Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214135.439ON58582983e-37
KLTH0F15950g5.439ON126583016e-37
SAKL0G02640g5.439ON126582861e-34
Kpol_1062.275.439ON126582801e-33
TDEL0D026205.439ON126582765e-33
Ecym_45105.439ON126582756e-33
NDAI0C015805.439ON126582756e-33
CAGL0I01078g5.439ON126582756e-33
ACL168C5.439ON126582731e-32
KNAG0B042205.439ON126582731e-32
KAFR0D050405.439ON126582695e-32
TPHA0E017405.439ON126582696e-32
TBLA0A065005.439ON119582661e-31
Skud_15.2845.439ON126582671e-31
Smik_15.2995.439ON126582662e-31
YOR122C (PFY1)5.439ON126582662e-31
Suva_8.1745.439ON126582652e-31
NCAS0H020705.439ON126582652e-31
KLLA0E02289g5.439ON126582634e-31
ZYRO0F10142g5.439ON126582522e-29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21413
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   119   3e-37
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   120   6e-37
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   114   1e-34
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   112   1e-33
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   110   5e-33
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   110   6e-33
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   110   6e-33
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   110   6e-33
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   109   1e-32
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   109   1e-32
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   108   5e-32
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   108   6e-32
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   107   1e-31
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   107   1e-31
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   107   2e-31
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   107   2e-31
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   106   2e-31
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   106   2e-31
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   105   4e-31
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   101   2e-29

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
          (PFY1) - profilin (actin-binding protein) [contig 130]
          FULL
          Length = 58

 Score =  119 bits (298), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
          MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY
Sbjct: 1  MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  120 bits (301), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           MLIRADDRSIYGRHDAEGV+CVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY
Sbjct: 69  MLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  114 bits (286), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (94%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           MLIRADDRSIYGRHDAEGVVCVRTKQTIL+ HYP GVQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADYLISVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (94%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           M++RADDRSIYGRHDAEGVVCVRTKQTILV HYPA VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADYLISVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  110 bits (276), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQTIL+ HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADYLISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  110 bits (275), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (94%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRH+AEG++ VRTKQTIL+ HYPAGVQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADYLISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  110 bits (275), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQT+LV HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADYLISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  110 bits (275), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQT+L+ HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADYLISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 55/58 (94%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RAD+RSIYGRH+AEGVV VRTKQTIL+ HYPAGVQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADYLISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           M +RADDRSIYGRHDAEGV+CVRTKQTILV HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADYLISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  108 bits (269), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQTI++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQTI++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEG+VCVRTKQTI++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 62  MLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADYLIGVQY 119

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  107 bits (267), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 54/58 (93%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGV+CVRTKQT++++HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADYLIGVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  107 bits (266), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQT+++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  107 bits (266), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGVVCVRTKQT+++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  106 bits (265), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIYGRHDAEGV+CVRTKQT+++ HYP  VQAGEATKIVEQLADYLI V Y
Sbjct: 69  MLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  106 bits (265), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADD+SIYGRHDAEG+VCVRT QTIL+ HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 69  MLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADYLISVKY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  105 bits (263), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           MLI+ADDRSIYGRH+AEG+V VRTKQTIL+ HYP GVQAGEATKIVEQL DYLISV Y
Sbjct: 69  MLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDYLISVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  101 bits (252), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%)

Query: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58
           ML+RADDRSIY RHDAEG+ CVRTKQTI++ HYP  VQAGEATKIVEQLADYLI   Y
Sbjct: 69  MLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADYLIGAQY 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,887,213
Number of extensions: 116686
Number of successful extensions: 213
Number of sequences better than 10.0: 20
Number of HSP's gapped: 213
Number of HSP's successfully gapped: 20
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)