 52
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)