Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212735.473ON36836819480.0
KLTH0F15048g5.473ON36836818670.0
KLLA0E03125g5.473ON36836816900.0
SAKL0G03520g5.473ON36936916760.0
TDEL0A033705.473ON37137116470.0
YOR136W (IDH2)5.473ON36936916460.0
NDAI0C014105.473ON36936916370.0
Smik_15.3165.473ON36936916270.0
Suva_8.1885.473ON36936916210.0
Ecym_23135.473ON37037016170.0
Skud_15.3005.473ON36936916170.0
AFR137C5.473ON36736815930.0
NCAS0H022505.473ON42236915970.0
CAGL0I07227g5.473ON36836315840.0
KNAG0B040705.473ON37337315750.0
Kpol_440.125.473ON36836815630.0
ZYRO0D11220g5.473ON36836815410.0
KAFR0B063705.473ON37837015210.0
Kpol_543.85.473ON36836815120.0
TBLA0B022405.473ON37336115040.0
TPHA0J027705.473ON37635014540.0
TPHA0E014805.473ON37735913470.0
ADL223W2.278ON3623647517e-97
KLLA0F04103g2.278ON3613437465e-96
Ecym_33162.278ON3623717413e-95
KLTH0G10186g2.278ON3603737386e-95
Kwal_23.50122.278ON3613457301e-93
SAKL0E07876g2.278ON3613757282e-93
ZYRO0D02838g2.278ON3613727255e-93
NDAI0B035902.278ON3593437231e-92
Smik_14.2902.278ON3603447203e-92
Skud_14.2932.278ON3613447101e-90
YNL037C (IDH1)2.278ON3603447082e-90
TBLA0B069102.278ON3653447074e-90
NCAS0B062902.278ON3593717012e-89
TPHA0D015602.278ON3603436943e-88
CAGL0G02673g2.278ON3583436892e-87
TDEL0C038402.278ON3613756874e-87
Kpol_1039.352.278ON3593716762e-85
KNAG0A052802.278ON3613636665e-84
KAFR0J014102.278ON3503426394e-80
Suva_14.3022.278ON3002865623e-69
SAKL0E07656g2.287ON3683894561e-52
TBLA0B059402.287ON3693534542e-52
KLLA0E08339g2.287ON3693954525e-52
CAGL0G02585g2.287ON3723594482e-51
NCAS0B062502.287ON3733904482e-51
Kpol_1003.392.287ON3703584482e-51
YIL094C (LYS12)2.287ON3713534447e-51
Smik_9.852.287ON3713794447e-51
KNAG0A054202.287ON3723534448e-51
ZYRO0A01914g2.287ON3683544421e-50
NDAI0B035502.287ON3723544412e-50
Suva_9.1052.287ON3713534402e-50
Skud_9.792.287ON3713534378e-50
ADL214C2.287ON3673594361e-49
KLTH0G10384g2.287ON3673914351e-49
Kwal_27.115282.287ON3673604324e-49
Ecym_33262.287ON3663554315e-49
TDEL0G021802.287ON3693914272e-48
TPHA0C034102.287ON3713794254e-48
KAFR0J013602.287ON3733544151e-46
Ecym_12961.402ON3632772925e-29
AAL012C1.402ON3722682821e-27
KLLA0D04906g1.402ON3622672751e-26
ZYRO0E04796g1.402ON3622672751e-26
Skud_3.431.402ON3642672732e-26
NDAI0G042301.402ON3632672714e-26
Smik_3.661.402ON3642672705e-26
YCL018W (LEU2)1.402ON3642672705e-26
SAKL0D08690g1.402ON3642682662e-25
Suva_3.31.402ON3642672653e-25
TBLA0C015001.402ON3652712653e-25
TDEL0B060001.402ON3622672611e-24
KAFR0I022001.402ON3652692601e-24
NCAS0C048701.402ON3652672583e-24
Kwal_0.2251.402ON3642712558e-24
Kpol_1048.631.402ON3643562549e-24
KLTH0H12188g1.402ON3643562494e-23
KNAG0I012801.402ON4472672481e-22
CAGL0H03795g1.402ON3652672415e-22
TPHA0B037301.402ON3652681965e-16
Suva_14.303singletonON53511197e-08
KNAG0H016701.396ON424127960.002
Kwal_26.7784singletonOFF16764740.63
KNAG0H010303.302ON443140750.83
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21273
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   754   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   723   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   655   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   650   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   639   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   638   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   635   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   631   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   629   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   627   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   627   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   618   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    619   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   614   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   611   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   606   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   598   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   590   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   587   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   583   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   564   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   523   0.0  
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   293   7e-97
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   291   5e-96
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   290   3e-95
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   288   6e-95
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   285   1e-93
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   285   2e-93
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   283   5e-93
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   283   1e-92
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   281   3e-92
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   278   1e-90
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   277   2e-90
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            276   4e-90
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   274   2e-89
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   271   3e-88
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   270   2e-87
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   269   4e-87
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   265   2e-85
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              261   5e-84
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   250   4e-80
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   221   3e-69
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   180   1e-52
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   179   2e-52
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   178   5e-52
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   177   2e-51
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   177   2e-51
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   177   2e-51
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   175   7e-51
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   175   7e-51
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              175   8e-51
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   174   1e-50
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   174   2e-50
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   174   2e-50
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   172   8e-50
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   172   1e-49
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   172   1e-49
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   171   4e-49
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   170   5e-49
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   169   2e-48
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   168   4e-48
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   164   1e-46
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   117   5e-29
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   113   1e-27
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   110   1e-26
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   110   1e-26
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   109   2e-26
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   108   4e-26
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   108   5e-26
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   108   5e-26
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   107   2e-25
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      106   3e-25
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   106   3e-25
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   105   1e-24
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   104   1e-24
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   103   3e-24
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   102   8e-24
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   102   9e-24
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   100   4e-23
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   100   1e-22
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              97   5e-22
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    80   5e-16
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    50   7e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    42   0.002
Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig...    33   0.63 
KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {O...    33   0.83 

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/368 (100%), Positives = 368/368 (100%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD
Sbjct: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360

Query: 361 AEAVISRL 368
           AEAVISRL
Sbjct: 361 AEAVISRL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/368 (94%), Positives = 362/368 (98%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MF+S F RN+ RF ATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA
Sbjct: 1   MFKSSFVRNSARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AKAPIQWE+CDV+PLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKS+QG+KTAYDNVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIRYAFEYARAVERPKV+VVHKSTIQRLADGLFVSVAE+L+KEYPDIELQTELIDNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTVL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           HTVRDP KYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGH+VSIFEAVHGSAPD
Sbjct: 241 HTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVF+TIA+GPE+RTGDL GSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSF 360

Query: 361 AEAVISRL 368
           AEAVISRL
Sbjct: 361 AEAVISRL 368

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/368 (85%), Positives = 339/368 (92%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MFR    + + RF ATKKQPSIGRYTGKP+P TGKYTVSFIEGDGVGPEISK+VK IF+A
Sbjct: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK PI+WE+CDV+P+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSI+G+KT Y+NV+LVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIRYAFEYARAV+R KVLVVHKSTIQRLADGLFV VA+KL+ EYPDIELQTEL+DNTVL
Sbjct: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
            TV+ P  Y DVVVVCPNLYGDILSD+NSGLSAGSLGLTPSANIGH VSIFEAVHGSAPD
Sbjct: 241 KTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAV +TIAS  +NRTGDL GSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360

Query: 361 AEAVISRL 368
            +AVI RL
Sbjct: 361 TDAVIERL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/369 (85%), Positives = 341/369 (92%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           M RSQ  R    RF ++KKQPSIGR+TGKP+P+TGKYTVSFIEGDGVGPEISK+VKDIFA
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA+ P++WE+CDVTPLFINGLTTIPQPA DSINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS++GFKT Y+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEYARAV RPKV+VVHKSTIQRLADGLFV VA++L+ EYPDI+LQ +L+DNTV
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L+ V +P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAGQNKANPTALLLSSVMMLNHMGL E AD IEKAV STIASGPENRT DLAGSASTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 360 FAEAVISRL 368
           F EAVI RL
Sbjct: 361 FTEAVIKRL 369

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/371 (82%), Positives = 341/371 (91%), Gaps = 3/371 (0%)

Query: 1   MFRSQFGRNTLRFF---ATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI 57
           M RSQ  R T+      AT KQPSIG+YTGKPDP TGKYTVSFIEGDGVGPEISK+VKDI
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 58  FAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTL 117
           FAAAK PI WE+C VTPL +NG+TTIP+ AQ+SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 118 RKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RKTFGLFANVRPAKS++GFKT Y++VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT++
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 178 ASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDN 237
           ASERVIRYA+EYARAV RPK++VVHKSTIQRLADGLFV+VA++LA E+PDI+LQTELIDN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 238 TVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGS 297
           TVL+ V +P KYSDVV VCPNLYGDILSD+NSGLSAGSLGLTPS NIGH+VSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAST 357
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA KIEKAV +TIA+GPE+RTGDLAGSAST
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 358 SSFAEAVISRL 368
           SSF EAVISRL
Sbjct: 361 SSFTEAVISRL 371

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/369 (82%), Positives = 339/369 (91%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           M R+ F RNT  RF AT KQPSIGRYTGKP+P+TGKYTVSFIEGDG+GPEISK+VK IF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA  PI+WE+CDV+P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSI+GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEYARA+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYPD+ L+TELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L  V +P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FAEAVISRL 368
           F EAVI RL
Sbjct: 361 FTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/369 (82%), Positives = 337/369 (91%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNTLR-FFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           MFR+   RNT R F + K QPSIG++TGKP+P+TGK+TVSFIEGDG+GPEIS++VK IF 
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AAK PI WE CDV+PLFINGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSI+GFKT YDNVDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYA+EYARA+ RP+V+VVHKSTIQRLADGLFV VA++L++EYPDI+L+TELIDNTV
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L+ V +P  YS+ V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAGQNKANPTALLLSSVMMLNHMGL  HADKIEKAV STIASGPE RTGDLAG A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 360 FAEAVISRL 368
           F +AVI RL
Sbjct: 361 FTDAVIGRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 337/369 (91%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           M R+ F RNT  RF AT KQPSIG+YTGKP+P+TGKYTVSFIEGDG+GPEISK+VK IF+
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA  PI+WE CDV P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS++GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEYARA+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYPDI L+TELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L  V +P  Y++ V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT +AD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 360 FAEAVISRL 368
           F EAVI RL
Sbjct: 361 FTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 335/369 (90%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           M R+ F RNT  RF +T KQPSIGRYTGKPDP+TG+YTVSFIEGDG+GPEISK+VK IF+
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA  PI WE CDV P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSI+GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT++AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEYARA+ RP+++VVHKSTIQRLADGLFV+VA++L+KEYPDI  +TELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L+ V +P  Y++ V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAG++KANPTALLLSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FAEAVISRL 368
           F EAVI RL
Sbjct: 361 FTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/370 (81%), Positives = 335/370 (90%), Gaps = 2/370 (0%)

Query: 1   MFRSQFGRNTLRFFAT--KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIF 58
           MF+    + + R+ A+  +KQPSIGR+TGKP+P TGKYTVSFIEGDG+GPEIS++VKDIF
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 59  AAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLR 118
           +AAK P++WE CDVTP+FINGLTTIP PA  SINKNL+ALKGPLATPIGKGHRSLNLTLR
Sbjct: 61  SAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLR 120

Query: 119 KTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           KTFGLFANVRPAKSI+GFKT Y+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DA
Sbjct: 121 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDA 180

Query: 179 SERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNT 238
           SERVIRYAFEYARAV RPKV+VVHKSTIQRLADGLFV+VA+++ KEYPDIELQ ELIDNT
Sbjct: 181 SERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNT 240

Query: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSA 298
           VL+ V  P KYSD V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH VSIFEAVHGSA
Sbjct: 241 VLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSA 300

Query: 299 PDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTS 358
           PDIAGQN ANPTALLLSSVMMLNHMGL EHAD+IE AV +T+AS  +NRT DLAG+A+TS
Sbjct: 301 PDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTS 360

Query: 359 SFAEAVISRL 368
           SF +AVI RL
Sbjct: 361 SFTKAVIERL 370

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 334/369 (90%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           M RS   RNT  RF AT KQPSIGR+TGKP+P+TG+YTVSFIEGDG+GPEISK+VK IF 
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA  PI+WE+CDV P+F+NGLTTIP  A  SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS++GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEYARA+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYPDI L+TELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L  V +P  Y++ V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FAEAVISRL 368
           F EAVI RL
Sbjct: 361 FTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/368 (80%), Positives = 330/368 (89%), Gaps = 1/368 (0%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           M R +  + + R+ A+ +QPSIGRY GKP+ A GKYTVSFIEGDGVGPEIS++VKDIF+A
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           A  P++WE CDVTPL +NGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSI+G+KT Y +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT++ASE
Sbjct: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIRYAFEYAR V RPKV+VVHKSTIQRLADGLFV+VA++L +EYPDIELQTEL+DNTVL
Sbjct: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           + V  P  Y DVV VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH+VSIFEAVHGSAPD
Sbjct: 240 NVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPD 299

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAV STIAS  ENRT DLAG+ASTSSF
Sbjct: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359

Query: 361 AEAVISRL 368
             AVI RL
Sbjct: 360 TNAVIERL 367

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 335/369 (90%), Gaps = 1/369 (0%)

Query: 1   MFRSQFGRNTLR-FFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59
           MFRS   R T R   + K QPSIG+YTGKP+P+TGKYTVSFIEGDG+GPEIS +VK IF+
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AAK PI+WETCDVTPLFI+GLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPA+S++GFKT Y NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT++AS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239
           ERVIRYAFEY RA+ RP+++VVHKSTIQRL+DGLFV+VA++L+KEYPDI+ +TELIDNTV
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299
           L  V +P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPS NIG+E+SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359
           DIAG+N ANPTALLLSSVMMLNHMGL++HAD+IE AV STIASGPE+RTGDLAG+A+TS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 360 FAEAVISRL 368
           F +AVI +L
Sbjct: 414 FTDAVIKKL 422

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/363 (80%), Positives = 329/363 (90%), Gaps = 1/363 (0%)

Query: 6   FGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPI 65
           F  N  RF AT  QPSIGR+TGKP+P+TGK+TVSFIEGDG+GPEIS +VK IF AA  P+
Sbjct: 7   FRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPV 65

Query: 66  QWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFA 125
           +WETCDVTP+F+NGLTTIP PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKTF LFA
Sbjct: 66  EWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFA 125

Query: 126 NVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRY 185
           NVRPAKSI+GFKT Y+NVDLVLIRENTEGEYSGIEH+V+PGVVQSIKLIT+DASERVIRY
Sbjct: 126 NVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRY 185

Query: 186 AFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRD 245
           A+EYARA+ RP+++VVHKSTIQRLADGLFV+VA++LA EYPDI+L+TELIDNT L+ V +
Sbjct: 186 AYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSN 245

Query: 246 PLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQN 305
           P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIGH+VSIFEAVHGSAPDIAGQN
Sbjct: 246 PSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQN 305

Query: 306 KANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVI 365
           KANPTALLLSSVMMLNHMG+TEHAD+IEKAV  TIA G E RTGDL GSAST+SF +A+I
Sbjct: 306 KANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAII 365

Query: 366 SRL 368
            +L
Sbjct: 366 KKL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/373 (79%), Positives = 333/373 (89%), Gaps = 5/373 (1%)

Query: 1   MFRSQFGRNTL---RFFAT--KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVK 55
           M R+   RN+    RF AT  K QPSIGR+TGKP+PATGK+ VSFIEGDG+GPEIS++VK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 56  DIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNL 115
           DIF AA+ PI WE CDVTP+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
           TLRKTF LFANVRPAKSI+GFKT Y +VDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 176 QDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELI 235
           +DASERVIRYAFEYA+A+ RP+V+VVHKSTIQRLADGLFV+VA++L+KEYP+I+L+TELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 236 DNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVH 295
           DNTVL+ V +P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIG+E+SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSA 355
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AV +TIAS  +NRTGDL GSA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 356 STSSFAEAVISRL 368
           +TSSF +AVI  L
Sbjct: 361 TTSSFTDAVIKNL 373

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/368 (78%), Positives = 325/368 (88%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           M R+   R +     T  QP+IGR+TGKP+P TGKYTV FIEGDGVGPEISK+VKDIFAA
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK PI+WE CDV P+F+NGLTTIP  A  SINK+L+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           F LFANVRPA+S+  +KT Y NVDLVLIRENTEGEYSGIEHV++PGV+QSIKLIT+DASE
Sbjct: 121 FNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIRYAFEY RA+ RP+++VVHKSTIQR+ADGLFV+VA++LA EYPDIELQTELIDNT+L
Sbjct: 181 RVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTIL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           + V  P  Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIG +VSIFEAVHGSAPD
Sbjct: 241 NVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGL EHA KIE A+ STIASG ENRTGDLAG+A+TSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSF 360

Query: 361 AEAVISRL 368
            EAVI++L
Sbjct: 361 TEAVINKL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/368 (76%), Positives = 328/368 (89%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MF+SQ  R  +    + KQPSIG++TGKPDP TG Y VSFIEGDG+GPEISK+VKDIFAA
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK P+ +E+  V P+ +NG+T+IP+ AQ SIN NL+ALKGPLATP+GKGHRS+NLTLRKT
Sbjct: 61  AKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFAN+RPAKS++GFKT YDNV+LVLIRENTEGEY+GIEH + PGVVQSIKLIT++ASE
Sbjct: 121 FGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RVIR+A+EYARA ERP+++VVHKSTIQRL+DGLFV VA++L  E+PDI+L+TELIDN VL
Sbjct: 181 RVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAVL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           +TV DP KYSD V VCPNLYGDILSDMNSGLSAGSLGLTPS NIGH+VSIFEAVHGSAPD
Sbjct: 241 NTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAG++KANPTALLLSSVMML+HMGL EHA +IEKAV +TIA+GPE+RTGDL GSASTSSF
Sbjct: 301 IAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSF 360

Query: 361 AEAVISRL 368
            EAVI +L
Sbjct: 361 TEAVIKKL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/370 (77%), Positives = 325/370 (87%), Gaps = 4/370 (1%)

Query: 3   RSQFGRNTLRFFATK--KQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           R+++   T RF + +  +QPSIGR+TGKPD ATGKYTVSFIEGDG+GPEIS++VKDIF A
Sbjct: 9   RARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQA 68

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           A  PI WETCDV+P+ ++GLTTIP  A  SINKNL+ LKGPLATPIGKGHRSLNLTLRKT
Sbjct: 69  ASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKT 128

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           F LFANVRPAKS++GFKT YDNVDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT+DASE
Sbjct: 129 FNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASE 188

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKE--YPDIELQTELIDNT 238
           RVIRYAFEYA+A+ RPKV+VVHKSTIQRL+DGLFV+VA++L KE  + +IEL TELIDNT
Sbjct: 189 RVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNT 248

Query: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSA 298
           VL+ V +P KYSD V VCPNLYGDILSD+NSGLSAGSLGLTPSANIG ++SIFEAVHGSA
Sbjct: 249 VLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSA 308

Query: 299 PDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTS 358
           PDIAGQNKANPTALLLSSVMML+HMGL E+ DKIE AV  TIA+  +NRTGDL G+A+T+
Sbjct: 309 PDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTT 368

Query: 359 SFAEAVISRL 368
           SF EAVI  L
Sbjct: 369 SFTEAVIDNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/368 (75%), Positives = 322/368 (87%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MF S+    T+  F +  QPSIGR+TGKPDPATGK+TV FIEGDGVGPEIS++VK IF+A
Sbjct: 1   MFNSRLQLRTVSRFLSTGQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSA 60

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK PI+W  CDV P+F+NG TTIP+PA + INK+LIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           F LFANVRPA+SI  +K+ Y+NVDLVLIRENTEGEYSGIEHV+ PGV+QSIKLIT++A+E
Sbjct: 121 FNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATE 180

Query: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240
           RV+RYAFEY +A+ RP++LV+HKSTIQR+ADGLFV VAE+LA EYPDI+L+TE+ID ++L
Sbjct: 181 RVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSIL 240

Query: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300
           + V  P  YSD V VCPNLYGDILSD+NSGLSAGSLGLTPSANIG +VSIFEAVHGSAPD
Sbjct: 241 NVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360
           IAGQNKANPTALLLSSVMML HMGL EHA+KIE AV +TIASG ENRT DL+G+ASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSF 360

Query: 361 AEAVISRL 368
            E VI RL
Sbjct: 361 TEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/361 (76%), Positives = 322/361 (89%), Gaps = 4/361 (1%)

Query: 12  RFFAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQW 67
           R F+T    +    +G+Y G P+P+TG++TV FIEGDGVGPEISK+VKDIF AA+ P+ W
Sbjct: 13  RLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDW 72

Query: 68  ETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 127
           E CDV+PL INGLTTIP+PA   INK+ IALKGPLATPIGKGHRSLNLTLRKTFGLFANV
Sbjct: 73  EYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 132

Query: 128 RPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAF 187
           RPA+SI+G++T Y NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT+DASERVIRYA+
Sbjct: 133 RPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAY 192

Query: 188 EYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPL 247
           EYARA+ RP+++VVHKSTIQ+LADGLFV++A++LA E+PDI+L+TELIDNTVL+ VRDP 
Sbjct: 193 EYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPP 252

Query: 248 KYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKA 307
            Y+D V VCPNLYGDILSD+NSGLSAGSLGLTPSANIG+EVSIFEAVHGSAPDIAGQNKA
Sbjct: 253 SYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKA 312

Query: 308 NPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISR 367
           NPTALLLSS MMLN+MGL  +++KIE A+ +TIASG ENRTGDLAG+A+TSSF E+VI  
Sbjct: 313 NPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKN 372

Query: 368 L 368
           L
Sbjct: 373 L 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/350 (76%), Positives = 310/350 (88%), Gaps = 1/350 (0%)

Query: 19  QPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFIN 78
           QP+IGR+TGK + ++G YTV FIEGDGVGPEISK+VKDIF+AA  PIQW+ CDV P+F+N
Sbjct: 28  QPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 79  GLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIQGFKT 138
           GLTTIP+PA  +I ++L+ALKGPLATP+GKGHRSLNLTLRKTF LFANVRPAKS+  +K+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 139 AYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKV 198
            Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT++ASE+VIRYA+EYA AV RP++
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 199 LVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPN 258
           +VVHKSTIQRL DGLFV +A +L  EYP I+L+T+++DNTVL+ V +P  Y D V VCPN
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPN 266

Query: 259 LYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318
           LYGDILSD+NSGLSAGSLGLTPSANIG +VSIFEAVHGSAPDIAGQNKANPTALLLSSVM
Sbjct: 267 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 326

Query: 319 MLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           MLNHMGL EHA +IE AV STIASGPE+RTGDL GSA+TSSF E VI +L
Sbjct: 327 MLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/359 (70%), Positives = 296/359 (82%), Gaps = 2/359 (0%)

Query: 11  LRFFATK-KQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWET 69
           LR+F T   + SIG + GKP+P TG YTV FIEGDGVGPEISK+V+ IF AAK PI W  
Sbjct: 19  LRYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVN 78

Query: 70  CDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRP 129
           CD+ PL ING TTIPQ A D IN +LIALKGPLATP+G+GHRS+NLTLRKTFGLFANVRP
Sbjct: 79  CDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRP 138

Query: 130 AKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEY 189
           AKSI    + Y+NVDL++IRENTEGEYSGIEH + PGVVQSIKLIT+ ASE+VI+YAFEY
Sbjct: 139 AKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEY 198

Query: 190 ARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKY 249
            R++ R  ++VVHK+TIQR  DGLFV  A+++A +YPD+ L+ ELIDNTVL+ + +P KY
Sbjct: 199 TRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKY 258

Query: 250 SDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANP 309
           +D V VCPNLYGDILSD+NSGLS GSLGLTPSANIG  V ++EAVHGSAPDIAGQ+KANP
Sbjct: 259 ADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANP 317

Query: 310 TALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           TALLLSSVMMLNHMGL ++AD IE AV +TI SG E RT DL GSA+T+SF +AVI  L
Sbjct: 318 TALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  293 bits (751), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 162/364 (44%), Positives = 228/364 (62%), Gaps = 10/364 (2%)

Query: 8   RNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQW 67
           RNTL    TK+  + GR    P    G+YTV+ I GDG+G E++ +V  IF A   P+ W
Sbjct: 3   RNTLSHI-TKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDW 61

Query: 68  ETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFAN 126
           E+ +++ L  N      Q A +S+ +N + LKG   TP  + GH SLN+  RK   +FAN
Sbjct: 62  ESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFAN 119

Query: 127 VRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYA 186
           V   KS  G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+A
Sbjct: 120 VALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFA 179

Query: 187 FEYARAVERPKVLVVHKSTIQRLADGLFV-SVAEKLAKEYPDIELQTELIDNTVLHTVRD 245
           F++A    R  V  VHK+ I +L DGLF  +V+E  AKEYP++ + + ++DN  +  V  
Sbjct: 180 FDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAK 239

Query: 246 PLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQ 304
           P ++   V+V PNLYG IL ++ + L  G  GL P AN G E ++FE        DI GQ
Sbjct: 240 PHQFD--VLVTPNLYGSILGNIGAALIGGP-GLVPGANFGREYAVFEPGCRHVGLDIKGQ 296

Query: 305 NKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAV 364
           + ANPTA++LSS +ML H+GL E+AD+I +A + TIA G +  T D+ G+A+T+ F  AV
Sbjct: 297 DVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEG-KRTTKDIGGTATTTEFTNAV 355

Query: 365 ISRL 368
           I +L
Sbjct: 356 IDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  291 bits (746), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 218/343 (63%), Gaps = 10/343 (2%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQ 88
           P    G+YTV+ I GDGVG E++ +V  IF     PI WET D++ L     T   Q A 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 89  DSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147
           +S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   KSI G KT  +N+D+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 148 IRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTIQ 207
           IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 208 RLADGLFVSVAEKL-AKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSD 266
           +L DGLF +   ++ A EYP+++++  ++DN  +  V  P ++   V+V PNLYG IL +
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSILGN 257

Query: 267 MNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 325
           + S L  G  GL P AN G E ++FE        DI GQN ANPTA++LSS +ML H+GL
Sbjct: 258 IGSALIGGP-GLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 326 TEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
             +AD+I KA +  I+ G ++ T D+ GSASTS F  AVI +L
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  290 bits (741), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 232/371 (62%), Gaps = 15/371 (4%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           M R+ F + + R FA      +      P    G+YTV+ I GDGVG E++ +V +IF A
Sbjct: 1   MLRNTFVQISKRRFALASGQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEA 54

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGK-GHRSLNLTLRK 119
              PI WE+ +++ L  N      Q A +S+ +N + LKG  +TP  + GH SLN+  RK
Sbjct: 55  ENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFRK 112

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              +FANV   KS  G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  S
Sbjct: 113 QLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKS 172

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKL-AKEYPDIELQTELIDNT 238
           ER+ R+AF++A    R  V  VHK+ I +L DGLF +   ++ AKEYP++E+++ ++DN 
Sbjct: 173 ERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDNA 232

Query: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGS 297
            +  V  P ++   V+V PNLYG IL ++ + L  GS GL P AN G E ++FE      
Sbjct: 233 SMQAVAKPHQFD--VLVTPNLYGSILGNVGAAL-IGSPGLVPGANFGREYAVFEPGSRHV 289

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAST 357
             DI GQ+ ANPTA++LSS +ML H+GL ++AD+I KA +  IA G ++ T D+ G AST
Sbjct: 290 GLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEG-KHTTKDIGGHAST 348

Query: 358 SSFAEAVISRL 368
           + F +A++ +L
Sbjct: 349 TQFTKAIVDKL 359

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  288 bits (738), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 164/373 (43%), Positives = 230/373 (61%), Gaps = 21/373 (5%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           M R+ FG +  R  AT  +  +      P    G+YTV+ I GDGVG E++ +V  IF +
Sbjct: 1   MLRNGFGISK-RSLATVAEQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES 53

Query: 61  AKAPIQWETCDVTPLFINGLTTIP--QPAQDSINKNLIALKGPLATPIGK-GHRSLNLTL 117
              PI WET +     I+GL      Q A DS+ +N + LKG   TP  + GH SLN+ L
Sbjct: 54  ENVPIDWETVE-----ISGLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVAL 108

Query: 118 RKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RK   +FANV   K++ G  + + NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+ 
Sbjct: 109 RKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTKA 168

Query: 178 ASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKL-AKEYPDIELQTELID 236
            S+R+ R+AF++A    R  V  VHK+ I +L DGLF +   ++ AKEYP+IE++  ++D
Sbjct: 169 KSDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIVD 228

Query: 237 NTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVH 295
           N  +  V  P ++   V+V PNLYG IL ++ + L  G  GL P AN G E ++FE    
Sbjct: 229 NASMQAVAKPHQFD--VLVTPNLYGSILGNIGAALIGGP-GLVPGANFGREFAVFEPGSR 285

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSA 355
               DI GQN ANPTA++LSS +ML H+GL  +AD+I KA +  IA   +N T D+ GSA
Sbjct: 286 HVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEA-KNTTKDIGGSA 344

Query: 356 STSSFAEAVISRL 368
           ST+ F +A+I +L
Sbjct: 345 STTDFTQAIIEKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  285 bits (730), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 158/345 (45%), Positives = 219/345 (63%), Gaps = 14/345 (4%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIP--QP 86
           P    G+YTV+ I GDGVG E++ +V  IF +   PI WET +     I+GL      Q 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVE-----ISGLDNQEGVQK 77

Query: 87  AQDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDL 145
           A +S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   KS+ G  + + NVD+
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 146 VLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKST 205
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 206 IQRLADGLFVS-VAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDIL 264
           I +L DGLF + + E  AKEYP+I+++  ++DN  +  V  P ++   V+V PNLYG IL
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSIL 255

Query: 265 SDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 323
            ++ + L  G  GL P AN G E ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 256 GNIGAALIGGP-GLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 324 GLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           GL  +AD+I KA +  IA   +  T D+ GSAST+ F EA+IS+L
Sbjct: 315 GLNAYADRISKATYDVIAEA-KTTTQDIGGSASTTEFTEAIISKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  285 bits (728), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 163/375 (43%), Positives = 231/375 (61%), Gaps = 24/375 (6%)

Query: 1   MFRSQFG--RNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIF 58
           MFR+ F   + +L   AT++          P    G+YTV+ I GDGVG E++ +V  IF
Sbjct: 1   MFRNTFAVSKRSLATVATEQLL--------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIF 52

Query: 59  AAAKAPIQWETCDVTPLFINGLTTIP--QPAQDSINKNLIALKGPLATPIGK-GHRSLNL 115
            A   PI WET ++T     G+ +    Q A +S+ +N I LKG   TP  + GH SLN+
Sbjct: 53  EAENVPIDWETINIT-----GVDSEEGVQKAVESLKRNKIGLKGIWHTPADQTGHGSLNV 107

Query: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
             RK   +FANV   K++ G KT   N+DLV+IRENTEGEYSG+EH   PGVV+S+K+IT
Sbjct: 108 AFRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIIT 167

Query: 176 QDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFV-SVAEKLAKEYPDIELQTEL 234
           +  SER+ R+AF++A    R  V  VHK+ I +L DGLF  +V E  A EYP+I+++  +
Sbjct: 168 KAKSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNII 227

Query: 235 IDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-A 293
           +DN  +  V  P ++   V+V PNLYG IL ++ + L  G  GL P AN G E ++FE  
Sbjct: 228 VDNASMQAVAKPHQFD--VLVTPNLYGSILGNIGAALIGGP-GLVPGANFGREYAVFEPG 284

Query: 294 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAG 353
                 DI G++ ANPTA++LSS +ML H+GL  +AD+I KA +  IA G ++ T D+ G
Sbjct: 285 SRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEG-KHTTKDIGG 343

Query: 354 SASTSSFAEAVISRL 368
           S+ST+ F ++VI +L
Sbjct: 344 SSSTTEFTKSVIDKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  283 bits (725), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 237/372 (63%), Gaps = 18/372 (4%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MFR    + TL   AT ++    +Y G+       YTV+ I GDGVG E++ +V  IF A
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGR-------YTVTLIPGDGVGKEVTDSVVSIFKA 53

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLAT-PIGK-GHRSLNLTLR 118
              P+ W+  D++ +         + A +S+ +N I LKG   T P  + GH SLN+ LR
Sbjct: 54  ENVPVDWDRVDISGV---DRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVALR 110

Query: 119 KTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KSI G +    +VDLV+IRENTEGE+SG+EH   PGVV+S+K++TQD 
Sbjct: 111 KELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQDN 170

Query: 179 SERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLA-KEYPDIELQTELIDN 237
            ER+ R+AF+YA+  +R +V+ VHK+ I ++ DGLF ++ +++  KEYP++++   ++DN
Sbjct: 171 IERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIVDN 230

Query: 238 TVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHG 296
             + TV +P ++   V+V P++YG IL ++ + L  G  GL   AN G +V++FE     
Sbjct: 231 ASMQTVANPHQFD--VLVTPSMYGTILGNIGAALIGGP-GLVAGANYGRDVALFEPGSRH 287

Query: 297 SAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAS 356
              DI GQN ANPTA++LSSV++LNH+GL   AD+I KAV + IA G ++ T D+ G+AS
Sbjct: 288 VGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG-KSVTRDIGGTAS 346

Query: 357 TSSFAEAVISRL 368
           T+ F EAVI++L
Sbjct: 347 TTEFTEAVINKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  283 bits (723), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 220/343 (64%), Gaps = 10/343 (2%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQ 88
           P    G++TV+ + GDGVG EI+ +V  IF +   PI WET D++ L     T   + A 
Sbjct: 21  PKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGL---DHTEGVKAAV 77

Query: 89  DSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147
           DS+ +N I LKG   TP  + GH SLN+  RK   ++ANV   KSI+G KT   NVDLV+
Sbjct: 78  DSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 148 IRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTIQ 207
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANIM 197

Query: 208 RLADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSD 266
           +L+DGLF +   K+  +EYP+I+  + ++DN  +  V  P ++   V+V P++YG I+ +
Sbjct: 198 KLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTIVGN 255

Query: 267 MNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 325
           + + L  G  GL P  N G + ++FE        DI GQN ANPTA+LLS+ ++L+H+GL
Sbjct: 256 IGAALIGGP-GLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGL 314

Query: 326 TEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
            + A++I+ AV+  IA G    T D+ GSAST+ F +AVI++L
Sbjct: 315 EKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFTQAVINKL 356

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  281 bits (720), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 151/344 (43%), Positives = 223/344 (64%), Gaps = 12/344 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPL-FINGLTTIPQPA 87
           P    G++TV+ I GDGVG EI+ +VK IF A K P+ WET ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQTDHKEGV----YEA 77

Query: 88  QDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLV 146
            +S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTI 206
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 207 QRLADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILS 265
            +L DGLF ++  ++  KEYPDI++ + ++DN  +  V  P ++   V+V P++YG IL 
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTILG 255

Query: 266 DMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 324
           ++ + L  G  GL   AN G + ++FE        DI GQN ANPTA++LSSV+MLNH+G
Sbjct: 256 NIGAALIGGP-GLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLG 314

Query: 325 LTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           L E+A +I KAV  TIA G ++ T D+ GS+ST+ F   +I++L
Sbjct: 315 LNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  278 bits (710), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 223/344 (64%), Gaps = 12/344 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPL-FINGLTTIPQPA 87
           P    G++TV+ I GDGVG EI+ +V+ IF A + P+ WET ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQTDHKEGV----YEA 77

Query: 88  QDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLV 146
            +S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTI 206
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 207 QRLADGLFVSVAEKLAK-EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILS 265
            +L DGLF ++  ++ + EYPDI++ + ++DN  +  V  P ++   V+V P++YG IL 
Sbjct: 198 MKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTILG 255

Query: 266 DMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 324
           ++ + L  G  GL   AN G + ++FE        DI GQN ANPTA++LSSV+MLNH+G
Sbjct: 256 NIGAALIGGP-GLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLG 314

Query: 325 LTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           L E+A +I KAV  TIA G ++ T D+ GS+ST+ F   VI++L
Sbjct: 315 LNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEVINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  277 bits (708), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 221/344 (64%), Gaps = 12/344 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPL-FINGLTTIPQPA 87
           P    G++TV+ I GDGVG EI+ +V+ IF A   PI WET ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGV----YEA 77

Query: 88  QDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLV 146
            +S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTI 206
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANI 197

Query: 207 QRLADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILS 265
            +L DGLF ++  ++  KEYPDI++ + ++DN  +  V  P ++   V+V P++YG IL 
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTILG 255

Query: 266 DMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 324
           ++ + L  G  GL   AN G + ++FE        DI GQN ANPTA++LSS +MLNH+G
Sbjct: 256 NIGAALIGGP-GLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLG 314

Query: 325 LTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           L E+A +I KAV  TIA G ++ T D+ GS+ST+ F   +I++L
Sbjct: 315 LNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 357

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  276 bits (707), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 218/344 (63%), Gaps = 12/344 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPL-FINGLTTIPQPA 87
           P    G+YTV+ I GDGVG E++ +V  IF A   PI WE  D++ L    G+    + A
Sbjct: 27  PKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWERVDISGLDHEEGV----EAA 82

Query: 88  QDSINKNLIALKGPLATPIGKG-HRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLV 146
            +S+ +N I LKG   T  G+  H SLN+ LRK   ++ANV   K++ G KT   +VDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTI 206
           +IRENTEGEYSG+EH   PGVV+S+K+IT++ SER+ R+AF++A+  +R  V  VHK+ I
Sbjct: 143 IIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANI 202

Query: 207 QRLADGLFVSVAEKLAK-EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILS 265
            +L DGLF +    + + EYPDI++ + ++DN  + +V  P ++   V+V P++YG IL 
Sbjct: 203 MKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQFD--VLVTPSMYGTILG 260

Query: 266 DMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 324
           ++ + L  G  GL P AN G E ++FE        DI GQN ANPTA++LSS ++L H+G
Sbjct: 261 NIGAALIGGP-GLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLG 319

Query: 325 LTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           L   A KIE AV+ TIA G +  T D+ GSAST+ F   +I +L
Sbjct: 320 LNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFTNEIIKKL 362

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  274 bits (701), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 222/371 (59%), Gaps = 18/371 (4%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MFR    + TL  F  K+       T  P    G+ TV+ + GDGVG EI+ +V  IF A
Sbjct: 1   MFRQTIAKRTLATFIPKE-------TILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQA 53

Query: 61  AKAPIQWETCDVTPL-FINGLTTIPQPAQDSINKNLIALKGPLATPIGK-GHRSLNLTLR 118
              PI WET D++ L   +G+      A +S+ +N I LKG   T   + GH SLN+  R
Sbjct: 54  ENVPIDWETVDISQLDHEDGVNA----AVESLKRNKIGLKGIWHTSADQVGHGSLNVAFR 109

Query: 119 KTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KSI G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVN 169

Query: 179 SERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNT 238
           SER+ ++AF++A   +R  V  VHK+ I +L+DGLF +   ++ + YP I+  + ++DN 
Sbjct: 170 SERIAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNA 229

Query: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGS 297
            +  V  P ++   V+V P++YG IL ++ + L  G  GL P  N G E ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVTPSMYGTILGNIGAALIGGP-GLVPGVNYGREYAVFEPGSRHV 286

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAST 357
             DI GQN ANPTA++LSS ++L H+GL + A +I KAV+  I  G    T D+ G+AST
Sbjct: 287 GLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEGNAT-TKDIGGNAST 345

Query: 358 SSFAEAVISRL 368
           + F +AVI +L
Sbjct: 346 TEFTKAVIDKL 356

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  271 bits (694), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 154/343 (44%), Positives = 217/343 (63%), Gaps = 10/343 (2%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQ 88
           P    G+YTV+ I GDG+G E++ +V  IFA+   PI WE  DV P   N      + A 
Sbjct: 22  PKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV-PGMSN--ENEVKKAV 78

Query: 89  DSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147
           +S+ +N I LKG   T   + G+ SLN+ LRK   +FANV   KS++G KT   +VDLV+
Sbjct: 79  ESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVV 138

Query: 148 IRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTIQ 207
           IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++A    R  V  VHK+ I 
Sbjct: 139 IRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALENNRSTVTAVHKANIM 198

Query: 208 RLADGLFV-SVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSD 266
           +L+DGLF  +VAE   KEYPDI++ T ++DN  +  V  P ++   V+V P++YG IL +
Sbjct: 199 KLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQFD--VMVTPSMYGTILGN 256

Query: 267 MNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 325
           + + L  G  GL P AN G E ++FE        DI  QN ANPTA++LS+ +MLN +GL
Sbjct: 257 IGAALIGGP-GLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGL 315

Query: 326 TEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
            E + +I  AV++ I  G +  T D+ G+AST+ F +AVI +L
Sbjct: 316 REESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  270 bits (689), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 212/343 (61%), Gaps = 10/343 (2%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQ 88
           P    G+YTV+ I GDGVG EI+ +V  IF A   P+ WE  D++    + +  + Q A 
Sbjct: 20  PKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDISTS--DNIQDVSQ-AV 76

Query: 89  DSINKNLIALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147
           +S+ +N I LKG   T      H S N+ LRK   +FA+V   KS+ G KT   NVDLV+
Sbjct: 77  ESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVV 136

Query: 148 IRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTIQ 207
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I 
Sbjct: 137 IRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKANIM 196

Query: 208 RLADGLFV-SVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSD 266
           ++ DGLF  +V E  A EYPDI+  + ++DN  +  V  P ++   V+V P++YG I+ +
Sbjct: 197 KMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTIIGN 254

Query: 267 MNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 325
           + + L  G  GL   A+ G E ++FE        DI G+N ANPTA++LSS +ML H+GL
Sbjct: 255 IGAALIGGP-GLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGL 313

Query: 326 TEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           TE A +I KA    I+ G +  T D+ GSAST+ F EA+I RL
Sbjct: 314 TESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFTEAIIKRL 355

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  269 bits (687), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 157/375 (41%), Positives = 227/375 (60%), Gaps = 24/375 (6%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           M RS  G+      A  ++    +Y G+       + V+ I GDGVG E++ +V  IF A
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGR-------FVVTLIPGDGVGKEVTDSVVSIFEA 53

Query: 61  AKAPIQWETCDVTPL-FINGLTTIPQPAQDSINKNLIALKG----PLATPIGKGHRSLNL 115
              PI W+  D++ L    G+    Q A DS+ +N I LKG      A   GKG  SLN+
Sbjct: 54  ENLPIDWDRVDISGLDHEEGV----QAAVDSLKRNKIGLKGIWHTSAADQAGKG--SLNV 107

Query: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
            LRK   ++ANV   KS+ G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T
Sbjct: 108 ALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMT 167

Query: 176 QDASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLA-KEYPDIELQTEL 234
           +D +ER+ R+AF++A+   R  V  VHK+ I +L DGLF +V  ++  +EYPD+++ + +
Sbjct: 168 EDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDVKVGSII 227

Query: 235 IDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-A 293
           +DN  + TV  P ++   V+V P++YG IL ++ + L  G  GL   AN G E ++FE  
Sbjct: 228 VDNASMQTVAKPHQFD--VLVTPSMYGTILGNIGAALIGGP-GLVAGANYGREYAVFEPG 284

Query: 294 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAG 353
                 DI  +N ANPTA++LS+ +ML+H+GL+  A KI  AV   IA G ++ T D+ G
Sbjct: 285 SRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEG-KSTTPDIGG 343

Query: 354 SASTSSFAEAVISRL 368
           SAST+ F +AVI +L
Sbjct: 344 SASTTEFTQAVIEKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  265 bits (676), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 218/371 (58%), Gaps = 18/371 (4%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60
           MFR+   +      A+++          P    G+YTV+ + GDGVG EI+ +V  IF A
Sbjct: 1   MFRNLISKRAFTSIASRENII-------PKKYGGRYTVTLLPGDGVGREITDSVVSIFEA 53

Query: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGK-GHRSLNLTLRK 119
              PI WE  +++ L    + T    A +S+ +N I LKG   T     GH S N+ LRK
Sbjct: 54  ENLPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRK 109

Query: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              ++ANV   KS +G  T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T   +
Sbjct: 110 ELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKT 169

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVS-VAEKLAKEYPDIELQTELIDNT 238
           ER+ R+AF+YA    R  V  VHK+ I +L DGLF + V E  AKEYP++ + + ++DN 
Sbjct: 170 ERIARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNA 229

Query: 239 VLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGS 297
            +  V  P ++   V+V P++YG IL ++ + L  G  GL P AN G + ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVAPSMYGTILGNIGAALIGGP-GLVPGANYGRDYAVFEPGSRHV 286

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAST 357
             DI  QN ANPTA++LS+ +MLNH+G    A +I KAV   IA G +  T D+ GSA+T
Sbjct: 287 GLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEG-KTTTRDIGGSATT 345

Query: 358 SSFAEAVISRL 368
           + F  AVI++L
Sbjct: 346 TEFTNAVIAKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  261 bits (666), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 152/363 (41%), Positives = 214/363 (58%), Gaps = 13/363 (3%)

Query: 11  LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETC 70
           LR   +K+  +    T  P+   G+YTV+ + GDGVG E + +V  +F A   PI WE  
Sbjct: 2   LRRLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIV 61

Query: 71  DVTPL-FINGLTTIPQPAQDSINKNLIALKGPLATPIG--KGHRSLNLTLRKTFGLFANV 127
           +++ L    G+    Q    S+ +N I LKG   T      GH SLN+  RK   ++ANV
Sbjct: 62  NISGLDHKEGVAAAVQ----SLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANV 117

Query: 128 RPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAF 187
              KS++G KT   +VDLV+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF
Sbjct: 118 AVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAF 177

Query: 188 EYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDP 246
            YA+   R  V  VHK+ I +L DGLF +    +  KEYPDIE  + ++DN  +  V  P
Sbjct: 178 NYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKP 237

Query: 247 LKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQN 305
            ++   V+V P++YG I+ ++ + L  G  GL   AN G E ++FE        DI GQN
Sbjct: 238 HQFD--VLVTPSMYGTIIGNIGAALIGGP-GLVAGANFGREYAVFEPGSRHVGLDIKGQN 294

Query: 306 KANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVI 365
            ANPTA+LLSS +MLNH+GLT+   +I  AV   IA G + RT D+ G A+T+ F +AVI
Sbjct: 295 IANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVI 353

Query: 366 SRL 368
            +L
Sbjct: 354 EKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  250 bits (639), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 142/342 (41%), Positives = 208/342 (60%), Gaps = 13/342 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQ 88
           P    G++ ++ I G+G+G E++ +V+ IF A   PI WE  ++     +G+ T    A 
Sbjct: 16  PKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLPIDWEIVNIES-HRDGIKT----AV 70

Query: 89  DSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
           DSI +N IALKG  ++    G  SLN+ LRK   +FANV   KS     T   NVDLV+I
Sbjct: 71  DSIKRNKIALKGIWSSDPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVI 128

Query: 149 RENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTIQR 208
           RENTEGE+SG+EH    GVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I +
Sbjct: 129 RENTEGEFSGLEHESVDGVVESLKIVTKPKTERIARFAFDFAKKHNRNHVTAVHKANIMK 188

Query: 209 LADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDM 267
           L DGLF ++   +   EYP+I+  + ++DN  +  V  P ++   V+V P++YG IL ++
Sbjct: 189 LGDGLFKNIVAHIGNNEYPEIKNSSIIVDNASMQAVAKPHQFD--VLVSPSMYGTILGNI 246

Query: 268 NSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLT 326
            + L  G  GL P AN G + ++FE        DI GQN ANPTA++LS+  ML H+GLT
Sbjct: 247 GAALIGGP-GLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLT 305

Query: 327 EHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
             A++I  AV   IA G    T D+ G+AST+ F +AVI+ L
Sbjct: 306 SPAERITNAVKHVIAQG-TTVTKDIGGTASTTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  221 bits (562), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 120/286 (41%), Positives = 178/286 (62%), Gaps = 11/286 (3%)

Query: 29  PDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQWETCDVTPL-FINGLTTIPQPA 87
           P    G++TV+ I GDGVG E++ +VK IF A   PI WET ++       G+      A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQTDHKEGV----NEA 77

Query: 88  QDSINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLV 146
            +S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKVLVVHKSTI 206
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 207 QRLADGLFVSVAEKLA-KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILS 265
            +L DGLF ++  ++  KEYPDI++ + ++DN  +  V  P ++   V+V P++YG IL 
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTILG 255

Query: 266 DMNSGLSAGSLGLTPSANIGHEVSIFE-AVHGSAPDIAGQNKANPT 310
           ++ + L  G  GL   AN G + ++FE        DI GQN ANPT
Sbjct: 256 NIGAALIGGP-GLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 203/389 (52%), Gaps = 42/389 (10%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59
           M RS   +   R +A+  +P                T+  I GDG+G E+  A K +   
Sbjct: 1   MLRSTVSQFARRSYASAAKP---------------LTIGLIPGDGIGKEVIPAGKLVLEN 45

Query: 60  -AAKAPIQWETCDVTP---LFINGLTTIPQPAQDSINKNLI-ALKGPLATPIGK--GHRS 112
            ++K  +++   D+      F++    +P    + +  +   AL G + +P  K  G+ S
Sbjct: 46  LSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSS 105

Query: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEHVVAPGV 167
             + LRK  GL+ANVRP KS+QG  T    VD++++RENTE  Y     + I+      V
Sbjct: 106 PIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRV 163

Query: 168 VQSIKLITQDASERVIRYAFEYA----RAVERPKVLVVHKSTIQRLADGLFVSVAEKL-- 221
            ++IK I++ A+  + + A E +    +A  +  + V HKS +   +DGLF  V + +  
Sbjct: 164 AEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYE 223

Query: 222 --AKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLT 279
              + Y  I    +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ 
Sbjct: 224 SNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 280

Query: 280 PSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFST 339
           PSAN+GH+  + E  HGSAPDIAG+  +NP A + S+ +ML  MG TE A  I KAV + 
Sbjct: 281 PSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTN 340

Query: 340 IASGPENRTGDLAGSASTSSFAEAVISRL 368
           I    + +T DL G ++T    + ++S++
Sbjct: 341 IREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTP---LFINGLTTIPQPAQDSI 91
           T+  I GDG+G E+  A K +      K  + +E  D+      F++    +P+   D +
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K+++G  T    +DLV++
Sbjct: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140

Query: 149 RENTEGEYSGIEHVV-----APGVVQSIKLITQDASERVIRYAFEYARAVERPK----VL 199
           RENTE  Y  IE           + ++ K IT+ A++R+ + A + A    + K    + 
Sbjct: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200

Query: 200 VVHKSTIQRLADGLFVSVAEKLAKE----YPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
           V HKS +   +DGLF  V +++ +     Y  +    +++D+ V    R+P  +   V+V
Sbjct: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           +  ML ++G +  A  I KAV + I    + +T DL G ++T    + ++ +L
Sbjct: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  178 bits (452), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 198/395 (50%), Gaps = 54/395 (13%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI--- 57
           M R++F + + R +A+  +                 T+  I GDG+G E+  A K I   
Sbjct: 1   MMRTRFIQLSRRAYASNAK---------------NLTIGLIPGDGIGKEVIPAGKKILES 45

Query: 58  --------FAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSI-NKNLIALKGPLATPIGK 108
                   F        WET      F N    +P    D + N+   AL G + +P  K
Sbjct: 46  LNPKYGLSFKFIDLQAGWET------FQNTGKALPDETIDILKNQCEGALFGAVQSPTTK 99

Query: 109 --GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEH 161
             G+ S  + LRK  GLFANVRP KS+ G K     VDLV++RENTE  Y     S I+ 
Sbjct: 100 VEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDE 157

Query: 162 VVAPGVVQSIKLITQDASERVIRYAFEYARA-VER---PKVLVVHKSTIQRLADGLFVSV 217
                V  + K IT+ A++ +   A + A+  +E+     + V HKS +   +DGLF  V
Sbjct: 158 ATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREV 217

Query: 218 A----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSA 273
                E    +Y  ++   +++D+ V    R+P  +   VVV PNLYGDILSD  + L  
Sbjct: 218 CRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-V 274

Query: 274 GSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIE 333
           GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I 
Sbjct: 275 GSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIH 334

Query: 334 KAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           KAV + I  G +  T DL G+++T    E V+S+L
Sbjct: 335 KAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 188/359 (52%), Gaps = 39/359 (10%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAAAKAPIQ-----------WETCDVTPLFINGLTTIPQ 85
           T+  I GDG+G E+  A K I                    WET      F N    +P 
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPD 79

Query: 86  PAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDN 142
              + + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K+++G  T    
Sbjct: 80  ETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRP 137

Query: 143 VDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVER 195
           VD+V++RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A  R   R
Sbjct: 138 VDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSR 197

Query: 196 --PKVLVVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKY 249
               + V HKS +   +DGLF  + + + +    +Y  I+   +++D+ V    R+P  +
Sbjct: 198 GHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF 257

Query: 250 SDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANP 309
              VVV PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP
Sbjct: 258 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANP 314

Query: 310 TALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
            A + S+ +ML  +G  E A  I KAV S I    + +T DL G ++T    + ++S++
Sbjct: 315 IATIRSTALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 203/390 (52%), Gaps = 48/390 (12%)

Query: 4   SQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA--A 61
           S+F  +T R +AT             +      T+  I GDG+G E+  A K +     +
Sbjct: 7   SRFATSTCRTYAT-------------NALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNS 53

Query: 62  KAPIQWETCDVTPLFINGLTT---IPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNL 115
           K  ++++  D+   F   L T   +P      +      AL G + +P  K  G+ S  +
Sbjct: 54  KHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIV 113

Query: 116 TLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--VVQS 170
            LRK  GLFANVRP KS+ G K     VD+V++RENTE  Y  IE      A G  V ++
Sbjct: 114 ALRKEMGLFANVRPVKSVSGTKDR--PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEA 171

Query: 171 IKLITQDASERVIRYAFEYARAVERPKV------LVVHKSTIQRLADGLFVSVAEKLAK- 223
            K I++ A+ R+   A + A  ++R KV       V HKS +   +DGLF  + + + + 
Sbjct: 172 TKRISEIATRRIATIALDIA--LQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYES 229

Query: 224 ---EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTP 280
              +Y  I    +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ P
Sbjct: 230 NKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVP 286

Query: 281 SANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTI 340
           SAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I +AV + +
Sbjct: 287 SANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANM 346

Query: 341 ASGPEN--RTGDLAGSASTSSFAEAVISRL 368
               EN  +T DL G+++T    E V++RL
Sbjct: 347 R---ENKIKTPDLGGNSTTQQVTEDVLARL 373

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/358 (34%), Positives = 190/358 (53%), Gaps = 27/358 (7%)

Query: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDV---TPLFINGLTTIPQP 86
           A    T+  I GDG+G E+  A K +      K  I ++  D+      F++    +P  
Sbjct: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78

Query: 87  AQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNV 143
               + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V
Sbjct: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136

Query: 144 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVE 194
           D+V++RENTE  Y     + I+      V ++ K I++ A+ ++ + A + A    +   
Sbjct: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196

Query: 195 RPKVLVVHKSTIQRLADGLFVSVA----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYS 250
           +  + V HKS +   +DGLF  V     EK    Y ++    +++D+ V    R+P  + 
Sbjct: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256

Query: 251 DVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPT 310
             VVV PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDI+GQ  +NP 
Sbjct: 257 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPV 313

Query: 311 ALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           A + S+ +ML  +G  E A  I+ AV   I SG + +T DL G +ST+   + ++S+L
Sbjct: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  175 bits (444), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTT---IPQPAQDSI 91
           T+  I GDG+G E+  A K +     +K  + +   D+   F     T   +P      +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            +    AL G + +P  K  G+ S  + LR+  GLFANVRP KS++G K     +D+V++
Sbjct: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIV 142

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVERPK--VL 199
           RENTE  Y  IE      A G  V  + K I++ A+ R+   A + A  R   R +  + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATLT 202

Query: 200 VVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
           V HKS +   +DGLF  + +++ +    +Y  I+   +++D+ V    R+P  +   V+V
Sbjct: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S
Sbjct: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +ML  +G  E A  I KAV + +  G   +T DL G AST    + V+SRL
Sbjct: 320 TALMLEFLGHNEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  175 bits (444), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 198/379 (52%), Gaps = 30/379 (7%)

Query: 11  LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWE 68
           LR  AT+     G  T   + A    T+  I GDG+G E+  A K +     +K  + + 
Sbjct: 2   LRSVATRLSTCRGLAT---NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58

Query: 69  TCDVTPLFINGLTT---IPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFG 122
             D+   F     T   +P      + +    AL G + +P  K  G+ S  + LR+  G
Sbjct: 59  FIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118

Query: 123 LFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQD 177
           LFANVRP KS++G K     +D+V++RENTE  Y  IE      A G  V  + K I++ 
Sbjct: 119 LFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEI 176

Query: 178 ASERVIRYAFEYA--RAVERPK--VLVVHKSTIQRLADGLFVSVAEKLAK----EYPDIE 229
           A+ R+   A + A  R   R +  + V HKS +   +DGLF  + +++ +    +Y  I+
Sbjct: 177 ATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIK 236

Query: 230 LQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVS 289
              +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G E+ 
Sbjct: 237 YNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIV 293

Query: 290 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTG 349
           I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV + +  G   +T 
Sbjct: 294 IGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTP 352

Query: 350 DLAGSASTSSFAEAVISRL 368
           DL G AST    E V+SRL
Sbjct: 353 DLGGKASTQQVVEDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  175 bits (444), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 191/353 (54%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAAA--KAPIQWETCDVTPLFIN----GLTTIPQPAQDS 90
           T+  I GDG+G E+  A K +  +   K  + ++  D+   F      G     +  Q  
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQIL 85

Query: 91  INKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
             K   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  +    VD++++
Sbjct: 86  KEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIV 143

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA----RAVERPKVL 199
           RENTE  Y  IE      A G  V ++ K I++ A++R+   A + A    +   +  + 
Sbjct: 144 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATLT 203

Query: 200 VVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
           V HKS +   +DGLF  V  ++ +    +Y  I    +++D+ V    R+P  +   V+V
Sbjct: 204 VTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIV 261

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S
Sbjct: 262 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 320

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +ML  +G  E A  I KAV + +  G   +T DL G+A+T +  + +++RL
Sbjct: 321 TALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDILARL 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  174 bits (442), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 192/354 (54%), Gaps = 31/354 (8%)

Query: 38  VSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTP---LFINGLTTIPQPAQDSIN 92
           +  I GDG+G E+  A K +  A  +K  +Q++  D+      F      +P      + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82

Query: 93  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIR 149
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++  K    NVD++++R
Sbjct: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140

Query: 150 ENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPK------V 198
           ENTE  Y     + ++      V ++IK I++ A+ ++   A + +  ++R K      +
Sbjct: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS--LQRLKSRGHATL 198

Query: 199 LVVHKSTIQRLADGLFVSVA----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVV 254
            V HKS +   +DGLF  +     EK   +Y +++   +++D+ V    R+P  +   VV
Sbjct: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VV 256

Query: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + 
Sbjct: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 315

Query: 315 SSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           S+ +ML  +G  E A  I KAV + +  G  N T DL G A+T    + ++S++
Sbjct: 316 STALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 189/354 (53%), Gaps = 28/354 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTTIPQPAQDSI--- 91
           T+  I GDG+G E+  A K +     +K  + ++  D+   F   L T      ++I   
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++G  T    VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 149 RENTEG------EYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVERPKV 198
           RENT        E + I+      V ++ K I++ A+ R+   A + A    +   +  +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 199 LVVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVV 254
            V HKS +   +DGLF  + + + +    +Y  I    +++D+ V    R+P  +   VV
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260

Query: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 314
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + 
Sbjct: 261 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 315 SSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           S+ +ML  +G  E A  I +AV + +    + +T DL G ++T    E V++RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 191/353 (54%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTTIPQPAQDSI--- 91
           T+  I GDG+G E+  A K I     +K  + +   D+   F     T      ++I   
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            ++   AL G + +P  K  G+ S  + LR+  GL+ANVRP KS++G K     +D+V++
Sbjct: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIV 142

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVERPK--VL 199
           RENTE  Y  IE      A G  V  +IK I++ A+ R+ + A + A  R   R +  + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202

Query: 200 VVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
           V HKS +   +DGLF  + + + +    +Y  I+   +++D+ V    R+P  +   V+V
Sbjct: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +ML  +G  + A  I KAV + +  G    T DL G AST    + V+SRL
Sbjct: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 188/353 (53%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTT---IPQPAQDSI 91
           T+  I GDG+G E+  A K +     +K  + +   D+   F     T   +P    + +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVNVL 84

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            K    AL G + +P  K  G+ S  + LR+  GLFANVRP KS++G +     +D+V++
Sbjct: 85  KKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIV 142

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVERPK--VL 199
           RENTE  Y  IE      A G  V  + K I++ A+ R+   A + A  R   R +  + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGEATLT 202

Query: 200 VVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
           V HKS +    DGLF  + +++ +    +Y  I+   +++D+ V    R+P  +   V+V
Sbjct: 203 VTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S
Sbjct: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +ML  +G    A  I KAV + +  G    T DL G AST    + V+SRL
Sbjct: 320 TALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/359 (33%), Positives = 187/359 (52%), Gaps = 40/359 (11%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQ---------WETCDVTPLFINGLTTIPQ 85
           T+  I GDG+G E+  A + +  A   K  I+         W+T      F+     +P 
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQT------FLETGNALPG 75

Query: 86  PAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDN 142
              +++ +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G       
Sbjct: 76  ATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTGQP--- 132

Query: 143 VDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERV----IRYAFEYARAV 193
           VDLV++RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R  
Sbjct: 133 VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMG 192

Query: 194 ERPKVLVVHKSTIQRLADGLFVSVAEKL----AKEYPDIELQTELIDNTVLHTVRDPLKY 249
            R  + V HKS +    DGLF  V  ++     K Y  IE   +++D+ V    ++P  +
Sbjct: 193 GRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF 252

Query: 250 SDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANP 309
              VVV PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP
Sbjct: 253 D--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANP 309

Query: 310 TALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
            A + S  +ML  +GL E A  I++AV   +    +  + DL G  +T    + +++R+
Sbjct: 310 IATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 201/391 (51%), Gaps = 47/391 (12%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59
           M R+ F +   R +A+               A+   T+  I GDG+G E+  A + +   
Sbjct: 1   MLRASFTQLARRSYAS---------------ASKSLTIGLIPGDGIGKEVIPAGRQVLEN 45

Query: 60  -AAKAPIQWETCDVTP---LFINGLTTIPQPAQDSI-NKNLIALKGPLATPIGK--GHRS 112
            ++K  ++++  D+      F      +P    D + N+   AL G + +P  K  G+ S
Sbjct: 46  LSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSS 105

Query: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEHVVAPGV 167
             + LRK  GL+ANVRP KS+   +     VD++++RENTE  Y     + I+      V
Sbjct: 106 PIVALRKKLGLYANVRPVKSVLPQERP---VDMIIVRENTEDLYIKTEKTYIDEKTGTRV 162

Query: 168 VQSIKLITQDASERVIRYAFEYARAVERPKV------LVVHKSTIQRLADGLFVSVAEKL 221
            ++IK I++ A++ +   A E A  ++R KV       V HKS +   +DGLF  V  ++
Sbjct: 163 AEAIKRISETATKNIANIALEIA--LQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220

Query: 222 AKEYPD----IELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLG 277
            +   D    I+   +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG
Sbjct: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 277

Query: 278 LTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVF 337
           + PSAN+G +  + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV 
Sbjct: 278 VVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337

Query: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +      +T DL G ++T    E V+SR+
Sbjct: 338 ANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 191/360 (53%), Gaps = 32/360 (8%)

Query: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTP---LFINGLTTIPQP 86
           AT   T+  I GDG+G E+  A K +    ++K  +++   D+      F++    +P  
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76

Query: 87  AQDSI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNV 143
             D + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     +
Sbjct: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEKP---I 133

Query: 144 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPKV 198
           D+V++RENTE  Y     + I+      V ++IK I++ A+  +   A E A  ++R KV
Sbjct: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIA--LQRQKV 191

Query: 199 ------LVVHKSTIQRLADGLFVSVAEKLAKEYPD----IELQTELIDNTVLHTVRDPLK 248
                  V HKS +   +DGLF  +  ++ +   D    I    +++D+ V    R+P  
Sbjct: 192 NGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPEC 251

Query: 249 YSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKAN 308
           +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G +  + E  HGSAPDIAG+  +N
Sbjct: 252 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISN 308

Query: 309 PTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           P A + S+ +ML  MG  E A  I KAV + +      +T DL G ++T    + V+SR+
Sbjct: 309 PVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 187/355 (52%), Gaps = 30/355 (8%)

Query: 36  YTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTP---LFINGLTTIPQPAQDS 90
           +T+  I GDG+G E+    + +      K  + ++  D+      F++    +P    + 
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79

Query: 91  INKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    VDLV+
Sbjct: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137

Query: 148 IRENTE-----GEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPK----V 198
            RENTE      E + I+      V ++IK I++ A+  +   A E A    + K    +
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 199 LVVHKSTIQRLADGLFVSVAEKL---AKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
            V HKS +   +DGLF  + + +    K++ +++   +++D+ V    ++P  +   V+V
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314

Query: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPEN--RTGDLAGSASTSSFAEAVISRL 368
           + ++L  +GL E A  IEK V   I    EN  +T DL G+++    A  ++SR+
Sbjct: 315 AALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGNSTGEQVANDILSRI 366

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 203/391 (51%), Gaps = 45/391 (11%)

Query: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA- 59
           M RS  GR      AT++      Y   P        +  I GDG+G E+  A K +   
Sbjct: 1   MLRSAIGR-----LATRRA-----YASAPK----SMVIGLIPGDGIGKEVIPAGKQVLEN 46

Query: 60  -AAKAPIQWETCDVTP---LFINGLTTIP-QPAQDSINKNLIALKGPLATPIGK--GHRS 112
            + K  + ++  D+      F      +P Q  Q   N+   AL G + +P  K  G+ S
Sbjct: 47  LSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSS 106

Query: 113 LNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--V 167
             + LRK  GL+ANVRP KS++G K     VD+V++RENTE  Y  +E      A G  V
Sbjct: 107 PIVALRKELGLYANVRPVKSVEGTKDR--PVDMVIVRENTEDLYIKLEKTYVDKATGTRV 164

Query: 168 VQSIKLITQDASERVIRYAFEYARAVERPK------VLVVHKSTIQRLADGLFVSVAEKL 221
            ++ K I++ A+ R+   A + A  ++R K      + V HKS +   +DGLF  + + +
Sbjct: 165 AEATKRISEVATRRIATIALDIA--LQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222

Query: 222 AK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLG 277
            +    +Y  +    +++D+ V    R+P  +   VVV PNLYGDILSD  + L  GSLG
Sbjct: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 279

Query: 278 LTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVF 337
           + PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV 
Sbjct: 280 VVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339

Query: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368
           + +    + +T DL G+++T    E ++S+L
Sbjct: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 193/379 (50%), Gaps = 48/379 (12%)

Query: 19  QPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI-----------FAAAKAPIQW 67
           Q +IG  + K +      T+  I GDG+G E+  + + +           F        W
Sbjct: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66

Query: 68  ETCDVTPLFINGLTTIPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLF 124
           +T      F++    +P     ++ +N   AL G + +P  K  G+ S  + LRK  GL+
Sbjct: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 125 ANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHV-----VAPGVVQSIKLITQDAS 179
           AN+RP KS+         VD+V++RENTE  Y  +E           V  + K I++ A+
Sbjct: 121 ANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVAT 178

Query: 180 ERVIRYAFEYARAVERPK------VLVVHKSTIQRLADGLFVSVAEKLAKE----YPDIE 229
            R+ + A + A  ++R K      + V HKS +   +DGLF  V +++ +     Y DI+
Sbjct: 179 RRIAKIALDIA--LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236

Query: 230 LQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVS 289
              ++ID+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G  + 
Sbjct: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIV 293

Query: 290 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTG 349
           I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+ AV S +    + +T 
Sbjct: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTP 352

Query: 350 DLAGSASTSSFAEAVISRL 368
           DL G  STS     VI RL
Sbjct: 353 DLGGKNSTSDVVNDVIRRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 189/354 (53%), Gaps = 29/354 (8%)

Query: 37  TVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTPLFINGLTT---IPQPAQDSI 91
           T+  I GDG+G E+  A K +    +++  + +   D+   F   L T   +P      +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 92  NKNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIV 143

Query: 149 RENTEGEYSGIEHVVAPG----VVQSIKLITQDASERVIRYAFEYA----RAVERPKVLV 200
           RENTE  Y  IE          V ++ K IT+ A+ ++ + A + A    +   +  + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 201 VHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVC 256
            HKS +   +DGLF  + + + +    +Y  I    ++ID+ V    R+P +Y DV+V  
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP-EYFDVIV-A 261

Query: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSS 316
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ + E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 317 VMMLNHMGLTEHADKIEKAVFSTIASGPEN--RTGDLAGSASTSSFAEAVISRL 368
            +ML  +G  E A  I KAV S +    EN  +T DL G++ST +  + V+ +L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  117 bits (292), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 141/277 (50%), Gaps = 34/277 (12%)

Query: 115 LTLRKTFGLFANVRP----AKSIQGFKTAYDNV----DLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+AN+RP    +KS+ G       +    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-------KVLVVHKSTIQRLADGLFVSVA 218
           GV    +  T    ER+ R     A   + P       K  V+  S + R       +V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRR------TVN 207

Query: 219 EKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGL 278
           E + +E+P + +Q +LID+  +  +++P K++ +V+   N++GDI+SD  S +  GSLGL
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKFNGIVITS-NIFGDIISDAAS-VIPGSLGL 265

Query: 279 TPSANIGHE------VSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADK 331
            PSA++  E        ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    
Sbjct: 266 LPSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKA 324

Query: 332 IEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           IE AV   I SG   RTGDL G+ +T+   +AV   L
Sbjct: 325 IENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 139/268 (51%), Gaps = 24/268 (8%)

Query: 115 LTLRKTFGLFANVRP----AKSIQGF-----KTAYDNVDLVLIRENTEGEYSGIEHV-VA 164
           L LR+  G++AN+RP    A S+        + A D  D++++RE   G Y G  H    
Sbjct: 94  LKLRQELGVYANLRPCNFAADSLLELSPLRPEIARDT-DIMVVRELLGGSYFGERHEDEG 152

Query: 165 PGVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAK 223
            GV       T    +R+ R A   A   + P  V  + K+ +   +     +V E    
Sbjct: 153 DGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVWSLDKANVLASSRLWRKTVEETFQS 212

Query: 224 EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSAN 283
           E+P+++LQ +LID+  +  V++P  ++ VVV   N++GDI+SD  S +  GSLGL PSA+
Sbjct: 213 EFPNVQLQHQLIDSAAMILVKNPRAFNGVVVTS-NMFGDIISDEAS-VIPGSLGLLPSAS 270

Query: 284 IG------HEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAV 336
           +           ++E  HGSAPD+    KANP   +LS+ MML   + +    + +E+AV
Sbjct: 271 LASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAV 329

Query: 337 FSTIASGPENRTGDLAGSASTSSFAEAV 364
              + SG   RTGDL GS+STS   +A+
Sbjct: 330 QEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  110 bits (275), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 92  LKIRKELGLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 152 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTE 211

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V+ P K + VV+   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 212 FPQLTVQHQLIDSAAMILVKSPTKLNGVVITN-NMFGDIISDEASVIP-GSLGLLPSASL 269

Query: 285 G------HEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+   NK NP A +LS+ MML   + L E    +E+AV 
Sbjct: 270 ASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVR 328

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
           + + +G   RTGDL GS ST+   +A+
Sbjct: 329 NVLDAG--VRTGDLGGSNSTTEVGDAI 353

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  110 bits (275), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 136/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P ++L  +LID+  +  V+ P + + +V+   NL+GDI+SD  S +  GSLGL PSA++
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQLNGIVLTS-NLFGDIISDEAS-VIPGSLGLLPSASL 269

Query: 285 G------HEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  + K NP A++LS+ MML   + L++  + +EKAV 
Sbjct: 270 ASLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK 328

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + SG   RTGDL GS STS   +A+
Sbjct: 329 QVLDSG--VRTGDLGGSNSTSEVGDAI 353

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  109 bits (273), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLDLSPIKPQFAKGTDFVVVRELVGGIYFGERKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  T    +R+ R A   A   E P  +  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDCEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P +++Q +LID+  +  V++P   + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGIIITS-NMFGDIISDEASVIP-GSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E    IE AV 
Sbjct: 272 ASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVK 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST+   +AV
Sbjct: 331 RVLDAG--IRTGDLGGSNSTTEVGDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  108 bits (271), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 138/267 (51%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRP----AKSIQGFKTAYDNV----DLVLIRENTEGEYSGI-EHVVAP 165
           L +RK  GL+AN+RP    ++S+ G       +    D +++RE   G Y G  +     
Sbjct: 93  LKIRKELGLYANLRPCNFASESLLGLSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGD 152

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 153 GVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 212

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V++P + + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 213 FPTLTVQNQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEAS-VIPGSLGLLPSASL 270

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  + K NP A +LS+ MML   + L +  D IE+AV 
Sbjct: 271 ASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVK 329

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST+   +A+
Sbjct: 330 KVLDAG--IRTGDLGGSNSTTEVGDAI 354

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  108 bits (270), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSGI-EHVVAP 165
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  T    +R+ R A   A   E P  +  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P +++Q +LID+  +  V++P   + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGIIITS-NMFGDIISDEASVIP-GSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E    IE AV 
Sbjct: 272 ASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST+   +AV
Sbjct: 331 KVLDAG--IRTGDLGGSNSTTEVGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  108 bits (270), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSGI-EHVVAP 165
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  T    +R+ R A   A   E P  +  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P +++Q +LID+  +  V++P   + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGIIITS-NMFGDIISDEASVIP-GSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E    IE AV 
Sbjct: 272 ASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST+   +AV
Sbjct: 331 KVLDAG--IRTGDLGGSNSTTEVGDAV 355

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  107 bits (266), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 133/268 (49%), Gaps = 22/268 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V+ P K + +V+   N++GDI+SD  + +  GSLGL PSA++
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKLNGIVITS-NMFGDIISD-EASVIPGSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E  + +E+AV 
Sbjct: 272 ASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVR 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAVI 365
             + +G   RT DL G  STS   +AV+
Sbjct: 331 RVLDAG--IRTADLRGENSTSEVGDAVV 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  106 bits (265), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSGI-EHVVAP 165
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLELSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  T    +R+ R A   A   + P  +  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHQPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P +++Q +LID+  +  V++P + + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEASCIP-GSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + +T     IE AV 
Sbjct: 272 ASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVK 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST    +AV
Sbjct: 331 KVLDAG--IRTGDLGGSNSTIEVGDAV 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  106 bits (265), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 142/271 (52%), Gaps = 23/271 (8%)

Query: 115 LTLRKTFGLFANVRPAKSIQ----GFKTAYDNV----DLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+ N+RP K I     G     + V    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  + +  +R+ + A   +   + P  +  + K+ +   +     +V E +A E
Sbjct: 154 GVAWDSEKYSIEEVKRITKMAAFLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIA-E 212

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P++++Q +LID+  +  V++P + + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 213 FPNLKVQHQLIDSAAMMLVKNPTQLNGIILTN-NMFGDIISDEAS-VIPGSLGLLPSASL 270

Query: 285 G------HEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+A + K NP A +LS+ MML   + + +  + IE+AV 
Sbjct: 271 ASLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVS 329

Query: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368
             +  G   RT DL G+++TS   +AV   L
Sbjct: 330 VVLDRGI--RTADLGGNSTTSELGDAVAQEL 358

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 133/267 (49%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V + + +E
Sbjct: 152 GVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEKTIKEE 211

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +  +LID+  +  V++P + + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 212 FPTLSVNHQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEAS-VIPGSLGLLPSASL 269

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+A + K NP A +LS+ MML   + + E    IEKAV 
Sbjct: 270 ASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVK 328

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             +  G   RTGDL GS STS   +AV
Sbjct: 329 KVLDDG--IRTGDLGGSNSTSEVGDAV 353

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 134/269 (49%), Gaps = 26/269 (9%)

Query: 115 LTLRKTFGLFANVRPAKSIQGFKTAYD----------NVDLVLIRENTEGEYSGIEHVVA 164
           L +RK  G++AN+RP + +   +T  D            D V++RE   G Y G      
Sbjct: 94  LKIRKELGVYANLRPCQFVS--ETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAG 151

Query: 165 P-GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLA 222
             GV    +  +    +R+ R A   A     P  V  + K+ +   +     +V E + 
Sbjct: 152 DDGVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIK 211

Query: 223 KEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSA 282
            E+P + +   LID+  +  V++P K + VV+   N++GDI+SD  S +  GSLGL PSA
Sbjct: 212 NEFPTLTINHHLIDSAAMTLVQNPTKLNGVVITT-NMFGDIISDEAS-VIPGSLGLLPSA 269

Query: 283 NIG------HEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKA 335
           ++         + ++E  HGSAPD+   + ANP A +LS+ MM    + LT+  + IE+A
Sbjct: 270 SLASLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGNAIEEA 328

Query: 336 VFSTIASGPENRTGDLAGSASTSSFAEAV 364
           V  TI +G   +TGDL G  +T+    AV
Sbjct: 329 VKRTIDAGI--KTGDLGGKNTTTEVGNAV 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  103 bits (258), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 136/267 (50%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRP----AKSIQGFKTAYDNV----DLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+AN+RP    ++ + G       +    D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    ER+ R A   A     P  +  + K+ +   +     +V   +  E
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNE 214

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V++P + + +++   N++GDI+SD  S +  GSLGL PSA++
Sbjct: 215 FPTLTVQNQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEAS-VIPGSLGLLPSASL 272

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  +NK NP A +LS+ MML   + + +  + +E+AV 
Sbjct: 273 ASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVR 331

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + +G   RTGDL GS ST    +A+
Sbjct: 332 RVLDAG--VRTGDLGGSNSTQEVGDAI 356

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  102 bits (255), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 134/271 (49%), Gaps = 22/271 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFK-TAYDNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K       D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLDLSPLKPECARGTDFVVVRELVGGIYFGERKEDTGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  V  + K+ +   +     +V E +  E
Sbjct: 154 GVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPVWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V++P + + V++   N++GDI+SD  + +  GSLGL PSA++
Sbjct: 214 FPTLTVQHQLIDSAAMILVKNPTQLNGVIITN-NMFGDIISD-EASVIPGSLGLLPSASL 271

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  + K NP A +LS+ MML   + + E    +E+AV 
Sbjct: 272 ASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVR 330

Query: 338 STIASGPENRTGDLAGSASTSSFAEAVISRL 368
             + SG   RT DL G+++TS   EAV+  L
Sbjct: 331 KVLDSG--VRTADLKGTSTTSEVGEAVVKAL 359

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  102 bits (254), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 169/356 (47%), Gaps = 35/356 (9%)

Query: 38  VSFIEGDGVGPEI-SKAVKDIFAAAKAPIQWETCDVTPLFINGL------TTIPQPAQDS 90
           +  + GD VG EI  +A+K + A A +  +    +     I G       T +P  A D+
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 91  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK----SIQGFKTAYD 141
              +   L G +  P  G G     + L L +RK   L+AN+RP      S+ G     +
Sbjct: 66  AKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLGLSPLKE 124

Query: 142 NV----DLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERP 196
            +    D  ++RE   G Y G  +     G     +  T    +R+ R A   A   + P
Sbjct: 125 EIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQHDPP 184

Query: 197 -KVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
             +  + K+ +   +     +V E +  E+P++++Q +LID+  +  V+ P + + +++ 
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQLNGIIIT 244

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGH------EVSIFEAVHGSAPDIAGQNKANP 309
             N++GDI+SD  S +  GSLGL PSA++           ++E  HGSAPD+  + K NP
Sbjct: 245 N-NMFGDIISDEAS-VIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNP 301

Query: 310 TALLLSSVMMLN-HMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAV 364
            A +LS+ MML   + L +    IE+AV   + +G   RT DL GS STS   +AV
Sbjct: 302 IATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEVGDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  100 bits (249), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 166/356 (46%), Gaps = 36/356 (10%)

Query: 38  VSFIEGDGVGPEIS-------KAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDS 90
           +  + GD VG EI+       KA+ ++ ++ K   Q        +   G   +P  + ++
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATG-EPLPDASLEA 65

Query: 91  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIQGFKT 138
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  AKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 139 AY-DNVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERP 196
            +    D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPP 184

Query: 197 -KVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255
             V  + K+ +   +     +V E +  E+P + +Q +LID+  +  V++P + + V++ 
Sbjct: 185 LPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQLNGVIIT 244

Query: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGH------EVSIFEAVHGSAPDIAGQNKANP 309
             N++GDI+SD  S +  GSLGL PSA++           ++E  HGSAPD+  + K NP
Sbjct: 245 N-NMFGDIISDEASVIP-GSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNP 301

Query: 310 TALLLSSVMMLN-HMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAV 364
            A +LS+ MML   + + E    +E+AV   + SG   RTGDL GS ST    +AV
Sbjct: 302 IATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSG--IRTGDLRGSNSTQEVGDAV 355

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 131/267 (49%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFK-TAYDNVDLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K       D+ ++RE   G Y G  +     
Sbjct: 177 LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGERKEDEGD 236

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  V  + K+ +   +     +V E +  E
Sbjct: 237 GVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPVWSLDKANVLASSRLWRKTVEETIKNE 296

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V++P  + + VV+  N++GDI+SD  S +  GSLGL PSA++
Sbjct: 297 FPTLTVQHQLIDSAAMILVKNP-THLNGVVIANNMFGDIISDEASVI-PGSLGLLPSASL 354

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  + K NP A +LS  MML   + +TE    +EKAV 
Sbjct: 355 ASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVK 413

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + SG   RT DL GS STS   +A+
Sbjct: 414 QVLDSGV--RTADLRGSNSTSEVGDAI 438

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 132/267 (49%), Gaps = 22/267 (8%)

Query: 115 LTLRKTFGLFANVRPAK----SIQGFKTAYDNV----DLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP      S+         +    D V++RE   G Y G  +     
Sbjct: 95  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIARGTDFVVVRELVGGIYFGERKEDEGD 154

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 155 GVAWDSEKYSVPEVQRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 214

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANI 284
           +P + +Q +LID+  +  V++P   + +++   N++GDI+SD  + +  GSLGL PSA++
Sbjct: 215 FPQLTVQHQLIDSAAMILVKNPTHLNGIIITN-NMFGDIISD-EASVIPGSLGLLPSASL 272

Query: 285 GH------EVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVF 337
                      ++E  HGSAPD+  + K NP A +LS+ MML   + L E  + IE+AV 
Sbjct: 273 ASLPDKNTAFGLYEPCHGSAPDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVK 331

Query: 338 STIASGPENRTGDLAGSASTSSFAEAV 364
             + SG   RT DL G+ ST+   +AV
Sbjct: 332 KVLDSG--IRTADLKGTNSTTEVGDAV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 123/268 (45%), Gaps = 24/268 (8%)

Query: 115 LTLRKTFGLFANVRPAK-------SIQGFKTAY-DNVDLVLIRENTEGEYSGI-EHVVAP 165
           L +RK   L+AN+RP          +   K  Y    D  ++RE   G Y G  +     
Sbjct: 95  LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGD 154

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVERP-KVLVVHKSTIQRLADGLFVSVAEKLAKE 224
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     +V E +  E
Sbjct: 155 GVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNE 214

Query: 225 YPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGL-------SAGSLG 277
           +P +++  +LID+  +  V++P + + +++   N++GDI+SD  S +        + SL 
Sbjct: 215 FPSLKVSHQLIDSAAMILVKNPTQLNGIIITN-NMFGDIISDEASVIPGSLGLLPSASLS 273

Query: 278 LTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAV 336
             P  N      ++E  HGSAPD+  + K NP   +LS  MML   + L E    +E+AV
Sbjct: 274 SLPDTN--SAFGLYEPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV 330

Query: 337 FSTIASGPENRTGDLAGSASTSSFAEAV 364
              + +    RT DL GS STS   +AV
Sbjct: 331 RRVLDNNI--RTADLGGSNSTSDIGDAV 356

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 50.4 bits (119), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 1/51 (1%)

Query: 318 MMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368
           +MLNH+GL E A +I KAV  TIA G ++ T D+ GS+ST+ F   +I++L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPD-------IELQT 232
           E   + +FE A   + P +    K+TI +  DGLF  + EKL K++         I  + 
Sbjct: 193 ESFAKSSFELALKRKLP-LFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITFEH 251

Query: 233 ELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIF- 291
            LID+ V   ++        ++   N  GD+ SD+ +    GSLGL  S  +  + S+F 
Sbjct: 252 RLIDDMVAQMLKSN---GGFILSLKNYDGDVQSDIVAQ-GFGSLGLMTSMLVTPDDSVFE 307

Query: 292 -EAVHGS 297
            EA HG+
Sbjct: 308 SEAAHGT 314

>Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig
           55] FULL
          Length = 167

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 3   RSQFGRNTLRFFATK-----KQPSIGRYTGKPDPATGKYTVSFIEGD-GVGPEISKAVKD 56
           RS  G +  R   T+     ++P +  +  K   ++  Y+V+ ++   G GP ++K++KD
Sbjct: 57  RSSAGESPCRLATTRCTTLSRRPPLAPWRDKEPTSSLSYSVTMLKASLGTGPSLAKSIKD 116

Query: 57  IFAA 60
           + AA
Sbjct: 117 LMAA 120

>KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {ON} 
          Length = 443

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 59/140 (42%), Gaps = 10/140 (7%)

Query: 48  PEISKAVKDIFAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIG 107
            ++S    D   A  A + +    ++ L +N LT++ Q    + N +L  L+    T +G
Sbjct: 218 SDVSSVSFDNLQAVNASLGFLNNTISELKLNNLTSVGQTFTITFNNDLTHLEFSNLTKVG 277

Query: 108 KGHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIR--------ENTEGEYSG- 158
            G    N T  K+   FAN++           +D++DL  ++        E     +S  
Sbjct: 278 GGFVVANNTNLKSIDAFANLQTVNGALDVIGNFDSLDLTALKSVRGGADVETKSANFSCS 337

Query: 159 -IEHVVAPGVVQSIKLITQD 177
            ++ + + G +Q  K I ++
Sbjct: 338 PLKKLQSKGAIQGDKFICKN 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,880,464
Number of extensions: 1489816
Number of successful extensions: 4162
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3930
Number of HSP's successfully gapped: 93
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)