Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.214025.441ON51651627040.0
KLTH0F15906g5.441ON51551418090.0
SAKL0G02684g5.441ON53951911451e-151
ZYRO0F10186g5.441ON51951210461e-137
TDEL0D026005.441ON5235299941e-129
TBLA0A027905.441ON5475389931e-128
Kpol_1062.255.441ON5335189501e-122
TPHA0E017205.441ON5374649441e-121
NCAS0F034205.441ON5255329361e-120
CAGL0A02904g5.441ON5015199311e-120
NDAI0B057105.441ON5635649341e-119
Smik_4.6375.441ON5114609121e-117
Ecym_45125.441ON5275149121e-116
KLLA0E02333g5.441ON4805239011e-115
YDR371W (CTS2)5.441ON5114938951e-114
Suva_2.5435.441ON5114608851e-113
Skud_4.6405.441ON5114558801e-112
ACL166W5.441ON4905198491e-107
KNAG0C048705.441ON4584468101e-102
KAFR0E038105.441ON4904717775e-97
NDAI0E044307.357ON457106714.7
Kpol_467.212.470ON60493715.0
KAFR0D037301.116ON25487695.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21402
         (516 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...  1046   0.0  
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   701   0.0  
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   445   e-151
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   407   e-137
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   387   e-129
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   387   e-128
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   370   e-122
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   368   e-121
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   365   e-120
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   363   e-120
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   364   e-119
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   355   e-117
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   355   e-116
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   351   e-115
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   349   e-114
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   345   e-113
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   343   e-112
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   331   e-107
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   316   e-102
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   303   5e-97
NDAI0E04430 Chr5 complement(1000369..1001742) [1374 bp, 457 aa] ...    32   4.7  
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    32   5.0  
KAFR0D03730 Chr4 complement(721535..722299) [765 bp, 254 aa] {ON...    31   5.6  

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/516 (97%), Positives = 504/516 (97%)

Query: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60
           MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD
Sbjct: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60

Query: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120
           NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE
Sbjct: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120

Query: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180
           WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK
Sbjct: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180

Query: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240
           NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP
Sbjct: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240

Query: 241 KAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN 300
           KAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN
Sbjct: 241 KAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN 300

Query: 301 LMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM 360
           LMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM
Sbjct: 301 LMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM 360

Query: 361 PAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSA 420
           PAYGRGFKGVSVPHHSEHNVIGQSFQQV            YNQLPLKGGQEWFDQDAVSA
Sbjct: 361 PAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDAVSA 420

Query: 421 YSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFT 480
           YSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFT
Sbjct: 421 YSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFT 480

Query: 481 QEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASII 516
           QEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASII
Sbjct: 481 QEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/514 (65%), Positives = 396/514 (77%), Gaps = 3/514 (0%)

Query: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60
           M P L  ARKFLV  CV  IILE +YT +I  S +++AFQ  +N + RS  M ST  D  
Sbjct: 1   MAPILCFARKFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAG 60

Query: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120
             L   +E G  +G+YYSNWSPY ARKHFPHDIDFR+LT V+Y+FLVVN ETGECQLSDE
Sbjct: 61  TGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDE 120

Query: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180
           WSDVQMDLYKQM S+F+K+DL+ QFP  S++ LPLGCIGELF+LKY++FL++ GG   V 
Sbjct: 121 WSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVN 180

Query: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240
           NFKTIMSVGGWSNREAF SLV+SPAK++VF++SCV +MF+YGFDGIDIDWEFPKND+ EP
Sbjct: 181 NFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEP 240

Query: 241 KAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN 300
           K YL M+++LR++LD LES IFG++ H  HF LTSAISAD  CL+YLPL E DRYVD WN
Sbjct: 241 KVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWN 300

Query: 301 LMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGM 360
           LMAYDFSGAWS  TAYQSNLY+ +   KRS N   GSAD AVR L +K KL +KKIVLGM
Sbjct: 301 LMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGR-GSADKAVRFLTDKSKLASKKIVLGM 359

Query: 361 PAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSA 420
           PAYGRGFKGV V H S  NVIG+ FQ V            Y QLPLKGG E+FD +AVSA
Sbjct: 360 PAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSA 419

Query: 421 YSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFT 480
           Y VKL+ NK+ AEL+VYDNV SM  KA YV KN+LGGGFWWESCGE+Y    +SL  AFT
Sbjct: 420 YCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFT 477

Query: 481 QEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLAS 514
           +EIK LNKT PTIY+LP+V ++Y K +P GFLAS
Sbjct: 478 KEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLAS 511

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  445 bits (1145), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 238/519 (45%), Positives = 309/519 (59%), Gaps = 21/519 (4%)

Query: 9   RKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLY---NAIARSEKMQSTVKDKDNSLLI 65
           + FL+     ++ LE       +K    + F+ +Y   N+   ++ +Q  V    N    
Sbjct: 29  QTFLICLLTSLLFLEMSVFFGTLKGRATQKFKQIYSDMNSNDNNQNLQEEVGPASND--- 85

Query: 66  SSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQ 125
              +   SG+YY+NWSPY  R HFPHD++F R+T VFYSF VV+ ++G  + SDEWSD Q
Sbjct: 86  --SQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQ 143

Query: 126 MDLYKQMFSAFEKVDLKR----QFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKN 181
           MDLYK+ +  F+   L       F    +  LP+GCIGELFYLKY+  L  + G    +N
Sbjct: 144 MDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRN 203

Query: 182 FKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPK 241
           FK  MSVGGWSNR+AF  +V+   K   FI +CV+ MF+YGFDG+DIDWEFP+ND  EPK
Sbjct: 204 FKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPK 263

Query: 242 AYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNL 301
            YL M+R LR+ LDDLE DIF  E H++HF LT A+ A    L+ LPL ++D YVD WNL
Sbjct: 264 MYLTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNL 323

Query: 302 MAYDFSGAWSRHTAYQSNLYSRSS--LGKRSENSEGG--SADTAVRLLLNKHKLPAKKIV 357
           MAYD+ G WS  T Y SNLYS  S  + +R    E    +AD+AV+ LL    + ++K+V
Sbjct: 324 MAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVV 383

Query: 358 LGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDA 417
           LGM AYGRGF  V    +S  + IG+ +  V            YNQLPL G  E FD  +
Sbjct: 384 LGMAAYGRGFTRVKTTANSG-SYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRS 442

Query: 418 VSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTR 477
           VSAYS    S       V YDNV SM+ KAQYV  +NL GGFWWESCG+N+ D  +SL  
Sbjct: 443 VSAYSFDPKSKT----FVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLN 498

Query: 478 AFTQEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASII 516
           AFT ++  L K  P+IY    V  YY K YP GFL+ + 
Sbjct: 499 AFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVF 537

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  407 bits (1046), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/512 (41%), Positives = 304/512 (59%), Gaps = 21/512 (4%)

Query: 12  LVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSERGL 71
           ++ F +  I++E  +  KI KS          + +      Q     KD+  +I  E G 
Sbjct: 14  ILAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQF----KDHHTVIGDE-GY 68

Query: 72  TSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQ 131
           TSG+YYS+WSPY  RKHFPHDIDF +++ ++Y+F +++G TGE + SDEWSD QMDLYK 
Sbjct: 69  TSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKP 128

Query: 132 MFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGW 191
           +     ++ LK     +S   LP GC+GELFYL++T  L +  G    ++FK +M+VGGW
Sbjct: 129 LAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKG----RHFKVMMAVGGW 184

Query: 192 SNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLR 251
           SNR+ +  +V+ P +++ FINSCV+ MFKYGFDGID+DWEFP+ND  EP+ YL++ R +R
Sbjct: 185 SNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMR 244

Query: 252 KKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWS 311
            K D+LE  IF  E +   F L+ A  A    L  LP+ E+DRY+D WN+M YD+ G WS
Sbjct: 245 LKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWS 304

Query: 312 RHTAYQSNLYS------RSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGR 365
             T Y  NLY              S + EG  A++A+  ++N+  + ++KI LGM AYGR
Sbjct: 305 PVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGR 364

Query: 366 GFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSAYSVKL 425
           GF  V     ++   I +SF  V            YNQLP+KG +E +D + VS +    
Sbjct: 365 GFTHVKAS-SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCF-- 421

Query: 426 ASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKY 485
             + +    V YDNV+S+K+KA YV +  L GGFWWESCG+N++D  RSL  AFT  IK 
Sbjct: 422 --DHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKT 479

Query: 486 LNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516
           + K   ++Y  P+   YY +K+  D FL+  I
Sbjct: 480 IAKNENSVYHKPEALRYYLEKFGQDEFLSPFI 511

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  387 bits (994), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/529 (39%), Positives = 307/529 (58%), Gaps = 42/529 (7%)

Query: 9   RKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISS- 67
           R +L    ++I+IL  +       ++ +  ++ +++  A+ + +         + L+++ 
Sbjct: 4   RPWLSHTVIIIVILASI-------AVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNP 56

Query: 68  ---ERG-LTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSD 123
              E G   SG+YYSNWSPY  R HFPHDID  R++ ++Y+F +V+G TG  +L DEWSD
Sbjct: 57  GTVEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSD 116

Query: 124 VQMDLYKQMFSAFEKV------DLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPE 177
           V MDLYK M     K+      DL+RQ     R  LP GC+GELFY++  +         
Sbjct: 117 VGMDLYKPMAIKLNKLNPEVKNDLERQ-----RRILPNGCLGELFYMRNANLFPN----R 167

Query: 178 DVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDS 237
           ++++FK IM VGGWSNRE F  +V++P ++  FI+SC++ MFKYGFDGID+DWEFP++D 
Sbjct: 168 NIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDG 227

Query: 238 TEPKAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVD 297
            EP+ YL + + L++++++LE  IFG   +   F L+ A  A    L+ LP+ E+D+Y+D
Sbjct: 228 FEPQMYLQLAKRLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYID 287

Query: 298 QWNLMAYDFSGAWSRHTAYQSNLYSRSSLG---------KRSENSEGGSADTAVRLLLNK 348
            WN+M YD+ G WS  T Y  NLY+ S+             +E+ EG  A +A+  +LN 
Sbjct: 288 IWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNV 347

Query: 349 HKLPAKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKG 408
             + + KI LGM AYGRGF  V V   ++   I + F  V            YNQLP++G
Sbjct: 348 AGVNSHKICLGMAAYGRGFTNV-VAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQG 406

Query: 409 GQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENY 468
             E FD D VS +     S       V YD+V+S++ KAQYV + NL GGFWWESCG+++
Sbjct: 407 THELFDPDYVSGFCYSSTSKT----FVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDH 462

Query: 469 LDNSRSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKYP-DGFLASII 516
            + SRSL  AFT EIK+++K    +Y    V  YY  K+  D FL+  I
Sbjct: 463 ANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFI 511

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  387 bits (993), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/538 (38%), Positives = 317/538 (58%), Gaps = 44/538 (8%)

Query: 11  FLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQ------STVKD-KDNSL 63
            ++ F  + +I E  + +K+      K  Q + N +    K++      + +KD K+ +L
Sbjct: 13  IILTFIAITLITEMCFYDKLFNK---KKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNL 69

Query: 64  LISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSD 123
            +++ +G TSG+YYSNWSPY  RKHFPHDIDF R++ V+YSF +VNG+ G+ +L D+WSD
Sbjct: 70  TVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSD 129

Query: 124 VQMDLYKQMFSAF----EKVDLKRQFPQSS---RNDLPLGCIGELFYLKYTDFLSKMGGP 176
           ++MDLYK +         KVD+  + PQ+    + +LP GCIGE FYL+ +  L  +   
Sbjct: 130 IEMDLYKPLSIKLGKLKNKVDVYEE-PQTQSTIKTNLPKGCIGEFFYLRNSKLLPTIN-T 187

Query: 177 EDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKND 236
           E+ KNFK IM++GGWSNR++F  + +SP K+  F+ S ++ MF+YGFDGID+DWEFPKN+
Sbjct: 188 ENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNN 247

Query: 237 STEPKAYLDMMRSLRKKLDDLESDIFGTE----KHTQHFLLTSAISADPSCLEYLPLGEI 292
           + EP  YL +M+ LR+ +++LE +I+       +  +HF L+ A  A    L  LP+ E+
Sbjct: 248 TQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEM 307

Query: 293 DRYVDQWNLMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLP 352
           ++ +D WN+M YD++G WS  T Y SNLY  S   K   + E  +AD+A++ ++    + 
Sbjct: 308 NKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGS---KVKHDEEVLNADSAIKYMIETQGVE 364

Query: 353 AKKIVLGMPAYGRGFKGVSVPH-------HSEHNVIGQ------SFQQVXXXXXXXXXXX 399
             K+VLG+  YGRG+  V+V H       + E  + G        ++ V           
Sbjct: 365 PNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMW 424

Query: 400 XYNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGF 459
            YNQLP+KG  E FD   VSAY   L +N     LV YDNV+SM +K QYV    L GGF
Sbjct: 425 MYNQLPIKGSIEQFDPKFVSAYCYDLKTNT----LVTYDNVESMNVKGQYVKDKGLAGGF 480

Query: 460 WWESCGENYLDNSRSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516
            WESCG+ + +  RSL  AFT E+  + K   +I+   +  E+Y +++  +G+L+  I
Sbjct: 481 MWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAI 538

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  370 bits (950), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/518 (39%), Positives = 293/518 (56%), Gaps = 42/518 (8%)

Query: 30  IVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLI--------SSERGLTSGIYYSNWS 81
           ++ SI +++F  LY    +    + +++D  N   I        + + G   G+YYSNWS
Sbjct: 17  VIISIMVESF--LYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVYYSNWS 74

Query: 82  PYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEKVDL 141
           PY  R H PHD+DF RLT V+Y+F VV+ +TG    SD WSD +MD YK +    +K+ L
Sbjct: 75  PYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQL 134

Query: 142 KRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLV 201
              F    +N LP+GCIGELFYL++    S++    + + FK IMSVGGWSNREAF  ++
Sbjct: 135 DHFFNPKFKNGLPMGCIGELFYLRH----SQLFDSNNSRKFKLIMSVGGWSNREAFPRMI 190

Query: 202 QSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDI 261
           +   K+  F+NSC++ MF YGFDGI++DWEFPK+D  EPK YL++++ L+ K ++LE  I
Sbjct: 191 RDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKI 250

Query: 262 FGTEKHTQH-----FLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAY 316
           F    +  H     F L+ A  A    L+ L + E+D YVD WN+M YD+ G WS  T Y
Sbjct: 251 FNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGY 310

Query: 317 QSNLYSRSSLGKRSENSEGG-----------------SADTAVRLLLNKHKLPAKKIVLG 359
            SNLYS        ++ +                   + D A+  ++ K+ +  KKI LG
Sbjct: 311 HSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLG 370

Query: 360 MPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVS 419
           M AYGRGF  V+     +   I + ++ V            YNQLP+K   E FD D VS
Sbjct: 371 MAAYGRGFTKVNASSQ-DTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVS 429

Query: 420 AYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAF 479
           A+      +K+    V YDN  SMK+KAQYV ++NL GGFWWESCG+++ +  +SL  AF
Sbjct: 430 AFCY----DKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAF 485

Query: 480 TQEIKYLNKTVPTIYALPQVGEYYHKKYPD-GFLASII 516
           T EI  + +   T++   +V +YY K   D GFL++ I
Sbjct: 486 TDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/464 (44%), Positives = 290/464 (62%), Gaps = 23/464 (4%)

Query: 67  SERGLTS-GIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQ 125
           +E  L S G+YYSNWSPY  R  FPHDID  R++ V+YSFL+V+G+ G  + SD WSD Q
Sbjct: 73  TENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQ 132

Query: 126 MDLYKQMFSAFEKVDLK-RQFPQSSRNDL-PLGCIGELFYLKYTDFLSKMGGPEDVKNFK 183
           +D+YK ++ +  +VD      P S + +L P+GCIGE FYL+ T     + GP+   +FK
Sbjct: 133 IDMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRI--PIHGPKST-DFK 189

Query: 184 TIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAY 243
             MSVGGWSNREAF  +V+ P K+  FINSC+D MF YGFDGID+DWEFP++D  EP  Y
Sbjct: 190 VFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMY 249

Query: 244 LDMMRSLRKKLDDLESDIF--GTEKHTQ--HFLLTSAISADPSCLEYLPLGEIDRYVDQW 299
           LD+++ L+ K+ +LE+ I+      +T   HF L+ A  A    L  LP+ ++D++VD+W
Sbjct: 250 LDIIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKW 309

Query: 300 NLMAYDFSGAWSRHTAYQSNLYS----RSSLGKRSE--NSEGGSADTAVRLLLNKHKLPA 353
           N+M YD+SG WS  T Y SNL+S      S+ KRS+  ++E    D AV+ + +  K+ +
Sbjct: 310 NMMTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISS 369

Query: 354 KKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWF 413
           +KI+LGM AYGRGF GVS    +   + G+ F  V            YN+LP+KG +E F
Sbjct: 370 RKIILGMAAYGRGFSGVS-KSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEF 428

Query: 414 DQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSR 473
           D+++VSAY     S       V YDN QSM IK++YV  NNLGGGF WE+CGE   +   
Sbjct: 429 DKESVSAYCYDPKSKI----FVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKL 484

Query: 474 SLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516
           SL  +FT ++  ++K   ++++  +V EYY  KY   GFL+  I
Sbjct: 485 SLINSFTFDMNNIDKQ-KSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  365 bits (936), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/532 (40%), Positives = 308/532 (57%), Gaps = 40/532 (7%)

Query: 9   RKFL----VLFCVVIIILE-GVYTNKIVKSIRIKAFQGLYNAIARSEKMQST-----VKD 58
           RKF     VLF + I++L   +  +K+    + KA Q L  +  R+  + +      + +
Sbjct: 7   RKFFLNTGVLFALAIVVLVLQMCLHKLY--FKQKATQDLIQSHFRNGTIPNRQEIDYLMN 64

Query: 59  KDNSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLS 118
           + NS   + E+G  SG+YYS+WSPYK R HFPHDID  R++ ++Y+F +V+ +TG+   S
Sbjct: 65  QTNS---NGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPS 121

Query: 119 DEWSDVQMDLYKQMFSAFEKVDL---KRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGG 175
           DEWSD+QMDLYK +      ++L   ++      +  LPLGCIGELFYLK++  +   GG
Sbjct: 122 DEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GG 179

Query: 176 PEDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKN 235
                  K I+S+GGWSNR+ F  LV+   K + FI+S V+ MF+YGFDGID+DWEFPK+
Sbjct: 180 SST----KMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKD 235

Query: 236 DSTEPKAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRY 295
           D  EP  YL+M+  LR+K+DDLE +IFG  K    F L+ A  A    L  LP+ ++D+Y
Sbjct: 236 DGLEPNKYLEMISKLRRKMDDLELEIFGETKDHPKFQLSVATPAFIYKLSILPIIQMDQY 295

Query: 296 VDQWNLMAYDFSGAWSRHTAYQSNLY----SRSSLGKRSENS---EGGSADTAVRLLLNK 348
           VD WN+M YD+ G+WS  T Y  NL+    S    G + E++    G +A+ A+  ++  
Sbjct: 296 VDYWNMMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKS 355

Query: 349 HKLPAKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXX-XYNQLPLK 407
             +P+ K+VLGM AYGR FK V         +I Q F+ V             YNQLPLK
Sbjct: 356 CNVPSSKVVLGMAAYGREFKHVK-SRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLK 414

Query: 408 GGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGEN 467
           G  E +D +    Y      +K+    + YDNV S+K+KAQYV    LGGGFWWESCG++
Sbjct: 415 GTVEMYDPN----YGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDD 470

Query: 468 YLDNSRSLTRAFTQEIKYLNK--TVPTIYALPQVGEYYHKKY-PDGFLASII 516
           +++  RSL   F+ E+  + K      I+   +   YY  +Y  DGFL+ I+
Sbjct: 471 HINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  363 bits (931), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/519 (40%), Positives = 294/519 (56%), Gaps = 41/519 (7%)

Query: 9   RKFLVLFCVVIIILEGVYTNKIVK-SIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISS 67
           RK L  F V++I      T+ I++ S+  K FQ L     RS+     + + D    + S
Sbjct: 6   RKRLGTFIVILI------TSLILQMSLHYKIFQKLKR---RSQSDDYRMPESD----VLS 52

Query: 68  ERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMD 127
                +G+YYSNWSPY+ R HFPHDIDF +++ ++Y+FL+++ ETG    SDEWSD Q++
Sbjct: 53  NTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLN 112

Query: 128 LYKQ----MFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFK 183
           L KQ    MF  F   +LK      +    P GCIGEL YL+Y    SK+      +N K
Sbjct: 113 LAKQCREYMFKRFTGDELK----AVTNIRAPPGCIGELNYLRY--IYSKIKK----RNVK 162

Query: 184 TIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAY 243
            IMSVGGWSNRE+F  +V+   K K FINSC++ M  YGFDGID+DWEFP++DS EP AY
Sbjct: 163 LIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAY 222

Query: 244 LDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMA 303
           L M R L+ +L  LE++I G +   + F L+ A  A    L  LP+ ++D+Y+D WNLM 
Sbjct: 223 LRMARELKLQLQKLEANILG-DHSNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMT 281

Query: 304 YDFSGAWSRHTAYQSNLYSRSSLGK-----RSENSEGGSADTAVRLLLNKHKLPAKKIVL 358
           YD+ G WS  T   +NLY+    GK     R +   G S D A+  ++N+ K+  +K++L
Sbjct: 282 YDYYGEWSERTGLHANLYNEK--GKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVIL 339

Query: 359 GMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAV 418
           GM AYGRGF  V +   + HN  G  F  V            YNQLP+ G  E +D   V
Sbjct: 340 GMAAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHV 399

Query: 419 SAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRA 478
            AY      +     LV YDN  S+  KA Y++ N+LGG FWWESCG+ + +  RSL   
Sbjct: 400 GAYCY----DDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNT 455

Query: 479 FTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516
           + + I+ +     TIY+  ++ +YY + Y  +GFL   I
Sbjct: 456 YIRVIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFI 494

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  364 bits (934), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/564 (38%), Positives = 306/564 (54%), Gaps = 73/564 (12%)

Query: 6   VIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIA----------------RS 49
           ++  +FL+L  ++  IL+   T     S + K     Y                    + 
Sbjct: 7   ILRIRFLILLAIICFILQMCLTKLFFNSNKEKIVTDHYKNNNNNNNNNNNNNNNDDGNKK 66

Query: 50  EKMQSTVKDKDNSLLISSERGLT-----SGIYYSNWSPYKARKHFPHDIDFRRLTEVFYS 104
            +  S +  ++N ++   + G T     SG+YYS+WSPYK R HFPHDID  ++T V+YS
Sbjct: 67  GQHHSHLFPQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYS 126

Query: 105 FLVVNGETGECQLSDEWSDVQMDLYKQM---FSAFEKVDLKRQFPQSSR---------ND 152
           F +VNG TG+   SDEWSD++MDLYK +    +   + D        +R           
Sbjct: 127 FFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQ 186

Query: 153 LPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFIN 212
           LPLGC+GELFYLK              +NFK IMS+GGWSNRE F S+V+   K+  FI 
Sbjct: 187 LPLGCVGELFYLK------------KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIE 234

Query: 213 SCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTEKHTQH-- 270
           S V+QMFKYGFDGID+DWEFP++D  EP  YL++++ LRK++D LE DIF   K + H  
Sbjct: 235 SSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDY 294

Query: 271 --------FLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLYS 322
                   F L+ A  A    L  LP+ E+++Y+D WN+M YD+ G WS  T Y  NLY 
Sbjct: 295 DHDYHHPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYE 354

Query: 323 RSSLG--------KRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPH 374
             + G        + + +++G +A+ A+  +L  + + ++K+VLG+ AYGRGF  V V  
Sbjct: 355 GGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNK 414

Query: 375 HSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAEL 434
           + E   I + F  V            YNQLP+K  +E FD + VSA+      + +    
Sbjct: 415 NDEL-FINKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAF----CYDPKTKTF 469

Query: 435 VVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQ--EIKYLNKTVPT 492
           V YDNV +MK+KA+YV   +L GGFWWESCG+++    RSL  AFT   E+K+L K   +
Sbjct: 470 VGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDS 529

Query: 493 --IYALPQVGEYYHKKY-PDGFLA 513
             IY  P   +YY   +  DGFL+
Sbjct: 530 HLIYEQPDTIKYYLNYFGNDGFLS 553

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  355 bits (912), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/460 (42%), Positives = 277/460 (60%), Gaps = 45/460 (9%)

Query: 69  RGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDL 128
            G  SG+YYSNWSPYK R HFPHDI+  +++ V+Y+F  +N  TG  + +D WSD++M+L
Sbjct: 71  EGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNL 130

Query: 129 YKQM-FSAFEKVDLKRQFPQSSRND----LPLGCIGELFYLKYTDFLSKMGGPEDVKNFK 183
           YK +   + E +D       +S ND    LPLGCIGELFYLK++            K FK
Sbjct: 131 YKPLAIKSSELID------GNSSNDIQKILPLGCIGELFYLKHSC---------SGKKFK 175

Query: 184 TIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAY 243
            IMS+GGWS+ E F+ ++++   ++ F++S V+ MFK GFDGID+DWEFP+N+ +EP+ Y
Sbjct: 176 VIMSIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGY 235

Query: 244 LDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMA 303
           L ++R LR KL+ LES IFG E    HF L+ A  A    L YLP+ EID+Y+D WN+M 
Sbjct: 236 LKLVRMLRSKLNSLESQIFG-EGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMT 294

Query: 304 YDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAY 363
           YD+ G+WS  T Y SNL+S + L          S + A+  +++K  + ++K+VLGM AY
Sbjct: 295 YDYYGSWSETTGYHSNLFSETEL----------SGNFAIHYMIDKFGINSRKLVLGMAAY 344

Query: 364 GRGF--KGVSVPHHSEHNV-IGQSFQQVXXXXXXXXXXXX------YNQLPLKGGQEWFD 414
           GR F  KG      +++ + I QSF+ V                  Y  LP KG  E +D
Sbjct: 345 GRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYD 404

Query: 415 QDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRS 474
              VSAY      +++ +  + YDN +S+K KA+YVL N LGGGFWWESCGE Y + SRS
Sbjct: 405 PKYVSAYCF----DEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRS 460

Query: 475 LTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLA 513
           L  AF + ++    T P+++   +V  +Y  KY  +GFL 
Sbjct: 461 LIHAFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLT 500

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  355 bits (912), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/514 (39%), Positives = 293/514 (57%), Gaps = 54/514 (10%)

Query: 13  VLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSERGLT 72
           +L  +V IILE  +  K++    I+ F+   + I R+  + +  +  D +L         
Sbjct: 13  ILVLLVAIILEMTFIPKLM----IEKFKKPRSDIERT-ALSTITRPVDRNL---QHGKYA 64

Query: 73  SGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQM 132
            G+YY++WSPY+ R HFPHDIDF+R+T V Y+F VV+ +TG+ Q +D WSD++M  +   
Sbjct: 65  VGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP- 123

Query: 133 FSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWS 192
                        PQ        G IGEL YLK           +   NF+  M+VGGWS
Sbjct: 124 -----------GIPQGV-----TGMIGELNYLKL----------QRNTNFRLFMAVGGWS 157

Query: 193 NREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRK 252
           NREAF  +V+S  K+K F+NS +D MF+YGFDGID+DWEFPK+D  EP  YL+M   LR 
Sbjct: 158 NREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRS 217

Query: 253 KLDDLESDIFGTEKHT-QHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWS 311
           K+D LE +I+G        F L+ A  A    L+ LP+ E++++V  WN+M YDF G+WS
Sbjct: 218 KMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWS 277

Query: 312 RHTAYQSNLY----SRSSLGKRS------ENSEGGSADTAVRLLLNKHKLPAKKIVLGMP 361
           + T Y SNLY    +   L KR       +++EG +AD A+++++   K+ AKK+ LGMP
Sbjct: 278 KRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMP 337

Query: 362 AYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSAY 421
           AYGRGF  V      + +++ + +  V            YNQLPL    E FD   VSAY
Sbjct: 338 AYGRGFTNVQT--KDDDDLLNKKYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAY 395

Query: 422 SVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQ 481
                 +K +   V YDN+QSM++K+ YV + +L GGF+WESCG+ + D  R+L RAF+Q
Sbjct: 396 CF----DKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQ 451

Query: 482 EIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASI 515
           E+  +   +PTI+  P+   YY K    GFL S+
Sbjct: 452 ELSEMR--IPTIFKDPRAIAYYLKHRQKGFLYSL 483

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  351 bits (901), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/523 (39%), Positives = 290/523 (55%), Gaps = 55/523 (10%)

Query: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60
           M  G  I  K  + F ++II+L  +    IV  + +   +   +A  R      T  D D
Sbjct: 1   MFEGFKIT-KLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRP----PTEIDPD 55

Query: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120
             +      G +   YYSNWSPY AR H P DI   +LT V+Y+F VV+ ++G  + SD 
Sbjct: 56  TRVPSEGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDS 115

Query: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180
           WSD ++ L          V +K             GCI EL  +K           E   
Sbjct: 116 WSDFELPL---------SVGVK-------------GCIKELQKIKL----------ESKH 143

Query: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240
            FKTI+ +GGWSNREA++ + +S  K+K FI + VD MF+YGFDGID+DWEFP+ DS EP
Sbjct: 144 EFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEP 203

Query: 241 KAYLDMMRSLRKKLDDLESDIFGT---EKHTQHFLLTSAISADPSCLEYLPLGEIDRYVD 297
             YL+MMR +R+ +D LE  IFG+   EK   HF L+ A  A    L  LP+ E+ +YVD
Sbjct: 204 IVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVD 263

Query: 298 QWNLMAYDFSGAWSRHTAYQSNLY-----SRSSLGKRSENSEGGSADTAVRLLLNKHKLP 352
            WN+M YDF G WS  T Y SNLY      R SL  R  NS   S+DTAV+L+ ++H + 
Sbjct: 264 IWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSNRISNSS-LSSDTAVKLMTDRHNIS 322

Query: 353 AKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEW 412
           +++I LGM AYGRGF  V     ++ N +G+ +  V            YNQLP+ G +E 
Sbjct: 323 SRRIALGMAAYGRGFTNVET---NDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQ 379

Query: 413 FDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNS 472
           FD +AVSAY     S       V YDNVQSM IK +Y+ K NL GGFWWESCG++  D  
Sbjct: 380 FDSNAVSAYCFDPKSRT----FVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPR 434

Query: 473 RSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASI 515
           +SL  AF++EI  L++   +++   +V +++ +KYP  +++S+
Sbjct: 435 KSLVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQKYPKDYISSL 476

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/493 (39%), Positives = 288/493 (58%), Gaps = 41/493 (8%)

Query: 28  NKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSERGLTSGIYYSNWSPYKARK 87
           NKI K+ R    +  +N      ++ S V++    +    +    SG+YYSNWSPYK R 
Sbjct: 35  NKIFKNQRSDDIRDNFNN--GGHRVPSNVQNHGTHI---RDEAFISGVYYSNWSPYKPRF 89

Query: 88  HFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEKVDLKRQFPQ 147
           HFPHDI+ ++++ ++Y+F  +N  TG  + +D WSD++M+LYK +  A +  +L ++   
Sbjct: 90  HFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSL--AIKNSELIKESSN 147

Query: 148 SS-RNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLVQSPAK 206
           +S +N LPLGCIGELFYLK T            K FK IMS+GGWS+ E F+ +++    
Sbjct: 148 NSVQNILPLGCIGELFYLKNT---------CSDKKFKVIMSIGGWSDSENFKIIIKDDKL 198

Query: 207 MKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTEK 266
           ++ F++S V+ MF+ GFDGID+DWEFP N+ +EP+ YL ++R LR KL+ LES IFG ++
Sbjct: 199 LQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFG-KR 257

Query: 267 HTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLYSRSSL 326
              HF L+ A  A    L YLP+ EID+YVD WN+M YD+ G+WS  T Y SNL+S + L
Sbjct: 258 TEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSETEL 317

Query: 327 GKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFK---GVSVPHHSEHNVIGQ 383
                     + + A+  ++++  + ++K+VLGM AYGR F        P +    +I +
Sbjct: 318 ----------NGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTVLINK 367

Query: 384 SFQQVXXXXXXXXXXXX------YNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAELVVY 437
            F+ V                  Y  LP  G  E +D   VSAY      +++ +  + Y
Sbjct: 368 IFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCF----DEKNSIFISY 423

Query: 438 DNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKTVPTIYALP 497
           DN +S+K KA+YV  NNLGGGFWWESCGE Y + SRSL  AF + + +   + P+I+   
Sbjct: 424 DNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQDV 483

Query: 498 QVGEYYHKKYPDG 510
           +V +YY  KY DG
Sbjct: 484 RVKKYYLNKYGDG 496

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/460 (41%), Positives = 272/460 (59%), Gaps = 36/460 (7%)

Query: 68  ERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMD 127
           + G  SG+YYSNWSPYK R HFPHDI+  +++ V+Y+F  ++ +TG    +D WSD++MD
Sbjct: 70  DDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMD 129

Query: 128 LYKQM-FSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIM 186
           LYK +   A + VD       + ++ LPLGCIGELFYLK     +   G    + FK+IM
Sbjct: 130 LYKPLAIKASQLVDDNLD-DNNMQSILPLGCIGELFYLK-----NACSG----RKFKSIM 179

Query: 187 SVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDM 246
           S+GGWS+ E F+++V++   ++ F++S V+ MFK GFDGIDIDWEFP+N+  EP+ YL +
Sbjct: 180 SIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKL 239

Query: 247 MRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDF 306
           +R LR KL+ LES IFG      HF L+ A  A    L +LP+ EID+Y+D WN+M YD+
Sbjct: 240 VRMLRLKLNSLESQIFGGST-KDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDY 298

Query: 307 SGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRG 366
            G+WS  T Y SNL+S + L          S + A+  ++ +  +  +K+VLGM AYGR 
Sbjct: 299 YGSWSETTGYHSNLFSETEL----------SGNFAIHYMIGEFGVNPRKLVLGMAAYGRS 348

Query: 367 FK---GVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXX------YNQLPLKGGQEWFDQDA 417
           F        P      +I Q F+ V                  Y  LP KG  E +D   
Sbjct: 349 FHIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKY 408

Query: 418 VSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTR 477
           VSAY      +++ +  + YDN +S+K KA YV+   LGGGFWWESCGE+Y D SRSL  
Sbjct: 409 VSAYCF----DEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLIN 464

Query: 478 AFTQEIKYLNKTVPTIYALPQVGEYYHKKYPD-GFLASII 516
           AF + + +   + P+++   +V +YY  KY D GFLA  +
Sbjct: 465 AFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYL 504

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  343 bits (880), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 273/455 (60%), Gaps = 35/455 (7%)

Query: 69  RGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDL 128
           +G  SG+YYSNWSPY  R HFPHDI+  +++ V+Y+F  +N +TG  + +D WSD++M+L
Sbjct: 71  KGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNL 130

Query: 129 YKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSV 188
           YK +     ++ ++     S +N LPLGC+GELFYLK              K FK IMS+
Sbjct: 131 YKPLAIKSSQL-VENNLNDSVQNILPLGCVGELFYLK---------NACSEKKFKVIMSI 180

Query: 189 GGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMR 248
           GGWS+ E F+++V     ++ F++S V+ MFK GFDGIDIDWEFP+N+  EP+ YL +++
Sbjct: 181 GGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVK 240

Query: 249 SLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSG 308
            LR KL++LES IFG E    HF ++ A  A    L +LP+ EID+Y+D WN+M YD+ G
Sbjct: 241 MLRLKLNNLESQIFG-ESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYG 299

Query: 309 AWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGF- 367
           +WS  T Y SNL+S + L          S + A+  ++++  + + K+VLGM AYGR F 
Sbjct: 300 SWSETTGYHSNLFSETEL----------SGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFH 349

Query: 368 -KGVSVPHHSEHNV-IGQSFQQVXXXXXXXXXXXX------YNQLPLKGGQEWFDQDAVS 419
            K       +++ V I Q F+ V                  Y  LP KG  E +D   VS
Sbjct: 350 IKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVS 409

Query: 420 AYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAF 479
           AY      +++ +  + YDN +S K KA+YV+ N LGGGFWWESCGE + + SRSL  AF
Sbjct: 410 AYCF----DEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAF 465

Query: 480 TQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLA 513
            + I++   + P+++   +V ++Y  KY  DGFL+
Sbjct: 466 NEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLS 500

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  331 bits (849), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/519 (38%), Positives = 281/519 (54%), Gaps = 63/519 (12%)

Query: 13  VLFCVVIIILEGVYTNKIVK---SIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSER 69
           +L  V  I+LE  +  K++K   S RI+          +  ++    +   ++     E 
Sbjct: 13  ILILVAAIVLEMTFLPKLIKEKLSRRIRP---------KPLEVHEETRPVPDAPYPDGE- 62

Query: 70  GLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLY 129
             T G+YYS+WSPYK R H+P +IDF+R+T V+Y+F VV+ +TG+    D+WSD +M + 
Sbjct: 63  -YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM- 120

Query: 130 KQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVG 189
                      + R            G IGEL YLK     ++ G      +FK +M+VG
Sbjct: 121 -------NLTGMPRGLN---------GAIGELNYLK-----TRPG-----TDFKLMMAVG 154

Query: 190 GWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRS 249
           GWSNRE F  +V+   K   FI+S +D MF+YGFDGID+DWEFPK+D  EP+ YL+M   
Sbjct: 155 GWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSR 214

Query: 250 LRKKLDDLESDIFGTEKHTQ-HFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSG 308
           LR K+D+LE +I+G    T+  F L+ A  A P  L   P+ E+++Y+  WN+M YD+ G
Sbjct: 215 LRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHG 274

Query: 309 AWSRHTAYQSNLYS------RSSLGKRS------ENSEGGSADTAVRLLLNKHKLPAKKI 356
           AWS  T Y SNLY+      +S L KR       +N +  +A  A+ ++  + K+  +KI
Sbjct: 275 AWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKI 334

Query: 357 VLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQD 416
            LGM AYGRGF  V         +IGQ +  V            YNQLPL  G E FD  
Sbjct: 335 ALGMAAYGRGFTNV---RGDGEQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNV 391

Query: 417 AVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLT 476
            VSAYS     +     LVVYDNV SMKIK +YV    L G F WESCG+N+ D  R+L 
Sbjct: 392 WVSAYSY----DPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLV 447

Query: 477 RAFTQEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASI 515
            AFT+ +K   K   T Y   ++ +YY +  P+GFL  +
Sbjct: 448 EAFTENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPM 484

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/446 (38%), Positives = 260/446 (58%), Gaps = 45/446 (10%)

Query: 72  TSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQ 131
            SG+YYS+WSPY+ R HFP +ID  ++T ++YSF +V+ ++   +L D WSD++M +   
Sbjct: 52  VSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM--- 108

Query: 132 MFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGW 191
                             +N +  GCIG L  L+           ++   FK IM+VGGW
Sbjct: 109 -----------------GKNTVLKGCIGALNSLR-----------DEKPGFKNIMAVGGW 140

Query: 192 SNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLR 251
           SN++AF   ++    ++    SCV+ MF+YGFDGID+DWE+PK+D  EP+ YL++MR +R
Sbjct: 141 SNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIR 200

Query: 252 KKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWS 311
           + +++LE  I+G +K  + F L+ A  A    LE  P+ E+D+Y+D WN+M YD+ G WS
Sbjct: 201 QHMNELEIAIWGDKK--RRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWS 258

Query: 312 RHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVS 371
             T + SNLY  ++  K SE+S    AD A+R + NK  + ++K+VLGM  YGRGF  V 
Sbjct: 259 SGTGFHSNLYDGTN--KFSEHSL--CADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVK 314

Query: 372 V--PHHSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLKGGQEWFDQDAVSAYSVKLASNK 429
              P  +   +I + F+ V            YNQLP++G QE FD+   SAY      + 
Sbjct: 315 EGDPKKTS-GLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCF----DP 369

Query: 430 EMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKT 489
           +   LV YDNV S + KAQYV  +NL GGFWWESCG  + +  +SL   F ++I+ L++ 
Sbjct: 370 KTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRN 429

Query: 490 VPTIYALPQVGEYYHKKYP-DGFLAS 514
              +Y  P++ E+Y + +   GFLA+
Sbjct: 430 ETNLYQDPKLREHYLQIFAKSGFLAA 455

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  303 bits (777), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 174/471 (36%), Positives = 248/471 (52%), Gaps = 50/471 (10%)

Query: 60  DNSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSD 119
           D  +  S  R  + G+YYSNWS Y+ R HFPH+I+F  ++ V+Y+F +V+G+ G+    D
Sbjct: 47  DERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGD 106

Query: 120 EWSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDV 179
           +W+D Q  + K                    N L  G +GELF LK  +           
Sbjct: 107 KWADFQRPILKN-------------------NKLVKGNVGELFDLKMKN----------- 136

Query: 180 KNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTE 239
              K IM +GGWSNREA+      P+K++ F    V  MF+YGFDGID+DWE+P++D  E
Sbjct: 137 -RVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIE 195

Query: 240 PKAYLDMMRSLRKKLDDLESDIF-GTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQ 298
           P+ YL++MR ++  ++ LES+IF  T   T +F L+ A  A    LE  PL E+D  +D 
Sbjct: 196 PQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDY 255

Query: 299 WNLMAYDFSGAWSRHTAYQSNLYS--------RSSLGKRSENSEGGSADTAVRLLLNKHK 350
           WN+M YD+ G WS  T Y SNLY          S L       EG + D AV+ ++N+  
Sbjct: 256 WNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-G 314

Query: 351 LPAKKIVLGMPAYGRGFKGVSVPH---HSEHNVIGQSFQQVXXXXXXXXXXXXYNQLPLK 407
           +   KI+LGM AYGRGF  V VP    +     IG++F  V            Y+QLP+ 
Sbjct: 315 IKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIP 374

Query: 408 GGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGEN 467
           G  E FD   VS Y  +  +       V YD + S+++K QY+   ++GGGFWWESCG+ 
Sbjct: 375 GTVEQFDPRYVSGYCFEPTT----GTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDT 430

Query: 468 YLDNSRSLTRAFTQEIKYLNKTVP-TIYA-LPQVGEYYHKKYPDGFLASII 516
           + +  RSL  A+ +E+   N   P +IY  L  V  Y    +  GFL+  +
Sbjct: 431 HKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481

>NDAI0E04430 Chr5 complement(1000369..1001742) [1374 bp, 457 aa]
           {ON} Anc_7.357 YLR195C
          Length = 457

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 225 GIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSC- 283
             D D+EF  ND   P+A     + LRK+LD+L SD     K     +  +  S D +  
Sbjct: 356 ATDADFEF--NDRFSPEA----TKKLRKRLDELISDALILAKQANMDVFNALTSQDNTLF 409

Query: 284 LEYLPLGEIDRYVD--QWNLMAYDFSGAWSRHTAYQSNLYSRSSLG 327
           L+ L  G  D +++   +N  A+  +G      +Y  ++  RS++G
Sbjct: 410 LDDLKFGAGDGFLNFYVFNYKAFPVTGGLKEDKSY--DVEKRSNVG 453

>Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON}
           (46346..48160) [1815 nt, 605 aa]
          Length = 604

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 13/93 (13%)

Query: 260 DIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWN----LMAYDF------SGA 309
           +IF   + T  + L +A+ A PSC+   P G   RYV   +    ++ YD       +  
Sbjct: 465 EIFKATELTNSYKLNTALQAKPSCISISPSG---RYVAAGDVSGKIILYDLENKDVKTTR 521

Query: 310 WSRHTAYQSNLYSRSSLGKRSENSEGGSADTAV 342
           WS HT+  + +  R S      +   GS DT +
Sbjct: 522 WSFHTSKINCITWRPSEDGEENHVVTGSLDTNI 554

>KAFR0D03730 Chr4 complement(721535..722299) [765 bp, 254 aa] {ON}
           Anc_1.116 YNL246W
          Length = 254

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 10/87 (11%)

Query: 69  RGLTSGIYYSNWSPYKARKHFPHDIDFRRL-TEVFYSFLVVNGETGECQLSDEWSDVQMD 127
           +G+ S   +  W+  K  K FPH   F  L +E  Y + V      +  L DE SD   D
Sbjct: 170 KGMKSFFGWFKWTGLKPGKEFPHGDSFATLFSEDLYPYCVKYYTEAQRDLEDEASDSDYD 229

Query: 128 LYKQMFSAFEKVDLKRQFPQSSRNDLP 154
                 SA E +D+     + S ND P
Sbjct: 230 ------SAEEPLDIDN---EESENDEP 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,088,449
Number of extensions: 2416985
Number of successful extensions: 6358
Number of sequences better than 10.0: 26
Number of HSP's gapped: 6413
Number of HSP's successfully gapped: 26
Length of query: 516
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 402
Effective length of database: 40,409,475
Effective search space: 16244608950
Effective search space used: 16244608950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)