Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214145.438ON1191196271e-85
KLTH0F15972g5.438ON1031034309e-56
CAGL0A02882g5.438ON1041044221e-54
NCAS0F034105.438ON1061044213e-54
KNAG0C048805.438ON1041034194e-54
SAKL0G02618g5.438ON1041034143e-53
TDEL0D026305.438ON1021034022e-51
Kpol_1016.35.438ON971033925e-50
Ecym_45095.438ON1031033692e-46
ZYRO0F10120g5.438ON1051023665e-46
KLLA0E02267g5.438ON1031033666e-46
NDAI0B057005.438ON1041033622e-45
ACL169W5.438ON1031033501e-43
Kpol_1016.3asingletonON971033361e-41
TPHA0C00950singletonON991052372e-26
KAFR0D02490singletonON107951903e-19
TBLA0C05870singletonON1001011833e-18
KAFR0D02400singletonON114901819e-18
KAFR0D02500singletonON112901792e-17
NDAI0D003207.499ON42847700.36
Kwal_26.91118.750ON31189661.4
KLTH0G06248g5.307ON122525661.4
SAKL0F15158g7.499ON40547651.8
ABR161C7.499ON40658642.4
NCAS0H003707.499ON42547642.5
NCAS0E002503.569ON708109615.5
Ecym_71907.499ON37058616.0
Kpol_1043.312.314ON28285616.0
KAFR0J028903.569ON706111607.8
NDAI0I032503.569ON709111608.0
ZYRO0B13750g4.305ON131356609.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21414
         (119 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   246   1e-85
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   170   9e-56
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   167   1e-54
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     166   3e-54
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   166   4e-54
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   164   3e-53
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   159   2e-51
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   155   5e-50
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   146   2e-46
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   145   5e-46
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   145   6e-46
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   144   2e-45
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   139   1e-43
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   134   1e-41
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 96   2e-26
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      78   3e-19
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    75   3e-18
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                74   9e-18
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      74   2e-17
NDAI0D00320 Chr4 (64823..66109) [1287 bp, 428 aa] {ON} Anc_7.499...    32   0.36 
Kwal_26.9111 s26 (1080235..1081170) [936 bp, 311 aa] {ON} YOR288...    30   1.4  
KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} simil...    30   1.4  
SAKL0F15158g Chr6 complement(1220221..1221438) [1218 bp, 405 aa]...    30   1.8  
ABR161C Chr2 complement(705050..706270) [1221 bp, 406 aa] {ON} S...    29   2.4  
NCAS0H00370 Chr8 (66024..67301) [1278 bp, 425 aa] {ON} Anc_7.499...    29   2.5  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569       28   5.5  
Ecym_7190 Chr7 complement(392964..394076) [1113 bp, 370 aa] {ON}...    28   6.0  
Kpol_1043.31 s1043 (66691..67539) [849 bp, 282 aa] {ON} (66691.....    28   6.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...    28   7.8  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...    28   8.0  
ZYRO0B13750g Chr2 (1112897..1116838) [3942 bp, 1313 aa] {ON} sim...    28   9.5  

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  246 bits (627), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MSRYLKPLKPSNLNKMVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQD 60
           MSRYLKPLKPSNLNKMVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQD
Sbjct: 1   MSRYLKPLKPSNLNKMVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQD 60

Query: 61  VSPEGKLSNFAGSHLQIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119
           VSPEGKLSNFAGSHLQIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA
Sbjct: 61  VSPEGKLSNFAGSHLQIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  170 bits (430), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 91/103 (88%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCVIV+DKKGSDRS  RPAHL+G+ +  E+G LVCAGAIY +V P+GK +NFAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           QI A+TKE+AL++VK D+FAKEGIWDLENIIIYPFGCAVRQ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  167 bits (422), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 85/104 (81%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCVIVYDK GSDRS  RP HL GIP LVE GKLVCAGAIY + +  G    FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119
           QIVADTKEEALE+V  DVFAK GIWDLENIIIY FGCAVRQPKA
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  166 bits (421), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 86/104 (82%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCVIVYDK GSDRS FRP HL  IP LVE+GKLVCAGAIY +   EG+   FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119
           QI+ADTKEEAL IV  D+FAKEGIWD +NIIIY FGCAVR+PK+
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  166 bits (419), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 86/103 (83%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWC +VYDK GSDRS FRP HL  IPKLV++GKLVCAGAIY + +  G    FAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           QIVADTKEEALE++ GDVFAKEGIWDL NII+Y FGCAVR+PK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  164 bits (414), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCV+VYDK  +DRS FRPAHL GIP LVE+GKLVCAGAI+ ++  EGK  NFAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
            IVAD+KEEAL +VK DVFAKEGIWDLENI+I+PFGCAVR+ K
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  159 bits (402), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 78/103 (75%), Positives = 86/103 (83%), Gaps = 2/103 (1%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEW VIVYDK   DRS FRPAHL GIP LVE+GKLVCAGAIY + +  G    FAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           QIVADTKEEALE+VKGD+FAKEG+WDL+NIIIY FGCAVR+ K
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  155 bits (392), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 84/103 (81%), Gaps = 6/103 (5%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCVI+ DKKGSDRS  RP HL GIP LVE+GKL CAGAIY D        +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYNDDG------SFAGSHL 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           QIVADTKE+ALE+VKGDVFA  GIWDL++IIIY FGCAVRQPK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  146 bits (369), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 88/103 (85%), Gaps = 1/103 (0%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCV VYDK GSDRS +R  HL+ IP+LV+EGK+V AGAIY+D+  +GK   FAGSHL
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLV-DGKPGGFAGSHL 59

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
            +VADT+EE +E++KGD++AKEG+WD++NI+I+PFGCAVR+ K
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  145 bits (366), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 81/102 (79%), Gaps = 2/102 (1%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEW VI +DK  +DRS +R  HL GIP  VE GKLVCAGAIY +    G+   FAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQP 117
           Q+VADTKEEA+EIVK D+FAKEG+WDL+N+I+Y FGCA+RQP
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  145 bits (366), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 84/103 (81%), Gaps = 1/103 (0%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEW VIVYDK GSDRS  RP HL GIP LVE GK+V AGAIY+DV  +GK +NFAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVV-DGKPANFAGSHL 59

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
            IVAD+K+E +E++K DVFAK  IWD++N +IYPFGCAVR+ K
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  144 bits (362), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (76%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWCVI+ DKKGSDRS F   H  GIP LVE+GK+VC GAIY + + EG     AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           Q+VADTKEE +E+VK D+FAKEGIWD++N IIY F  A+R PK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (80%), Gaps = 1/103 (0%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           MVEWC I+YDK G DRS+ R  HL  IPKLVE+GKLV AGAIY++V  +G+ S FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVV-DGRPSQFAGSQL 59

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
            +VAD++EEAL I++ D FAK G+WD+EN+++YPFGCAVR+ K
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  134 bits (336), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (74%), Gaps = 6/103 (5%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           M EWC+I+ DKKGS+RS     H  GI  LVE+G L C GAIY D   +G +   AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND---DGSV---AGSHL 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118
           QIVADTKE+ALE+VKGDVFA  GIWDL++I+IY F CAVRQPK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 95.9 bits (237), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 70/105 (66%), Gaps = 10/105 (9%)

Query: 16  MVEWCVIVYDKKGSD--RSLFRPAHLQGIPKLVEEGKLVCAGAIY-QDVSPEGKLSNFAG 72
           M E+ V++ D  G++  R    P H   IP LV+ G +VC GA++ ++ SP        G
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEEGSP-------VG 53

Query: 73  SHLQIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQP 117
           SH+QIVAD++E+ LE++K DVFA+E +WDLE+ IIY F CAVR+P
Sbjct: 54  SHIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKP 98

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON} 
          Length = 107

 Score = 77.8 bits (190), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 6/95 (6%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           M EW V V DK  +DR+ +   HL  +P L E+  LV AGA+  D   E       GS  
Sbjct: 1   MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALIGDNGKE------VGSSF 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPF 110
           Q+VA++KE+A+ ++K D+FAKEG+++L++ + Y F
Sbjct: 55  QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 75.1 bits (183), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           M EW V + D   SDR+     H+  +P L+  G L C GA+  D        N  GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNG------NMIGSHF 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQ 116
           ++  +TKEEA++++  D F K G+WD+ +I I  F C  R+
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHRE 95

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 74.3 bits (181), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 6/90 (6%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           M EW V V D K  DR+ + P H++ +P LV+ G +V AGA+    +PEGK     G   
Sbjct: 1   MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGAL---TTPEGKE---IGGMF 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENI 105
            + A TKEEA+EIVK DVFA++GI++++++
Sbjct: 55  IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON} 
          Length = 112

 Score = 73.6 bits (179), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 6/90 (6%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75
           M EW V + D +G+DR+ + P H+Q +  L +E  LV AGA+    +PEGK +   G  L
Sbjct: 1   MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL---TTPEGKET---GGIL 54

Query: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENI 105
            I A TKEEA+E+VK DVFA++GI+ ++ I
Sbjct: 55  IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>NDAI0D00320 Chr4 (64823..66109) [1287 bp, 428 aa] {ON} Anc_7.499
           YJR105W
          Length = 428

 Score = 31.6 bits (70), Expect = 0.36,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 9/47 (19%)

Query: 28  GSDRSL---------FRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEG 65
           G DRSL         F+P+HL+   + V+  KL   G  +  VSPE 
Sbjct: 216 GHDRSLVTDLGAANHFKPSHLEANWEFVQNAKLFYVGGFHLTVSPEA 262

>Kwal_26.9111 s26 (1080235..1081170) [936 bp, 311 aa] {ON} YOR288C
           (MPD1) - Disulfide isomerase related protein [contig 70]
           FULL
          Length = 311

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 30  DRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNF-AGSHLQIVADTKEEALEI 88
           D ++   A L G P+++E+        +++D   E K +   +   + +V D KE    +
Sbjct: 201 DFNILPNAKLGGSPEILEK-----LHPVFRDYLSELKRTQVESNESILVVFDLKEHEYHV 255

Query: 89  VKGDVFAKEGIWDLENIIIYPFGCAVRQP 117
            +GD F K  +W L    +  FG     P
Sbjct: 256 YEGDSFEKAAVWRL----LSKFGTPTEGP 280

>KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} similar
           to uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
           Protein with a role in maintenance of cellular integrity
           interacts with components of the TOR pathway ssd1 mutant
           of a clinical S. cerevisiae strain displays elevated
           virulence
          Length = 1225

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query: 31  RSLFRPAHLQG-IPKLVEEGKLVCA 54
           +SLF P   Q  IP+L+EEG+LVC 
Sbjct: 342 KSLFAPYLPQANIPELIEEGRLVCG 366

>SAKL0F15158g Chr6 complement(1220221..1221438) [1218 bp, 405 aa]
           {ON} similar to uniprot|P47143 Saccharomyces cerevisiae
           YJR105W ADO1 adenosine kinase
          Length = 405

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 9/47 (19%)

Query: 28  GSDRSL---------FRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEG 65
           G DRSL         F+PAHL      VE  +L   G  +  VSPE 
Sbjct: 193 GHDRSLVTDLGAANHFKPAHLDKHWSQVESAQLFYVGGFHLTVSPEA 239

>ABR161C Chr2 complement(705050..706270) [1221 bp, 406 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR105W
           (ADO1)
          Length = 406

 Score = 29.3 bits (64), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 11/58 (18%)

Query: 28  GSDRSL---------FRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHLQ 76
           G DRS+         F+P HL     +VE  K+   G  +  VSPE  +    G H Q
Sbjct: 197 GHDRSMVTDLGAANHFKPEHLDKHWNVVESAKMFYVGGFHLTVSPEAIVK--LGKHAQ 252

>NCAS0H00370 Chr8 (66024..67301) [1278 bp, 425 aa] {ON} Anc_7.499
           YJR105W
          Length = 425

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 9/47 (19%)

Query: 28  GSDRSL---------FRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEG 65
           G DRSL         F+P HL     +VE  KL   G  +  VSPE 
Sbjct: 213 GHDRSLVTDLGAANHFKPEHLDKHWSVVESAKLFYIGGFHLTVSPEA 259

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 48/109 (44%), Gaps = 23/109 (21%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQG------------------IP-KLVEEGKLVCAGA 56
           M++W  ++  +K +D SL    HL+G                  +P  LV+   L+    
Sbjct: 575 MMDWGNVIITQKNADGSLVGKLHLEGDFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDK 634

Query: 57  IYQDVSPEGKLSNFAGSHLQIVADTKEEALEIVKGDV--FAKEGIWDLE 103
           + +D S E  L+     H   +AD   + +++  GD+  F ++G + L+
Sbjct: 635 LEEDESFEDFLTPVTEFHTDAIADLNVKDMKV--GDIIQFERKGYYRLD 681

>Ecym_7190 Chr7 complement(392964..394076) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii ABR161C
          Length = 370

 Score = 28.1 bits (61), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 11/58 (18%)

Query: 28  GSDRSL---------FRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHLQ 76
           G DRSL         F+P HL    + VE  +L   G  +  VSPE  +    G H Q
Sbjct: 158 GHDRSLVTDLGAANHFKPEHLDAHWEHVENAELFYVGGFHLTVSPEAIIK--LGKHAQ 213

>Kpol_1043.31 s1043 (66691..67539) [849 bp, 282 aa] {ON}
           (66691..67539) [849 nt, 283 aa]
          Length = 282

 Score = 28.1 bits (61), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 21/85 (24%)

Query: 55  GAIYQDVSPEGKLSNFAGSHLQIVADTKEEALEIVKGDVFAKEGI------WDLE----- 103
           G  + DVS E  L+    + L I+ DT ++A+E +K D   ++ +      W L      
Sbjct: 4   GDEFIDVSVEQLLNTPIANGLVILIDTSDDAIEFLKDDFEFEQALRLLPMAWQLGVINKK 63

Query: 104 ----------NIIIYPFGCAVRQPK 118
                     N I+  FGCA+  P 
Sbjct: 64  NLKSKYISLCNRILQIFGCAILSPN 88

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 23/111 (20%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQG------------------IP-KLVEEGKLVCAGA 56
           +++W  I+  KK +D S+    HL+G                  +P  LV+   L+    
Sbjct: 573 LMDWGNIIITKKNADGSMEAKVHLEGDFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDK 632

Query: 57  IYQDVSPEGKLSNFAGSHLQIVADTKEEALEIVKGDV--FAKEGIWDLENI 105
           + +D S E  L+     H   +AD   + +++  GDV  F ++G + L+++
Sbjct: 633 LEEDESFEDFLTPETEFHTSAIADLNVKEMKV--GDVIQFERKGYFRLDSL 681

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 27.7 bits (60), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 23/111 (20%)

Query: 16  MVEWCVIVYDKKGSDRSLFRPAHLQG------------------IP-KLVEEGKLVCAGA 56
           M++W  ++  KK +D S+    HL G                  +P  LV+   L+    
Sbjct: 576 MMDWGNVIITKKNADGSMVGKLHLDGDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDK 635

Query: 57  IYQDVSPEGKLSNFAGSHLQIVADTKEEALEIVKGDV--FAKEGIWDLENI 105
           + +D S E  L+     H   +AD   + +++  GD+  F ++G + L+ +
Sbjct: 636 LEEDESFEDFLTPTTEFHTSAIADLNVKDMKV--GDIIQFERKGYYRLDAV 684

>ZYRO0B13750g Chr2 (1112897..1116838) [3942 bp, 1313 aa] {ON}
           similar to uniprot|Q06412 Saccharomyces cerevisiae
           YLR425W TUS1 Guanine nucleotide exchange factor (GEF)
           that functions to modulate Rhop1 activity as part of the
           cell integrity signaling pathway multicopy suppressor of
           tor2 mutation and ypk1 ypk2 double mutation potential
           Cdc28p substrate
          Length = 1313

 Score = 27.7 bits (60), Expect = 9.5,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 51  LVCAGAIYQDVSPEGKLSNFAGSHLQIVAD----TKEEALEIVKGDVFAKEGIWDL 102
           + C      DV PE KLS+F    + +  D    T EE  EI   +V  +  I+DL
Sbjct: 422 ITCVSRSIADVRPEIKLSDFINKSVGLWTDYWKLTPEEIAEINPREVQKQSFIFDL 477

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,813,664
Number of extensions: 484907
Number of successful extensions: 1093
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1081
Number of HSP's successfully gapped: 34
Length of query: 119
Length of database: 53,481,399
Length adjustment: 88
Effective length of query: 31
Effective length of database: 43,390,791
Effective search space: 1345114521
Effective search space used: 1345114521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)