Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.213995.442ON32932917320.0
KLTH0F15884g5.442ON32932915820.0
SAKL0G02706g5.442ON33233214260.0
TDEL0D025905.442ON33033013530.0
KAFR0D050605.442ON32632913420.0
Smik_4.6385.442ON34634613310.0
Skud_4.6415.442ON34634613240.0
YDR372C (VPS74)5.442ON34534513230.0
ZYRO0F10208g5.442ON33233213200.0
Suva_2.5445.442ON34634713130.0
KNAG0B042005.442ON34434413110.0
KLLA0E02355g5.442ON32432613070.0
CAGL0A02926g5.442ON32833012781e-178
Ecym_45135.442ON33333212781e-178
ACL165C5.442ON33132912631e-175
NCAS0F034305.442ON33233312631e-175
Kpol_1016.25.442ON32832912411e-172
NDAI0B057205.442ON36536512391e-171
TBLA0A064805.442ON33433812241e-169
TPHA0J026105.442ON32932911791e-163
Kpol_1062.245.442ON2762769081e-122
TBLA0A027805.442ON3873209001e-119
NCAS0H020905.442ON3452835806e-72
NDAI0A003201.33ON49794750.74
ZYRO0F07172g8.667ON50640712.0
ABL179C2.30ON74081694.5
Skud_15.4828.790ON33660675.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21399
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   671   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   613   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   553   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   525   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   521   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   517   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   514   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   514   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   513   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   510   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   509   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   508   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   496   e-178
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   496   e-178
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   491   e-175
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   491   e-175
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   482   e-172
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   481   e-171
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   476   e-169
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   458   e-163
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   354   e-122
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   351   e-119
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   228   6e-72
NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33        33   0.74 
ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conser...    32   2.0  
ABL179C Chr2 complement(69348..71570) [2223 bp, 740 aa] {ON} Syn...    31   4.5  
Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {...    30   5.8  

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM
Sbjct: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE
Sbjct: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           EIDANSDALLRLEVVAGVFEVFSRMDTLL
Sbjct: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/329 (90%), Positives = 313/329 (95%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           MSGLQRRRVNKSES    +PV+++E +GE KRVAYDPEEA L+D+ T PKLNLMEEVLLM
Sbjct: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQV+ND ARKRFDVSERLVEVINATKT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFP+SV FKL+RTLSLI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           CGAYGANVLENVL SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN+NKE+QE
Sbjct: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           E+ +N DA L+LE VAGVFEVFSRMDTLL
Sbjct: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 302/332 (90%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGES---KRVAYDPEEAMLKDNATIPKLNLMEEV 57
           MSGLQRRRVN++ S+Y  +P+ S ++  E+   ++VAYDPEEA LK+N T+PKL LMEEV
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA 117
           LLMGLKDKEGYLSFWNDNISYALRGCILIELALR KI+V++D ARKRFDVS+RL+EVI+ 
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGEVLLDEALNL+KNDEPL IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTL 237
           LRTEMKNFFLFDM THPITDTSCKEAIKRR+LSVLVSRNM+LNYNEYF  +++FK++RTL
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 238 SLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297
           SLICGAYGANVLENVL SLDY+KRDRAFSRADEILAQFS+FPFALDK TE+GISVN+NKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 298 MQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +Q EI  N    L+LEVVAGVFEVFSRMDTLL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/330 (76%), Positives = 292/330 (88%), Gaps = 1/330 (0%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGE-SKRVAYDPEEAMLKDNATIPKLNLMEEVLL 59
           MS LQRRRVN+ +S  +S    SE  E   SKRVAYDPEEA + +N   PKL LMEEVLL
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEVLL 60

Query: 60  MGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATK 119
           +GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI++++DSARKRFDVSERL+EV++A+K
Sbjct: 61  LGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120

Query: 120 TGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLR 179
           TGEVLLDE L LMK DEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLR
Sbjct: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180

Query: 180 TEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSL 239
           TEMKNFFLFDM THP+TDTSCKEA+KRR+LSVLVSRNM+L+YNEYFP + SFKL+RT++L
Sbjct: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240

Query: 240 ICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQ 299
           ICG+Y ANVLENVL SLDYEKRDRA SRADEIL Q++Q+PF LDK TE+G+S+N+NKE++
Sbjct: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300

Query: 300 EEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           EE+  N D  L+LEVVAGVFEVFSRMD LL
Sbjct: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 287/329 (87%), Gaps = 3/329 (0%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           MS LQRRR N+S+SN D    +SE    + ++VAYDPEEA L+DN +IPKL LMEEVLLM
Sbjct: 1   MSTLQRRRKNRSDSNADDSENVSE---SQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLLM 57

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GL+D+EGYLSFWNDNISYALRGCILIELALR KI++++DSARKRFDVSERLVEVI+ +KT
Sbjct: 58  GLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSKT 117

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEAL LMKNDEPLTIANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRT
Sbjct: 118 GEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 177

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDM THP+TDTSCKEAIKRRILS LVSRNM+LNYN YF  + SFK +R ++L+
Sbjct: 178 EMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVALV 237

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           C +YGANVLENVL SLDYEKRDRA SRA+EILAQF+Q+PF L K TE GISVN+NKE++ 
Sbjct: 238 CCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVEN 297

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           E++ N    L+LEV+AGV EVFSRMD LL
Sbjct: 298 EVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/346 (71%), Positives = 297/346 (85%), Gaps = 17/346 (4%)

Query: 1   MSGLQRRRVNKSESNYDS--EP---------------VISEEAEGESKRVAYDPEEAMLK 43
           MS LQRRRVN+++S   S  +P                + ++  G +K++AYDPEE+ L+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 44  DNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARK 103
           DN  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++++DSARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163
           RFD+SERL+EVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 224 YFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALD 283
           YFP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI+AQFSQFPF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 284 KQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           K+TE GISVN+NKE++EE+++N    L+LEV+AGVFEVFSRMD LL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/346 (71%), Positives = 297/346 (85%), Gaps = 17/346 (4%)

Query: 1   MSGLQRRRVNKSES-------------NYDSEPV----ISEEAEGESKRVAYDPEEAMLK 43
           MS LQRRRVN+++S             N   + +    I ++  G +K++AYDPEE+ L+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 44  DNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARK 103
           DN  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++++DSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163
           RFD+SERLVEV++ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 224 YFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALD 283
           YFP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A +RA+EI+AQFSQ+PF L+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 284 KQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           K+TE G+SVN+NKE++EEI+ N+   L+LEV+AGVFEVFSRMD LL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/345 (71%), Positives = 295/345 (85%), Gaps = 16/345 (4%)

Query: 1   MSGLQRRRVNKSESNYDSE----------------PVISEEAEGESKRVAYDPEEAMLKD 44
           MS LQRRRVN+++S   S                  V  ++  G +K++AYDPEE+ L+D
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 45  NATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKR 104
           N  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++++DSARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 105 FDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQV 164
           FD+SERL+EVI+++KTGEVLLDE L LMKNDEPL+I+NWIDLLSGETWN +KI+YQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 165 RERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEY 224
           RERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNEY
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 225 FPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDK 284
           FP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI+AQFSQ+PF L+K
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 285 QTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +TE G+SVN+NKE++EEI+ N    L+LEV+AGVFEVFSRMD LL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/332 (75%), Positives = 290/332 (87%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNKSESN-YDSEPVISEEAE--GESKRVAYDPEEAMLKDNATIPKLNLMEEV 57
           MSGLQRRRVN+ +S+  ++EP    EA+    SK+VAYDPEE  L DN  +PKL LMEEV
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEV 60

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA 117
           LL+GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI+VV+DSARKRFDVSERL+EV ++
Sbjct: 61  LLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGEVLLDEAL LMK DEPL+I NWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTL 237
           LRTEMKNFFLFDM THP+TDTSCKEAIKRRILSVLV RN++LNYN+YF   VSFKL+RT+
Sbjct: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240

Query: 238 SLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297
           +LICGAY ANVLENVL SL YEKRD A  RADEIL QFS++PF LD QTE+GIS+N+NKE
Sbjct: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300

Query: 298 MQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           + +E+  + ++ L+LEV+AGVFEVFSRMD LL
Sbjct: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 296/347 (85%), Gaps = 19/347 (5%)

Query: 1   MSGLQRRRVNKSES-----------NYDSE-------PVISEEAEGESKRVAYDPEEAML 42
           MS LQRRRVN+++S           N++S        PV  ++  G +K++AYDPEE+ L
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-NGINKKIAYDPEESKL 59

Query: 43  KDNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSAR 102
           +DN  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++++DSAR
Sbjct: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 103 KRFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLK 162
           KRFD+SERLVEVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLK
Sbjct: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 163 QVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYN 222
           QVRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 223 EYFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFAL 282
           EYFP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI++ FSQ+PF L
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299

Query: 283 DKQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +K T+ G+SVN+NKE++EEI+ N    L+LEV+AGVFEVFSRMD LL
Sbjct: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 290/344 (84%), Gaps = 15/344 (4%)

Query: 1   MSGLQRRRVNKSESNYD---------SEPVISEEAE------GESKRVAYDPEEAMLKDN 45
           MS LQRRRVN+S+SN           + P  S +AE      G +++VAYDPEEA L+DN
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 46  ATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRF 105
            T+PKL LMEEVLLMGL+D+EGYLSFWNDNISYALRGCI+IELALR KI++++DSARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 106 DVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVR 165
           D+SERLVEV++ +KTGEVLLDE L LMKNDEPLTIANWIDLLSGETWN MKI+YQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 166 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYF 225
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS +VSRNM+L++N YF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 226 PASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQ 285
           P S SFK +RT++L+C  YGA+VLENVL SLDYE+RDRA SRA+E+L +F Q+PF L+KQ
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 286 TETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
            ++GIS N+NKE Q E+D + ++ L LEVVAGV EVFSRMD LL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/326 (74%), Positives = 283/326 (86%), Gaps = 4/326 (1%)

Query: 4   LQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLMGLK 63
           LQRRRVNK ++  +S P I  E +    ++ YD +EA L+DN ++PKL LMEEVLLMGLK
Sbjct: 3   LQRRRVNKGDTT-ESIPQIDNEHD---HKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLK 58

Query: 64  DKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKTGEV 123
           DK+GYLSFWNDNISYALRGCILIELALRGKI+ V+D ARKR+DVSERL+EVI+ +KTGEV
Sbjct: 59  DKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEV 118

Query: 124 LLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMK 183
           LLDE+L+LMKND P +I  WIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRTEMK
Sbjct: 119 LLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMK 178

Query: 184 NFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGA 243
           NFFLFDM THPITDT+CKE+IKRRILS+LVSRN +L YN YFP  VSFK +RTLSLICGA
Sbjct: 179 NFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGA 238

Query: 244 YGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEID 303
           YGANVLENVL +LDYE RD  F+RADEILAQFS+FPF LDKQT TG+SVN+NKE+ +E++
Sbjct: 239 YGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELN 298

Query: 304 ANSDALLRLEVVAGVFEVFSRMDTLL 329
            +  + L+LEVVAGVFEVFSRMDTLL
Sbjct: 299 NHPGSDLQLEVVAGVFEVFSRMDTLL 324

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 290/330 (87%), Gaps = 3/330 (0%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESK-RVAYDPEEAMLKDNATIPKLNLMEEVLL 59
           MS LQRRRVNKSE+   S  +   E +G S  ++AYDPEE+ L++++  P L LMEEVLL
Sbjct: 1   MSTLQRRRVNKSENA--SNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58

Query: 60  MGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATK 119
           MGL+D+EGYLSFWND+ISYALRGCILIELALR KI++++  AR RFD+SERL+EVI+++K
Sbjct: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118

Query: 120 TGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLR 179
           TGEVLLDE L LM NDEPL+IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLR
Sbjct: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178

Query: 180 TEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSL 239
           TEMKNFFLFDM THP++D+SCKEAIKRRILSVLVSRNM+++YN YFP S +FKL+RT+SL
Sbjct: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238

Query: 240 ICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQ 299
           I GAYGANVLENV+ SL+Y+KRD+A +RA+EILAQFSQ+PF L K+++ GISVN+NKE+Q
Sbjct: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298

Query: 300 EEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           EE+++N  + L+LEV+AGVFEVFSRMD LL
Sbjct: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 279/332 (84%), Gaps = 7/332 (2%)

Query: 4   LQRRRVNKSESNYDSEPVISEEAEGE------SKRVAYDPEEAMLKDNATIPKLNLMEEV 57
           LQRRRVNK+E    S   +++   GE      S +VAYDPE+  L++N   P L LMEEV
Sbjct: 3   LQRRRVNKAEVGGTSVE-LTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEV 61

Query: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA 117
           LLMGLKDKEGYLSFWND+ISY+LRGCILIELALRGKI+VV D+ARKRFD+SERLVEVI  
Sbjct: 62  LLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIET 121

Query: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177
           +KTGE LLDE L+LMK++EPL+I NWIDLLSGETWN +KISYQLKQVRERLAKGLVDKGV
Sbjct: 122 SKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGV 181

Query: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTL 237
           LRTEMKNFFLFDM THP+ D+SCKE+IKRR+LSVLV RN+ L+Y EYFP SV+FK LRT+
Sbjct: 182 LRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTI 241

Query: 238 SLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297
           +LICGAYGANVLENVL SLDYEKR+R FSRA+EIL QFSQ+PFALDK  ETGISVN+  +
Sbjct: 242 ALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQ 301

Query: 298 MQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           ++EEI  N    L+LEVVAGVFEVFSRMD  L
Sbjct: 302 VKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 275/329 (83%), Gaps = 3/329 (0%)

Query: 4   LQRRRVNKSESNYDSEPVI---SEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           LQRRRVNK+  N          S+E EG + +VAYDPEE  L++N   P L LMEEVLLM
Sbjct: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GLKDKEGYLSF N+NISYALRGCILIELALRG+IQVV+D+ R+RFD SERL+EV++ +KT
Sbjct: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GE LLDEAL LMK  EPLTI NW+DLLSGETWNF+KI+YQL+QVRERLAKGLVDKGVLRT
Sbjct: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDMPTHP+ DTSCKE+IKRRILSVLV RN++L Y E FP +V+FK LRT++LI
Sbjct: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           C A+GANVLE VL +LDYEKRDR FSRA+E+L QFSQ+PFALDK  ETGISVN+N+ +QE
Sbjct: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           E+D N    L LEVVAGV +V+SRMD LL
Sbjct: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 287/333 (86%), Gaps = 5/333 (1%)

Query: 1   MSGLQRRRVNKSESNYDS---EPVISEEAEGESKRVAYDPEEAMLKD-NATIPKLNLMEE 56
           MS LQRRRVNK +S+ ++    P +  +++ ++K VAYDPEEA +++    +P L LMEE
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59

Query: 57  VLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVIN 116
           VLLMGL+DKEGYLSFWNDNISYALRGCILIELALRGKIQ+++DSARKRF++SERLV+VI+
Sbjct: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119

Query: 117 ATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKG 176
            TKTGEVLLDE L LMKNDEPL+IA+WIDLLSGETWN MKI+YQLKQVRERLAKGLVDKG
Sbjct: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179

Query: 177 VLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRT 236
           VLRTEMKNFFLFDM THP+TD+SCKEAIKRR+LS+LVSRNM+L+YN YFP +  FK++RT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239

Query: 237 LSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINK 296
           ++LICGAYGANVLEN+L SLD+E  D A +RADE++AQFS+FPF L+  T  GISVN+N+
Sbjct: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299

Query: 297 EMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           E+Q+E+       L+LEV+AGV EVFSRMDTLL
Sbjct: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  482 bits (1241), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 281/329 (85%), Gaps = 1/329 (0%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           MS LQRRR+N+  S+  +E    +E   +S ++AYDPEEA LKD+ T+P L LMEEV+L+
Sbjct: 1   MSSLQRRRLNRINSDT-AESSNDDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVLL 59

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GL DK+GYLSFWNDNISY LRGCI+IELALR KI++++D ARKRFD+SERLVEV++ +KT
Sbjct: 60  GLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSKT 119

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDEAL LMKNDEPL+IANWIDLLSGETWNF KI+YQLKQVRER++KGLVDKGVLRT
Sbjct: 120 GEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLRT 179

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDM THP+TDTSCKEAIKRRILS LVSR M+LNYNEYFP +  +K++RT++LI
Sbjct: 180 EMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIALI 239

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           C +Y ANVLENVL SL+YEKRD A +R++ IL++F+Q+PF LDK ++  +S+N++K +++
Sbjct: 240 CSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVED 299

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           EI  N  + L+LE VAGVF+VFS+MD +L
Sbjct: 300 EIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  481 bits (1239), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 246/365 (67%), Positives = 283/365 (77%), Gaps = 36/365 (9%)

Query: 1   MSGLQRRR-----VNKSESNYDSEPVISEEAEGE--------------SKRVAYDPEEAM 41
           MS LQRRR      NK   + DS+   S    G               S ++AYDPEEA 
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 42  L-----------------KDNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCI 84
           L                  +NA  P L LMEEVLLMGL+DKEGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 85  LIELALRGKIQVVNDSARKRFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWI 144
           LIELALRGKI++++DSARKRFD+SERL+EV + +KTGEVLLDE L LMKNDEPLTIANWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 145 DLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAI 204
           DLLSGETWN MKI+YQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM THP+TD+SCKEAI
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 205 KRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRA 264
           KRR+LSVLVSRNM+ NYNEYFP +  FK++RT++LICGAYGANVLENVL SLDYEK D A
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 265 FSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSR 324
            +RADE++AQFS+FPF L+K T T +SVN+N+ +Q+E+D N    L+LEV+AGV EVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 325 MDTLL 329
           MDTLL
Sbjct: 361 MDTLL 365

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  476 bits (1224), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/338 (67%), Positives = 284/338 (84%), Gaps = 13/338 (3%)

Query: 1   MSGLQRRR---------VNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKL 51
           MS LQRRR          + ++SN D+EP      + ES+RVAYDPEE  +++N ++P+L
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSN-DNEPT---NRQAESRRVAYDPEEDKIRNNMSVPQL 56

Query: 52  NLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERL 111
            LMEEV+L+GL+DKEGYLSFWNDNISYALRGCI+IELALRGKI++++D ARKRF++SERL
Sbjct: 57  TLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERL 116

Query: 112 VEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKG 171
           VEV++++KTGEVLLDEAL +M+NDEPL I+NW+DLLSGETWN  KI+YQLKQVRER++KG
Sbjct: 117 VEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKG 176

Query: 172 LVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSF 231
           LVDKGVLRTEMKNFFLFDM THP+TD+SCKEAIKRRILS+LV+R  +  YN+YFP + SF
Sbjct: 177 LVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSF 236

Query: 232 KLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGIS 291
           K +RT+SLIC AYGANVLENVL SL+Y+KRD   +RA+E+L QFSQ+PF L+KQTE G S
Sbjct: 237 KYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTS 296

Query: 292 VNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +N+N  ++EEI+A+    L LEVVAGVFEVFS+MD LL
Sbjct: 297 INLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  458 bits (1179), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 211/329 (64%), Positives = 273/329 (82%)

Query: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60
           MSG+QRRR+N+  +  +S+   ++++     +VA+DPEEA +KD+ ++PKL LMEEV+L+
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLL 60

Query: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120
           GL D EGYLSFWNDNISY LRGCILIELALRGKI++++DSARK FD+SERL+EVI+A+KT
Sbjct: 61  GLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKT 120

Query: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180
           GEVLLDE L LMKNDEP +I +WIDLLSGETWNF K++YQLKQVRERL+KGLVDKGVLRT
Sbjct: 121 GEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRT 180

Query: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240
           EMKNFFLFDM THP+ D+SCKE++KRRI+S LV R + L YNEYFP S +FK++RT+SLI
Sbjct: 181 EMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLI 240

Query: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
             AY ANVLENVL +L+YEKRD+A SRA+ +L  F  +PF L  + +  IS+N+N+ +++
Sbjct: 241 ITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVED 300

Query: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           EI AN    L+LEV+AGVF+VF++MD ++
Sbjct: 301 EIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 216/276 (78%)

Query: 54  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVE 113
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA RG IQV++D +RKRFD+S+RL+E
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 114 VINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLV 173
           V+N  KTGE LLDE L +MK++E  +I+ WIDLLSGETWN  KI+ QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 174 DKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKL 233
           DKG+LRTEMKNFFLFDM THP+ D  CKE IK+RILSVL+ +   +  +EYFP +V  + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 234 LRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN 293
           LRT++LI  AY  +VLENV   LDY+K+D  F R  EIL Q S +PF  D ++ T I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 294 INKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +N+ ++ E+  + +  L+LE +AGVFEVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 232/320 (72%), Gaps = 2/320 (0%)

Query: 11  KSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLMGLKDKEGYLS 70
           +++SN++S   +     G+     +DPEE++  +   +P LNLMEE++L+GLKDK+GYLS
Sbjct: 69  RNDSNFNSHYSLIN-PNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLS 127

Query: 71  FWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA-TKTGEVLLDEAL 129
           FWNDNISY LRGCILIELALR KI+V++D  R  +DVS R++EV+   TKTG  LLDEAL
Sbjct: 128 FWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEAL 187

Query: 130 NLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFD 189
           N+M  + P +I NWIDLLSGETWN  K + QLK VRER++KGLVDKG+L+    NF  FD
Sbjct: 188 NMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFD 247

Query: 190 MPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGAYGANVL 249
           M THP+ D   KE++K+RI S+LV ++  L YN YFP +V+FK++R+L LIC AYGA+VL
Sbjct: 248 MSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVL 307

Query: 250 ENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEIDANSDAL 309
           ++ L +++Y+  D AF +A+++    S FP  LD++  +G+ V+I K++Q E+  +S   
Sbjct: 308 DDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGES 367

Query: 310 LRLEVVAGVFEVFSRMDTLL 329
           L LEVVAGV +V  RMD+LL
Sbjct: 368 LYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  228 bits (580), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 182/283 (64%), Gaps = 7/283 (2%)

Query: 49  PKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKR-FDV 107
           P+L LM+E+ L+ LKDKEGY+S W+  +SY LR C++IELALRGKIQ V +  +K+    
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122

Query: 108 SERLVEVINATKTGEVLLDEALNLMKNDEP-LTIANWIDLLSGETWNFMKISYQLKQVRE 166
            E  +EVI+ + TG+ LLD+ L LMK ++   ++++WI LLSGE+ NF+K SYQL  VR+
Sbjct: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182

Query: 167 RLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFP 226
           R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  + L   +YFP
Sbjct: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242

Query: 227 ASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQT 286
            +VS+++LRT+ L C AYGA++L+      + E       RA  +L+ FS+FPF L++  
Sbjct: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAV 301

Query: 287 ETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329
           +  ++  ++KE+ E  +  S    +LEVVAG  +V + +DT+L
Sbjct: 302 QPDLNEKVSKELHEHPEEAS----QLEVVAGAIDVINTIDTVL 340

>NDAI0A00320 Chr1 (45071..46564) [1494 bp, 497 aa] {ON} Anc_1.33
          Length = 497

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 209 LSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFS-- 266
           L VL +    ++ ++ + A+  F L      + G Y   VL NVL  +D  KR   F+  
Sbjct: 294 LKVLPTTKYDVDIDQKYSANPGFHLFE--KRVSGMYLGEVLRNVL--VDLHKRGLIFAQY 349

Query: 267 RADEILAQFSQFPFALDKQTETGISVNINKEMQE 300
           R ++ L    Q PF LD +  + I ++ +  ++E
Sbjct: 350 RTEKQLPHRLQTPFELDSEVLSHIEIDDSTGLRE 383

>ZYRO0F07172g Chr6 (579706..581226) [1521 bp, 506 aa] {ON} conserved
           hypothetical protein
          Length = 506

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 76  ISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVI 115
           IS+AL+  I  E+ +  ++  VND  RK F V  R V+++
Sbjct: 245 ISFALKNLITEEIEVNKEVSQVNDGQRKEFLVPRRFVDLL 284

>ABL179C Chr2 complement(69348..71570) [2223 bp, 740 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL234C
           (GYP7)
          Length = 740

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 LVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAK 170
           L +  N+    E+  DE    M+   PL+ A W  L  G      ++S   ++++ER+  
Sbjct: 311 LAKEFNSDGDIEISEDELNTAMERTHPLSKAEWDSLFDG----MGRLSLSAQEIKERIFH 366

Query: 171 GLVDKGVLRTEMKNFFLFDMP 191
           G +    LR  +  F L   P
Sbjct: 367 GGIKDNQLRRRVWPFLLGVFP 387

>Skud_15.482 Chr15 complement(842032..843042) [1011 bp, 336 aa] {ON}
           YOR313C (REAL)
          Length = 336

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 7/60 (11%)

Query: 245 GANVLENVLC-------SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297
           G  V  +  C       +LDY    RA S A   +A  ++ PFA    T T  + N++K+
Sbjct: 227 GEKVPNDTFCCEFNRGLALDYNFMTRALSAASHQVADVAKLPFAYGYHTNTVYNKNLDKQ 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,908,190
Number of extensions: 1387578
Number of successful extensions: 4769
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4912
Number of HSP's successfully gapped: 42
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)