Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214085.440ON43643618390.0
KLTH0F15928g5.440ON42342412951e-177
SAKL0G02662g5.440ON4794109501e-124
KLLA0E02311g5.440ON4174108491e-110
Ecym_45115.440ON4613978421e-108
KAFR0D050505.440ON4192107991e-102
NDAI0C015905.440ON4704138021e-102
TDEL0D026105.440ON4404247891e-100
ACL167C5.440ON4394447851e-100
Skud_15.2855.440ON4873597827e-99
Kpol_1062.265.440ON4573747668e-97
Suva_8.1755.440ON4533597623e-96
Smik_15.3005.440ON4633627599e-96
NCAS0H020805.440ON4352767525e-95
CAGL0K10230g5.440ON4462747501e-94
YOR123C (LEO1)5.440ON4643597442e-93
ZYRO0F10164g5.440ON4232787141e-89
KNAG0B042105.440ON4632097154e-89
TPHA0E017305.440ON4693766893e-85
TBLA0A064905.440ON4283776202e-75
AGR312W5.165ON61634722.5
TPHA0J027305.466ON56396687.1
Kwal_55.21296singletonOFF29264678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21408
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   712   0.0  
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   503   e-177
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   370   e-124
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   331   e-110
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   328   e-108
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   312   e-102
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   313   e-102
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   308   e-100
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   306   e-100
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   305   7e-99
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   299   8e-97
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   298   3e-96
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   296   9e-96
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   294   5e-95
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   293   1e-94
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   291   2e-93
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   279   1e-89
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   280   4e-89
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   270   3e-85
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   243   2e-75
AGR312W Chr7 (1313736..1315586) [1851 bp, 616 aa] {ON} Syntenic ...    32   2.5  
TPHA0J02730 Chr10 (603215..604906) [1692 bp, 563 aa] {ON} Anc_5....    31   7.1  
Kwal_55.21296 s55 (774344..775222) [879 bp, 292 aa] {OFF} [conti...    30   8.5  

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/436 (82%), Positives = 361/436 (82%)

Query: 1   MSQRDSEITRLGLMSDSERQAEVPRDSEEELRKETPAQDGAEGEDMDDLFGDESDNNIDQ 60
           MSQRDSEITRLGLMSDSERQAEVPRDSEEELRKETPAQDGAEGEDMDDLFGDESDNNIDQ
Sbjct: 1   MSQRDSEITRLGLMSDSERQAEVPRDSEEELRKETPAQDGAEGEDMDDLFGDESDNNIDQ 60

Query: 61  EDDGTQARXXXXXXXXXXXXQAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYS 120
           EDDGTQAR            QAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYS
Sbjct: 61  EDDGTQAREDGEGEEDEEDEQAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYS 120

Query: 121 TVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVR 180
           TVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVR
Sbjct: 121 TVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVR 180

Query: 181 WRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQS 240
           WRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQS
Sbjct: 181 WRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQS 240

Query: 241 VKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXX 300
           VKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDP           
Sbjct: 241 VKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQ 300

Query: 301 GXXXXXXXXXXXXXXXXXXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXX 360
           G                  GLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMV       
Sbjct: 301 GQIIRERRKRQLREQQEREGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVDDENNET 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDS 420
                                      AERLRQLKRSGASQYRSEGSEDDHVADEEPQDS
Sbjct: 361 GEDDEGEDDEDDLLDDNNEEEEDDDLNAERLRQLKRSGASQYRSEGSEDDHVADEEPQDS 420

Query: 421 TLKRRKVAVLDDEDDE 436
           TLKRRKVAVLDDEDDE
Sbjct: 421 TLKRRKVAVLDDEDDE 436

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  503 bits (1295), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 260/424 (61%), Positives = 295/424 (69%), Gaps = 2/424 (0%)

Query: 14  MSDSERQAEVPRDSEEELRKETPAQDGAEGEDMDDLFGDESDNNIDQEDDGTQARXXXXX 73
           MSD         +S+ EL ++      A+GE+MDDLFGD+SD          +       
Sbjct: 1   MSDQGEGTVALENSQNELSEKQSPNVEADGEEMDDLFGDDSDQETGSGPGEQEPHSPNSA 60

Query: 74  XXXXXXXQAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYA 133
                  QAMYNRKFYGD  EDSNDEGSQ EFREAD+D++KH+VPYST PS+GDKTI+Y 
Sbjct: 61  NEEEDDEQAMYNRKFYGDKGEDSNDEGSQ-EFREADIDIMKHIVPYSTEPSQGDKTIYYT 119

Query: 134 KVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFK 193
           KVPQFLTIDPIPFDPPAFQ+KIE+R AQ +S EDQIDDRLIEENTVRWRYSRD  Q+VFK
Sbjct: 120 KVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFK 179

Query: 194 ESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFI 253
           ESNA IVQWSDGT+SLRLGDE+TDVLINDTEDTYL VSHDQQELIQSVKGGEVTKNMIFI
Sbjct: 180 ESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFI 239

Query: 254 PTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXX 313
           PTSTNSKSHQRLSKAVARKEQ+EHHGPNTYILRVDP           G            
Sbjct: 240 PTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLR 299

Query: 314 XXXXXXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMV-XXXXXXXXXXXXXXXXXXX 372
                 G+DSPAP +KP+S S  GYSQ+RYDEYEDDGFMV                    
Sbjct: 300 EQQEREGMDSPAPTSKPRSASRPGYSQTRYDEYEDDGFMVDDEENESDGGVGGDGNEDEE 359

Query: 373 XXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDD 432
                          AERLRQLKR GA+QY ++ + D++V  ++ +DS +KRRKVAVLDD
Sbjct: 360 DLLDDEEEEDDDDLNAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDD 419

Query: 433 EDDE 436
           EDDE
Sbjct: 420 EDDE 423

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  370 bits (950), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 252/410 (61%), Gaps = 24/410 (5%)

Query: 39  DGAEGEDMDDLFGDESDNNIDQE-----------DDGTQARXXXXXXXXXXXXQAMYNRK 87
           +  E E+MDDLFGD+SDN  + E           +  +++             QAMYNRK
Sbjct: 79  NSGEDEEMDDLFGDDSDNAGEGELEGEEKEGKSPNHLSKSEANHGSYLEEDEEQAMYNRK 138

Query: 88  FYGDNAE-DSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFLTIDPIPF 146
           FYGD+ + DS+ E SQREF+EADV++ KH+VPY T  +  DK ++YAKVPQFLTIDP+PF
Sbjct: 139 FYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFLTIDPVPF 198

Query: 147 DPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWSDGT 206
           DPP+F+  +E R AQ SS EDQ+DDRLI+ENT+RWRYSRDSKQQVFKESNAQI+QWSDGT
Sbjct: 199 DPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGT 258

Query: 207 FSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLS 266
           FSLRLGDEF+DVLINDT++T+LTVSH+QQEL+Q V+GGE+TK M+FIPTST+SK HQRLS
Sbjct: 259 FSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLS 318

Query: 267 KAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGLDSPAP 326
           KAV R+EQREH GPNTYI+R DP                                DS  P
Sbjct: 319 KAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKENRDSVEP 378

Query: 327 AAKPKS-TSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 385
               KS TSS G    R +EYE+                                     
Sbjct: 379 LGVRKSATSSFGV--GRRNEYEE---DDFLVDDEEEEEEGGISGEEEEEAEEEDDDDEDD 433

Query: 386 XXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDD 435
             AERLRQLKR GA+QY  +  E              KRRK+AVLDDE++
Sbjct: 434 LNAERLRQLKREGAAQYEQKDEESGSEESSH------KRRKIAVLDDEEE 477

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 242/410 (59%), Gaps = 36/410 (8%)

Query: 46  MDDLFGDESD----------NNIDQEDDGTQARXXXXXXXXXXXXQAMYNRKFYGDNAED 95
           +DDLFGDES+             D +D                  QAMYNRKF G++ E 
Sbjct: 25  LDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLGEDYEG 84

Query: 96  SNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKI 155
            ++E  +++++E DV++VKHVVPY T     DKTI+YAKVPQFLTIDP+PFDPP+FQ K+
Sbjct: 85  QSEEEYEKKYKEVDVEIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKV 144

Query: 156 EQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEF 215
           E R ++ SS EDQ+ DRLIEENT+RWRYSRD  ++VFKESNAQIV+WSDGTFSL++GDE+
Sbjct: 145 EDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEY 204

Query: 216 TDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQR 275
           TD+L+N+TE+TYLTVSH++QELIQ V+GGE+TK+M+F+PTSTNSK H+ LSKAVAR+++R
Sbjct: 205 TDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDER 264

Query: 276 EHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGL-DSPAPAAKPKSTS 334
             HGPNTYI R DP                                 DSP P    +   
Sbjct: 265 GQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQLKEKLELENAGDSPEPQFNIQKNL 324

Query: 335 SLGYSQSRYDEYE-DDGFMVXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXXXX 386
           S    +   DEYE DDGF+                                         
Sbjct: 325 S---KRHNLDEYEYDDGFVAQDDEEEDDEEEEEDEDFSGEDNDVGDEEESDGGDSEKEYE 381

Query: 387 XAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436
            A+RLR++K++GA +Y+              +D+  K+RK+AVLDDEDDE
Sbjct: 382 NAKRLREVKQTGAQEYQ--------------EDAQAKKRKIAVLDDEDDE 417

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  328 bits (842), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/397 (45%), Positives = 237/397 (59%), Gaps = 20/397 (5%)

Query: 59  DQEDDGTQARXXXXXXXXXXXXQAMYNRKFYGDNAEDSNDEG---SQREFREADVDVVKH 115
           D+   GT  +            Q MYNRKFYGD+ + ++ E     +RE +EA+V ++KH
Sbjct: 65  DENSGGTSVKPTGLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKH 124

Query: 116 VVPY-STVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLI 174
           VVPY +T  SE D +++YAKVPQFLTIDPIPFDPP FQ++IEQR  + SS EDQ+ DRLI
Sbjct: 125 VVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLI 184

Query: 175 EENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQ 234
           +ENT+RWRYSR + QQVFKESNAQI+QWSDGTFSL+LGDEF+D+LIND E+TY+TVSH+Q
Sbjct: 185 DENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQ 244

Query: 235 QELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXX 294
           +EL+Q V+GGE+ K+M+FIPTSTNSK+HQRLS A+AR+E REH GP+TYI+R+DP     
Sbjct: 245 EELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPELEKK 304

Query: 295 XXXXXXGXXXXXXXXXXXXXXXXXXGLDSPA--------PAAKPKSTSSLGYSQSRYDEY 346
                                      +                +S  +  Y +   DEY
Sbjct: 305 ELEKKHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGKHHQDEY 364

Query: 347 ED-DGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYR-- 403
           +D DGF+                                   AERL+QLK  GA++Y+  
Sbjct: 365 DDEDGFIDDSEEEESGSYDEENAAGSLMDEESDGEDDEDDLNAERLKQLKIEGAARYQHG 424

Query: 404 ----SEGSEDDHVADEEPQD-STLKRRKVAVLDDEDD 435
               +  S+ D   D E  D S  KRRKVAVLD +D+
Sbjct: 425 STTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  312 bits (799), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 179/210 (85%), Gaps = 1/210 (0%)

Query: 81  QAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVP-SEGDKTIFYAKVPQFL 139
           +AMYNRKFYG+   D +D   +  F+EADV++V+HVVPY T P +E DKTI+Y KVP FL
Sbjct: 69  EAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPAFL 128

Query: 140 TIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQI 199
           +IDP+PFDPP+F+NK+++RT+  SS EDQ+ DRLI+ENT+RWRYSRD++Q+VFKESNAQI
Sbjct: 129 SIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNAQI 188

Query: 200 VQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNS 259
           VQWSDG++SL+LG E+TD+L+N T++T+LTVSHDQQEL+Q V GG++ K +IFIPTSTNS
Sbjct: 189 VQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTSTNS 248

Query: 260 KSHQRLSKAVARKEQREHHGPNTYILRVDP 289
           K HQRLSKA+AR++QR H GP T I+ +DP
Sbjct: 249 KIHQRLSKAIARRDQRVHSGPGTMIVNLDP 278

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  313 bits (802), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/413 (44%), Positives = 239/413 (57%), Gaps = 39/413 (9%)

Query: 46  MDDLFGDESDNNIDQ-------------EDDGTQARXXXXXXXXXXXXQAMYNRKFYGDN 92
           MDDLFGD+ D + +Q             EDD +  R            +AMY RKFYGD 
Sbjct: 75  MDDLFGDDEDEDKEQRGSDDEEEGFIVEEDDESAQRRPEDMDDE----EAMYTRKFYGDT 130

Query: 93  AEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQ 152
            + S++E    +F+EA+V++++H+VPY T   + D TI+YAKVP FLTIDPIPFDP +F+
Sbjct: 131 DKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQADTTIYYAKVPPFLTIDPIPFDPVSFE 190

Query: 153 NKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLG 212
            K++ R A  SS EDQ+ DRLI+ENT+RWRYSRD  Q+VFKESNAQIVQWSDG+FSL+LG
Sbjct: 191 TKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESNAQIVQWSDGSFSLKLG 250

Query: 213 DEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARK 272
           DE+TD+L+NDT++T+LTVSHDQQEL+Q   GGE+TK M+FIPTSTNSK HQ+LSKAV R+
Sbjct: 251 DEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIHQQLSKAVTRR 310

Query: 273 EQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGLDSP-----APA 327
            QR++ GP T I+  DP           G                    D+      + +
Sbjct: 311 NQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKEREIQESPDTTFDVRGSAS 370

Query: 328 AKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           +K +S +   Y  SR DEYE+                                       
Sbjct: 371 SKNRSPAPSSYRGSRQDEYEE---DDFLVDDDEEEEFVGDEDEEEEEEEEEEEEDEDDRK 427

Query: 388 AERLRQLKRSGASQYRSEGSEDDHVADEEPQD---STLKRRKVAVL-DDEDDE 436
           A+RL+++K+ GA +Y          AD E  D    + KRRKVAVL DDE+DE
Sbjct: 428 AKRLKEIKKGGAQEY----------ADREESDMEEGSSKRRKVAVLSDDEEDE 470

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  308 bits (789), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/424 (42%), Positives = 244/424 (57%), Gaps = 40/424 (9%)

Query: 38  QDGAEGEDMDDLFGDE---SDNNIDQEDDGTQA--------RXXXXXXXXXXXXQAMYNR 86
           +D    ++MDDLFGDE   SD   D+E+ G+          R             AMY R
Sbjct: 32  EDSGGDDEMDDLFGDEGQASDRGSDEEEGGSSNSDEEESSRRGEMQMDDEEAQEHAMYTR 91

Query: 87  KFYGDNAEDSND-EGSQREFREADVDVVKHVVPYSTVPSEGDK--TIFYAKVPQFLTIDP 143
           KFYG++A++ +D E S   F E +V++V+H+VPY TV    D+  TI+YAKVP+FLTIDP
Sbjct: 92  KFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDP 151

Query: 144 IPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWS 203
           +PFDPP+F++K+++R    SS EDQ+ DRLI+ENT+RWRYSRD  QQV+KESNAQIVQWS
Sbjct: 152 VPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWS 210

Query: 204 DGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQ 263
           DG  SL+LG E+TD+L+NDT++T+  VSHD+QEL+Q  +GGEVTK+++FIPTSTNSK HQ
Sbjct: 211 DGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQ 270

Query: 264 RLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX------ 317
           +L+KAV R++QR+  GP  Y +  DP                                  
Sbjct: 271 KLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIESRNSPDI 330

Query: 318 XXGLD----SPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXX 373
             GL+    +P  A+  + +    Y  S+ +EYE D F+V                    
Sbjct: 331 STGLNGYRKTPVTASDEQDSY---YGSSKRNEYEQDDFLV-DDDEEEEAGYSEEDDVLDD 386

Query: 374 XXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQ-DSTLKRRKVAVLDD 432
                         AERLRQLKR G  +Y           + EP+ D + KRRKVA++DD
Sbjct: 387 NNDDQEAEDEEDAKAERLRQLKRQGTERY----------TEPEPESDPSTKRRKVAIIDD 436

Query: 433 EDDE 436
           EDDE
Sbjct: 437 EDDE 440

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/444 (42%), Positives = 256/444 (57%), Gaps = 27/444 (6%)

Query: 14  MSDSERQA--EVPRDSEEELRKETPAQDGAEGEDMDDLFGDESD----------NNIDQE 61
           M++ +R A  E    SE++L     +  G    + +DLFG++SD          ++   E
Sbjct: 1   MAEEQRDALTESAELSEQKLEDGFTSDQGGSSANENDLFGEDSDVSGSDDADEADDGASE 60

Query: 62  DDGTQARXXXXXX--XXXXXXQAMYNRKFYGDN---AEDSNDEGSQREFREADVDVVKHV 116
           D G++                Q MYNRKFYGD+   A D +DE   RE +EAD+++VKHV
Sbjct: 61  DSGSRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHV 120

Query: 117 VPY-STVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIE 175
           VP     P EG + ++Y KVPQFLTIDP+PFDPP+FQ +IE+R A+ SS EDQ+ D LI+
Sbjct: 121 VPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLID 180

Query: 176 ENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQ 235
           ENT+RWRYSR S Q+VFKESNAQ+++WSDGT SL+LGDE+TD+L N+ E+TYLTVSH+QQ
Sbjct: 181 ENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQ 240

Query: 236 ELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXX 295
           E++Q V+GG ++ +M+FIPTSTNSK H+RL+KA+AR+E REH GP+TYI+R DP      
Sbjct: 241 EIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRE 300

Query: 296 XXXXXGXXXXXXXXXXXXXX----XXXXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGF 351
                                       GL   +   K  +  +  YS+S  DEY+D+  
Sbjct: 301 LQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEDEYDDEDG 360

Query: 352 MVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDH 411
            +                                  A RL+QLKR GA++Y +  +    
Sbjct: 361 FIDDDDDLEALSDNDDAADSLPGSPTASQDEEDDLNAARLQQLKREGAAKYAA--APPAP 418

Query: 412 VADEEPQDSTLKRRKVAVLDDEDD 435
            ADEE     LKRRKVAVLD +D+
Sbjct: 419 RADEE---VALKRRKVAVLDSDDE 439

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  305 bits (782), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 215/359 (59%), Gaps = 13/359 (3%)

Query: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137
           QAMY RKFYG++A D +D+  +   F+E ++++V+H++P     +E      IFYA++P 
Sbjct: 138 QAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYARIPN 197

Query: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197
           FLTID +PFDPP+F+ K+ +R    +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 198 FLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 257

Query: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257
           QIVQWSDG++SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 258 QIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 317

Query: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX 317
           NSK HQ+LSKAV R+ QR++ GP TYI+ +DP                            
Sbjct: 318 NSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRRQLKEREK 377

Query: 318 XXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXX 377
               D+       K +S   Y  SR +EYE+D F+V                        
Sbjct: 378 QESPDAAFETGFRKQSSPTSYGISRRNEYEEDDFLV--DDDEEEEAGFDDGDDEEEEEEE 435

Query: 378 XXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436
                     A RLR LKR GA+ Y+ E  +DD         +  KRR+VAV++D++DE
Sbjct: 436 EEEEEADQENAARLRNLKREGAAMYKEEEKDDDS--------NETKRRRVAVIEDDEDE 486

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  299 bits (766), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 165/374 (44%), Positives = 218/374 (58%), Gaps = 28/374 (7%)

Query: 81  QAMYNRKFYGDNAEDSND-EGSQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137
           QAMY RKFYG++  D +D E  + EFRE DV + +HVVP      E   D TI+YAKVP 
Sbjct: 93  QAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAKVPP 152

Query: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197
           FLTIDPIPFDPP F+N + +R     S E+Q++DRLI++NT+RWRYSRD  Q+VFKESNA
Sbjct: 153 FLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKESNA 212

Query: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257
            IVQWSDG++SL+LGDE+TD+L+NDT++T+LTVSHDQQEL+Q V GGE++K+++F+P ST
Sbjct: 213 TIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPIST 272

Query: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX 317
            SK HQRLSKA+ R+   E  GP + I+ +DP                            
Sbjct: 273 TSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRKKKQKEIEA 332

Query: 318 XXGLDSPA------PAAKPKSTSSLGYSQSRYDEYEDDGFMV---------XXXXXXXXX 362
              L++         A++ +ST+ + Y  SR DEYE+D F+V                  
Sbjct: 333 LESLETTGFGNNSYSASRKRSTTPMSYGGSRRDEYEEDDFIVDDEEEEPEYAGEEDDDDL 392

Query: 363 XXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTL 422
                                    AERLR+LKR G + Y    ++D+    E P     
Sbjct: 393 DGFEEEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAY----NDDEKSGSESP----- 443

Query: 423 KRRKVAVL-DDEDD 435
           KRRKVAV+ DDEDD
Sbjct: 444 KRRKVAVIEDDEDD 457

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  298 bits (762), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 213/359 (59%), Gaps = 17/359 (4%)

Query: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137
           QAMY RKFYG++A D +D+  +   F+E +V++V+H++P     +E      IFYA++P 
Sbjct: 108 QAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPN 167

Query: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197
           FLTIDPIPFDPP+F+ K+ +R     S EDQ+DDRLI+ENTVRWRYSRD+ Q VFKESN 
Sbjct: 168 FLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKESNT 227

Query: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257
           QIVQWSDG++SL++G+E+TD+L+NDT +T+LTVSHDQQEL+Q  +GGE+ K ++FIPTST
Sbjct: 228 QIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTST 287

Query: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX 317
           +SK HQ+LSKAV RK QR++ GP TYI+ +DP                            
Sbjct: 288 SSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEKEK 347

Query: 318 XXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXX 377
               D     A  K +S   Y  +R +EYE                              
Sbjct: 348 QESPDVGFETAFRKQSSPTAYGATRRNEYE------EDDFLVDDDEEEEAEFDDDDDNEE 401

Query: 378 XXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436
                     A RLR LKR GA+ Y+ EG +DD         +  KRR+VAV++D++DE
Sbjct: 402 EEEEEADEDNAARLRNLKREGAAMYKEEGGDDD--------SNESKRRRVAVIEDDEDE 452

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  296 bits (759), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 214/362 (59%), Gaps = 15/362 (4%)

Query: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137
           QAMY RKFYG++  D +D+  +   F+E +V++V+H++P   + +E      IFYA++P 
Sbjct: 110 QAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPN 169

Query: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197
           FLTIDP+PFDPP+F+ K+ +RT+  +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 170 FLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 229

Query: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257
           QIVQWSDGT+SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 230 QIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 289

Query: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX 317
           NSK HQ+LSKAV R+ QR++ GP TYI+ +DP                            
Sbjct: 290 NSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKEKEK 349

Query: 318 XXGLDSPAPAAKPKSTSSLGYSQSRYDEY---EDDGFMVXXXXXXXXXXXXXXXXXXXXX 374
               D+       K +S   Y  SR +EY   +                           
Sbjct: 350 QESPDAAFETGFRKQSSPTAYGTSRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEEEEEEE 409

Query: 375 XXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDED 434
                        A RLR LK+ GA+ YR E +ED++           KRR+VAV++D++
Sbjct: 410 EEEEEEEDADEANAARLRSLKKEGAAMYRQEENEDNN---------ETKRRRVAVIEDDE 460

Query: 435 DE 436
           +E
Sbjct: 461 EE 462

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  294 bits (752), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 200/276 (72%), Gaps = 16/276 (5%)

Query: 24  PRDSEEELRKETPAQDGAEGEDMDDLFGDES----DNNIDQ--EDDGTQARXXXXXXXXX 77
           P +  EE +KE  A++ A+G  MDDLFGDE     + ++D+  EDD   +R         
Sbjct: 26  PTEITEENKKEV-AEEEADG--MDDLFGDEEEEDENKSVDEQSEDDDIGSRPRRTDIDEE 82

Query: 78  XXXQAMYNRKFYGD---NAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKT-IFYA 133
              +AMY RKFYGD   N   S+ + +   F+E +V++++H+VPY T   + D+T ++YA
Sbjct: 83  ---EAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYA 139

Query: 134 KVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFK 193
           KVP FLTI+P+PFDP AF++ +  R +  SS EDQ+ DRLI+ENTVRWRYSRD+ Q+VFK
Sbjct: 140 KVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFK 199

Query: 194 ESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFI 253
           ESNAQIVQWSDG+FSL+LGDE+TD+L+N+T +T+L VSHDQQEL+Q   GGE+TK ++FI
Sbjct: 200 ESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFI 259

Query: 254 PTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDP 289
           PTSTNSK HQ+LSKAV R+ QREH GP T I+  DP
Sbjct: 260 PTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDP 295

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 8/50 (16%)

Query: 388 AERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVL-DDEDDE 436
           AERLR  KRSG         ED+  +  E + S+ K+R+VAV+ DDEDDE
Sbjct: 393 AERLRNAKRSGYD-------EDNQESGTENESSSSKKRRVAVINDDEDDE 435

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  293 bits (750), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 136/274 (49%), Positives = 189/274 (68%), Gaps = 1/274 (0%)

Query: 81  QAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDK-TIFYAKVPQFL 139
           Q MY RKFYG++A + +D+     F+E++VD+++H++PY T  +  +   IFYAKVP FL
Sbjct: 109 QEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFL 168

Query: 140 TIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQI 199
           TIDP+PFDP  F+  +++R ++ +S EDQ+ DRLI+ENT+RWRYSRD++Q VFKESNAQI
Sbjct: 169 TIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQI 228

Query: 200 VQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNS 259
           VQWSDG+FSL+LGDE+TD+++NDT++T+LTVSHDQQEL+Q   GGE+TK M+FIPTSTNS
Sbjct: 229 VQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNS 288

Query: 260 KSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXXXX 319
           K HQ+LSKAV+R+  R++ GP +YI++ DP           G                  
Sbjct: 289 KIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIETRE 348

Query: 320 GLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMV 353
             ++           +     SR +EYEDDGF+V
Sbjct: 349 NAENGFAETGEFKRGNTPSRSSRQNEYEDDGFLV 382

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  291 bits (744), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/359 (44%), Positives = 210/359 (58%), Gaps = 14/359 (3%)

Query: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137
           QAMY RKFYG++A + +D+  +   F+E +V++V+H++P     +E      IFYA++P 
Sbjct: 116 QAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPN 175

Query: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197
           FLTIDPIPFDPP+F+ K+ +R +  +S EDQ+DDRLI+ENTVRWRYSRD  Q VFKESN 
Sbjct: 176 FLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNT 235

Query: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257
           QIVQWSDGT+SL++G+E TD+L+NDT +T+LTVSHDQQELIQ  +GGE+ K ++FIPTST
Sbjct: 236 QIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTST 295

Query: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXXXXXX 317
           NSK HQ+LSKAV R+ QR+  GP TYI+ +DP                            
Sbjct: 296 NSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKEKEK 355

Query: 318 XXGLDSPAPAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXXXXXXXXXXXXXXXXXXX 377
               D+       K  S   Y  SR +EYE                              
Sbjct: 356 QESPDAAFETGFRKQNSPTTYGASRRNEYE----EDDFLVDDDEEEEAAFDDEEDDNEEE 411

Query: 378 XXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436
                     A RLR LKR GA+ YR E        +EE   S  KRR+VAV++D++DE
Sbjct: 412 EEEEDADEENASRLRNLKREGAAMYREE-------EEEEKDRSETKRRRVAVIEDDEDE 463

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  279 bits (714), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 196/278 (70%), Gaps = 15/278 (5%)

Query: 27  SEEELRKET---PAQDGAEG--EDMDDLFGDESDNNI---------DQEDDG-TQARXXX 71
           +E+EL  ET   P+ D   G  ++M+DLFG++   +          D+ D+G    R   
Sbjct: 20  AEKELSNETKQEPSGDEKSGSQDEMEDLFGEDEGEDEEDEKRKGSEDENDEGEVTLRHRQ 79

Query: 72  XXXXXXXXXQAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIF 131
                     AMY RKFYG++ +  +DE   +EFRE DV++V+H+VPY          ++
Sbjct: 80  EMDDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEFREEDVELVRHIVPYRATQGTDKPVLY 139

Query: 132 YAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQV 191
           YAK+P+FLTIDP+PFDPP+F+  +++R    +S EDQ+ DRLI+ENTVRWRYSRD+ QQV
Sbjct: 140 YAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQV 199

Query: 192 FKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMI 251
           FKESNAQIVQWSDGTFSL+LGDE+TD+L NDT++T+  VSHDQQEL+Q  +GGEVTK ++
Sbjct: 200 FKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLM 259

Query: 252 FIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDP 289
           FIPTST+S+ HQ+L+KAV R++ ++  GP TYI++ DP
Sbjct: 260 FIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 17/49 (34%)

Query: 388 AERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436
           AERLR+LKR GA+ Y                    KRR+VAV+DDE+DE
Sbjct: 392 AERLRRLKREGANNYEER-----------------KRRRVAVIDDEEDE 423

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  280 bits (715), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 166/209 (79%), Gaps = 2/209 (0%)

Query: 83  MYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQFLT 140
           MYNRKFYG++ + S+ E ++ EF+EA+V++VKH+VPY  VP +  G   I+ AKVP FL 
Sbjct: 102 MYNRKFYGEDVDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTNDIYVAKVPPFLM 161

Query: 141 IDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIV 200
           IDP PFDP +F+ K+  R     S ED++ DRLI+ENTVRWRYSRD+ Q VFKESN QIV
Sbjct: 162 IDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVFKESNTQIV 221

Query: 201 QWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSK 260
           QWSDG++SL+LG+E+TD+LINDT++T+LTVSHDQQEL+Q V+GG V K ++FIPTST+SK
Sbjct: 222 QWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFIPTSTSSK 281

Query: 261 SHQRLSKAVARKEQREHHGPNTYILRVDP 289
            HQ+LSKAVAR+   +  GP TYI+ VDP
Sbjct: 282 IHQKLSKAVARRNVMQSAGPGTYIVSVDP 310

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 212/376 (56%), Gaps = 38/376 (10%)

Query: 81  QAMYNRKFYGDNAEDSNDEG-SQREFREADVDVVKHVVPYSTVPSEGDKT---------I 130
            AMY RKFYGD   +  DE  +  EF+EADV++V+H+VPY  +  + D +          
Sbjct: 112 HAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNST 171

Query: 131 FYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQ 190
           +YA++P FLTIDP+PFDPP F++++++R    ++ +D+I DRLI+ENT+RWRYSRD+ Q 
Sbjct: 172 YYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQT 231

Query: 191 VFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNM 250
           VFKESNAQI+QWSDG++SL+LGD++TD+L+ND  +T+LTVSHDQQEL+Q V GGE++K+ 
Sbjct: 232 VFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSA 291

Query: 251 IFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXX-XXXXXX 309
           +F+P STNS+ HQRLSKA+AR++Q     P + I+ VDP                     
Sbjct: 292 MFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRRKR 351

Query: 310 XXXXXXXXXXGLDSP---------APAAKPKSTSSLGYSQSRYDEYEDDGFMVXXXXXXX 360
                      LDSP         + + K   T S    + R DEYE+D F+        
Sbjct: 352 KQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYDPRRERADEYEEDDFI--VDDEGE 409

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDDHVADEEPQDS 420
                                       ERL+  K           +++D   +E+    
Sbjct: 410 EDDDVEDDVEDEEDEDEEEEEEEEERNLERLKNSK-----------TQNDFEVEEDS--- 455

Query: 421 TLKRRKVAVLDDEDDE 436
             KRRKVAV+DDEDDE
Sbjct: 456 --KRRKVAVIDDEDDE 469

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  243 bits (620), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 141/377 (37%), Positives = 208/377 (55%), Gaps = 25/377 (6%)

Query: 81  QAMYNRKFYG-DNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGD----KTIFYAKV 135
           +AMY +KFYG D    S+D+ ++ E++E+D+++V+H+VPY T PS  +    + ++YAKV
Sbjct: 56  KAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHRELYYAKV 115

Query: 136 PQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQ--QVFK 193
           P FL +DP+PFD   F++ +++R     + + QI DRL +ENT+RWRYSRDS    +VFK
Sbjct: 116 PPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFK 175

Query: 194 ESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFI 253
           +SNAQI+QWSDG++SL+LG+++TD+L N+T++ +LTVSHDQQEL+Q   GGE+TK ++FI
Sbjct: 176 QSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFI 235

Query: 254 PTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPXXXXXXXXXXXGXXXXXXXXXXXX 313
           P+ST SK HQRL+ AV  ++++   GP   ++  DP                        
Sbjct: 236 PSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRRRKQLQ 295

Query: 314 XXXXXXGLDSPAPAAKPKSTSSLGYSQS------------RYDEYEDDGFMVXXXXXXXX 361
                  +D        +  S    SQS            R +EYE+D F+V        
Sbjct: 296 ERENNE-VDGITSGFSKRDNSPSINSQSIKGSRSDRNHDYRRNEYEEDDFIVDDEDEEVD 354

Query: 362 XXXXXXXXXXXXXXXXXXXXXXXXXXAERLRQLKRSGASQYRSEGSEDD--HVADEEPQD 419
                                     AERLR  KR G   Y+ +  E D  +  ++    
Sbjct: 355 GMVDDDDDNAEEEEEEEEEEDEDDLNAERLRNAKRQG---YQEDDDERDARNEEEQSSSS 411

Query: 420 STLKRRKVAVLDDEDDE 436
              KRRK+AV+DDEDDE
Sbjct: 412 EVTKRRKIAVIDDEDDE 428

>AGR312W Chr7 (1313736..1315586) [1851 bp, 616 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL019W (MPS3)
          Length = 616

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 149 PAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWR 182
           P + +K+E   AQL S   QI+ +L+ EN   W+
Sbjct: 221 PGYTSKLESNIAQLESEMQQINQKLLMENVTLWQ 254

>TPHA0J02730 Chr10 (603215..604906) [1692 bp, 563 aa] {ON} Anc_5.466
           YOR132W
          Length = 563

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 184 SRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKG 243
           + D   Q+FK  NA I +    +F   L   FT+  IN+ ED   TVS+ Q    + +K 
Sbjct: 139 TMDEFHQLFKYLNAAIQE----SFIPSLPSPFTNYCINNREDLEKTVSNFQNWFDRIIKD 194

Query: 244 GEVTKN---MIFIPTSTNSKSHQRLSKAVARKEQRE 276
             V KN   + FI    N+    R +  +A   +R+
Sbjct: 195 PLVIKNEEFVHFIECDCNTYIPIRKANLIASGLKRK 230

>Kwal_55.21296 s55 (774344..775222) [879 bp, 292 aa] {OFF} [contig
           130] FULL
          Length = 292

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 18/64 (28%)

Query: 176 ENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDT----YLTVS 231
           E  V W+ S DS+Q               GT+SL  GD+ T +L+ D  DT    + T++
Sbjct: 23  ERLVNWQVSLDSEQW--------------GTWSLFFGDDLTSLLVQDGVDTTDSLFWTLN 68

Query: 232 HDQQ 235
            DQ+
Sbjct: 69  LDQE 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,806,247
Number of extensions: 1782990
Number of successful extensions: 10758
Number of sequences better than 10.0: 154
Number of HSP's gapped: 10811
Number of HSP's successfully gapped: 180
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)