Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212675.475ON60460431780.0
KLTH0F15004g5.475ON59760920480.0
SAKL0G03564g5.475ON60559615110.0
YOR138C (RUP1)5.475ON67163911421e-148
TDEL0A033905.475ON62261211321e-147
Suva_8.1905.475ON66662811231e-145
Smik_15.3185.475ON67264011221e-145
Skud_15.3025.475ON67864411191e-144
TPHA0J027805.475ON63162011141e-144
Kpol_543.95.475ON64263810891e-140
KAFR0E025405.475ON65966410181e-129
TBLA0A025405.475ON6785699151e-114
NCAS0H022705.475ON6965129041e-112
ZYRO0D11264g5.475ON5475938821e-111
NDAI0C013905.475ON7096968801e-108
KNAG0B040505.475ON6736668211e-100
CAGL0I07205g5.475ON6036317666e-93
KLLA0E03169g5.475ON5445266945e-83
TBLA0B022305.475ON7905096362e-72
KNAG0G015808.185ON40637880.041
KLLA0E10341g8.185ON41437870.051
YER143W (DDI1)8.185ON42836860.068
KAFR0C004103.270ON76955870.072
TDEL0D035503.270ON78050860.088
Skud_5.2808.185ON42836850.10
Skud_2.1773.270ON78256850.11
Suva_4.2953.270ON78248820.25
TBLA0E025703.270ON78552820.29
Smik_5.3088.185ON42836800.36
Kpol_526.238.185ON42336800.42
CAGL0I06787g8.185ON42636790.47
Suva_5.2718.185ON42836790.53
ZYRO0G06864g8.185ON41837790.54
NCAS0I016203.270ON79550790.55
Smik_2.1893.270ON78268790.66
AGR023C3.270ON78036780.91
KAFR0B023008.185ON41637770.98
KLLA0F18700g3.270ON77045771.2
NDAI0C058908.185ON46236761.3
TBLA0A086708.185ON44837761.3
YBR058C (UBP14)3.270ON78139751.9
TPHA0D043008.185ON42437732.4
NCAS0A039208.185ON47236732.6
Kpol_1028.897.488ON87734732.9
CAGL0F04609g7.488ON131134742.9
TBLA0C009302.649ON658106724.1
ZYRO0F01276g3.270ON77645715.4
KNAG0M015005.300ON36882706.1
Suva_11.1612.601ON970146707.1
YKL064W (MNR2)2.601ON969146707.8
KLTH0E09174g2.411ON114859699.2
Smik_11.1842.601ON973146699.4
NCAS0F011605.545ON516128699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21267
         (604 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...  1228   0.0  
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   793   0.0  
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   586   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   444   e-148
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   440   e-147
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   437   e-145
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   436   e-145
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   435   e-144
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   433   e-144
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   424   e-140
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   396   e-129
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   357   e-114
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   352   e-112
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   344   e-111
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   343   e-108
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   320   e-100
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   299   6e-93
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   271   5e-83
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   249   2e-72
KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.1...    39   0.041
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    38   0.051
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    38   0.068
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    38   0.072
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    38   0.088
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.10 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    37   0.11 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    36   0.25 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    36   0.29 
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    35   0.36 
Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON} (62128..6...    35   0.42 
CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {...    35   0.47 
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    35   0.53 
ZYRO0G06864g Chr7 complement(548758..550014) [1257 bp, 418 aa] {...    35   0.54 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   0.55 
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    35   0.66 
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    35   0.91 
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    34   0.98 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    34   1.2  
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    34   1.3  
TBLA0A08670 Chr1 complement(2127049..2128395) [1347 bp, 448 aa] ...    34   1.3  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    33   1.9  
TPHA0D04300 Chr4 (928596..929870) [1275 bp, 424 aa] {ON} Anc_8.1...    33   2.4  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    33   2.6  
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    33   2.9  
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    33   2.9  
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    32   4.1  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    32   5.4  
KNAG0M01500 Chr13 (265547..266653) [1107 bp, 368 aa] {ON} Anc_5....    32   6.1  
Suva_11.161 Chr11 (300508..303420) [2913 bp, 970 aa] {ON} YKL064...    32   7.1  
YKL064W Chr11 (317764..320673) [2910 bp, 969 aa] {ON}  MNR2Vacuo...    32   7.8  
KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} simil...    31   9.2  
Smik_11.184 Chr11 (304067..306988) [2922 bp, 973 aa] {ON} YKL064...    31   9.4  
NCAS0F01160 Chr6 (229393..230943) [1551 bp, 516 aa] {ON} Anc_5.5...    31   9.9  

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/604 (98%), Positives = 597/604 (98%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE 60
           MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE
Sbjct: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE 60

Query: 61  QGPQKEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQEEAANEVKNDQEDPLVVK 120
           QGPQKEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQEEAANEVKNDQEDPLVVK
Sbjct: 61  QGPQKEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQEEAANEVKNDQEDPLVVK 120

Query: 121 PESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNED 180
           PESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNED
Sbjct: 121 PESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNED 180

Query: 181 VTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLN 240
           VTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLN
Sbjct: 181 VTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLN 240

Query: 241 NAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVSLLHFMPE 300
           NAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVSLLHFMPE
Sbjct: 241 NAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVSLLHFMPE 300

Query: 301 EYDSNIYKMFNALLYPNXXXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVE 360
           EYDSNIYKMFNALLYPN       VEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVE
Sbjct: 301 EYDSNIYKMFNALLYPNDADDDDDVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVE 360

Query: 361 VPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLD 420
           VPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLD
Sbjct: 361 VPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLD 420

Query: 421 FIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGI 480
           FIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGI
Sbjct: 421 FIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGI 480

Query: 481 IEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTNT 540
           IEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTNT
Sbjct: 481 IEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTNT 540

Query: 541 IRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKIPSTVDQKD 600
           IRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKIPSTVDQKD
Sbjct: 541 IRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKIPSTVDQKD 600

Query: 601 LLEL 604
           LLEL
Sbjct: 601 LLEL 604

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/609 (64%), Positives = 475/609 (77%), Gaps = 17/609 (2%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE 60
           MSE+AI+SLLDMGITR+VAIEAL+KTNGDVENSVNYIFSGELPQQG              
Sbjct: 1   MSENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG-----------PPP 49

Query: 61  QGPQKEEDREDSALLEHTEYAS---VSNGPLEEPER--YRDYTLSTQEEAANEVKNDQED 115
              +  EDRE     E     +   +   P  E E    +   +S +E+ A ++KN  ED
Sbjct: 50  APEETPEDREKEPESESELPENPEFIEEAPPSEDEATDQQGVAVSPREQIACQLKNRPED 109

Query: 116 PLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKF 175
           PLVV+P S NALFENYFALFCLAVGLGFPH+FL PDF+DL YG DW +GQFLKP +R+KF
Sbjct: 110 PLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQFLKPAYRVKF 169

Query: 176 ETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQV 235
           E N+DV+IVP+ETLTSQDNL LQPELLWQFQKFLAVQ+SP   RK V+ARYLTK LEPQV
Sbjct: 170 ENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARYLTKVLEPQV 229

Query: 236 VEKLNNAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVSLL 295
           VEKLNN++HLH+ LPSFI+SLANDVELCPG+ S+KELFISTAYYKP SEP PIETLVSLL
Sbjct: 230 VEKLNNSDHLHEALPSFIKSLANDVELCPGAHSVKELFISTAYYKPVSEPEPIETLVSLL 289

Query: 296 HFMPEEYDSNIYKMFNALLYPNXXXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRL 355
           HFMPEEYD+NIYKMFNALLYP+       +++ QNSLGNLA MITIVFDEMDEST+   L
Sbjct: 290 HFMPEEYDTNIYKMFNALLYPD-SNEDAEMDDIQNSLGNLAPMITIVFDEMDESTEQATL 348

Query: 356 PHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFL 415
           PHGV+VP++FYPQLYTE+AK  LIK+VTK + + Q +A SIL+ LN+LKSFQGK IHSFL
Sbjct: 349 PHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILRNLNDLKSFQGKQIHSFL 408

Query: 416 NSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSH 475
           NS LDFI +D S V+E   + +LVD+LQ +KQ L  KKT+ MA+YKA+SH+LNN+ NLSH
Sbjct: 409 NSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEKMAQYKAVSHRLNNELNLSH 468

Query: 476 PELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAE 535
           PELGII++ + LGLIDEPY+LT+AVIS  NYFIR+ + QW+HV+G+ +++ ++V KTDA 
Sbjct: 469 PELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNGQWFHVVGRSNSEHMDVTKTDAS 528

Query: 536 TVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKIPST 595
           TV++ IR +TR ASE+PLMFTYFK SAIDT   + EA+  N G   FAEQDQ  +   S 
Sbjct: 529 TVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKGAKLFAEQDQKHINTLSA 588

Query: 596 VDQKDLLEL 604
            D++DL++L
Sbjct: 589 PDEEDLIDL 597

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/596 (50%), Positives = 414/596 (69%), Gaps = 21/596 (3%)

Query: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQG-- 62
           +I+ LLDMGI+ +VA++ALS+TNGD+E SVNYIFSGEL Q   E   L    +D+E G  
Sbjct: 7   SIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL-QATTEHVDLTQDDSDSENGIK 65

Query: 63  PQKEED----REDSALLEHTEYASVSNGPLEEPERYRDYTLSTQEEAANEVKNDQEDPLV 118
           P    D     ++   +E  E  +     +  P    D T    +++ N       DP V
Sbjct: 66  PGMLNDVIPNTDNVTTVETREVENTIPDDVLAPSGIMDSTTQLLKDSLN-------DPTV 118

Query: 119 VKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETN 178
           V P   NAL ENYFALFCL+VG+ FPH+FL PDF+DLNY  +W +G + KP++R++F +N
Sbjct: 119 VLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSN 178

Query: 179 EDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEK 238
            +V+IVP+  LT QD+LTLQPELLWQFQKF+AV +S  S RK VSA+   K LEP V++K
Sbjct: 179 NNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDK 238

Query: 239 LNNAEHLHDVLPSFIRSLANDVELC---PGSQSIKELFISTAYYKPASEPVPIETLVSLL 295
           L + +HL +VLPSFI+SLANDVE+C     ++ I+ LFISTAY+KP+ +   IETLVSLL
Sbjct: 239 LGSCDHLFEVLPSFIKSLANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLL 298

Query: 296 HFMPEEYDSNIYKMFNALLYPNXXXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRL 355
           HF+PEEYD+N+Y+MFN LLYP         EE +NSLGNLA M+T+VFDEMDEST+++ L
Sbjct: 299 HFLPEEYDTNLYRMFNTLLYP---EEDEDGEEVENSLGNLAPMLTVVFDEMDESTENVSL 355

Query: 356 PHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFL 415
             GV+VP+KFYPQ+YT+ +K SLI  V     E Q  +H+IL+ LN LKSFQGKHI+SFL
Sbjct: 356 QQGVDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFL 415

Query: 416 NSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSH 475
           NST+DF A+D      +    +L+ +L  IK+ ++ KKT+ M EYK ISH ++N WNLSH
Sbjct: 416 NSTVDFAAKD-PLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSH 474

Query: 476 PELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAE 535
           P+L +++  +K+GLIDEPY+LT+A++SP++Y+IRKRD  WY V+ + +   L  + T+  
Sbjct: 475 PDLYVVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEPH 534

Query: 536 TVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
            V+ +I+L TR ASETPLMFTY KES I    ++ +++E N GV+ F + DQ+ L+
Sbjct: 535 EVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELE 590

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  444 bits (1142), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 248/639 (38%), Positives = 366/639 (57%), Gaps = 53/639 (8%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQ---GPESKPLQPLHA 57
           M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q   G E+   QP  +
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRIS 61

Query: 58  D----AEQGPQKEEDREDSAL------------------LEHTEYASVSNGPLEEPERYR 95
           +    A   P    +  D  +                   +    ++ ++G     + Y 
Sbjct: 62  ENKIVAGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQNYD 121

Query: 96  DYTLSTQEEAA--------NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYF 147
            Y++S              NE K++  DP VV P   N+L E+YF LF L   + FPH F
Sbjct: 122 RYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVF 181

Query: 148 LGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQ 206
           L PDFKDLNY  DW +G  F +P++R+ +   ED +      L S  N  LQP LLWQ Q
Sbjct: 182 LKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQ 241

Query: 207 KFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG- 265
           K ++V ++    R  VSA+  T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+CPG 
Sbjct: 242 KLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGI 301

Query: 266 -SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXX 324
             +  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP        
Sbjct: 302 RDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEED 361

Query: 325 V-----------EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTED 373
           V            E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P++FYPQLYT+ 
Sbjct: 362 VIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTKQ 421

Query: 374 AKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENP 433
            K  LI+ +     + + R+  +L+ +NELKS+QGK+I + L STL ++         + 
Sbjct: 422 CKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYL-----QTIPDD 476

Query: 434 QINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEP 493
             N+    +  +K  L+  +   M EYK ++ KL+ +WNLSHPE  II   ++LGLI+ P
Sbjct: 477 ANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENP 536

Query: 494 YILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTN-TIRLNTRTASETP 552
           YILT A +SP++YFIR R+  W  +          V K  + +V    I+  T+ ASETP
Sbjct: 537 YILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETP 596

Query: 553 LMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           LMF Y +E  I T E + EA++ N+G   FAE DQ+SLK
Sbjct: 597 LMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLK 635

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  440 bits (1132), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/612 (40%), Positives = 368/612 (60%), Gaps = 43/612 (7%)

Query: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQGPQ 64
           A++SL++MGI++DVA +AL +TNGDVE + N+IF  + P Q  E+   Q  H +   G  
Sbjct: 6   AVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVE-QRAHIELPAGSA 64

Query: 65  KEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQEEA--------ANEVKNDQEDP 116
                 D       EY  +SN P  E E + +  +  +E++         +  K    DP
Sbjct: 65  SGFQPGD-----LNEY--ISNAPDTESEDFEE--IDVEEDSVETGPSLECSGRKGQISDP 115

Query: 117 LVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARG-QFLKPQFRIKF 175
            VV P   N LFE YFALFCL V    PH    PDF DLNY  +W RG  +   ++R+K+
Sbjct: 116 TVVLPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKY 175

Query: 176 -----ETNEDVTIVPRETLTSQD-NLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTK 229
                  +E + IVP++ LT +D + TLQ ELLWQ QK  +V +S  S R  V A+    
Sbjct: 176 LSKNGSDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAYVRAKMFAI 235

Query: 230 ALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQS--IKELFISTAYYKPAS---- 283
           A+EPQV   +  AEHLH+VLPSFI+S+A D+E+CP  Q   ++E FIS+A++ P++    
Sbjct: 236 AVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNEVRECFISSAFHTPSNSAPQ 295

Query: 284 EPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXXVE----ETQNSLGNLASMI 339
           E   ++T +SL HF+PEEY++N+Y+MFNALL+ +        +    E +NSL  +A + 
Sbjct: 296 EESTMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVESDQSDSPDGEGENSLSEIAPVF 355

Query: 340 TIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKT 399
           TIVFDEM+E+T+ + L  GVE+P++FYPQLYT++ K  LIK +     + Q  + +IL+ 
Sbjct: 356 TIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRRQSQTDSRAILQE 415

Query: 400 LNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAE 459
           + +LKSFQGK +  F+NS+LD++ +D  +        +L+  L  +K  ++ KKT  M E
Sbjct: 416 ITDLKSFQGKDLSKFINSSLDYLQKDEKS-------PELIKGLLDLKDQITNKKTKKMNE 468

Query: 460 YKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVL 519
           YK I+H+L ++WNLS PE+ I++  ++LGLID+ Y+LT AVISP+ Y+ R RD QW+ V 
Sbjct: 469 YKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRDGQWFFVQ 528

Query: 520 GKQHNDALNV-AKTDAETVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTG 578
              +  + NV A +    + + I+ +TR  SE PLMF Y K+  I  ++T+ +A+E N G
Sbjct: 529 STPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLKALENNQG 588

Query: 579 VTSFAEQDQSSL 590
              FA+ DQ  L
Sbjct: 589 CHRFAKDDQLQL 600

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  437 bits (1123), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 239/628 (38%), Positives = 367/628 (58%), Gaps = 43/628 (6%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPL---QPLHA 57
           M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q    +P      +  
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRVVP 61

Query: 58  DAEQGPQKEEDREDSAL------------------LEHTEYASVSNGPLEEPERYRDYTL 99
           DA  G     +  D  +                      + +  S+     P+ Y     
Sbjct: 62  DAGAGAYDVPNSGDQDIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGPDHYSISET 121

Query: 100 STQEEAANEVKNDQ-----EDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKD 154
           S    + + V+++Q     +DP VV P   N+L E+YF LF L   + FPH FL PDF+D
Sbjct: 122 SLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQD 181

Query: 155 LNYGPDWARG-QFLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQH 213
           LNY PDW +G  F +P++R+ +  + D +      + S  +  +QP LLWQ QK ++V +
Sbjct: 182 LNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVN 241

Query: 214 SPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG--SQSIKE 271
           +    R  VSA+  T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+CPG   +  + 
Sbjct: 242 TKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRN 301

Query: 272 LFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXXV------ 325
           LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP        V      
Sbjct: 302 LFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEGEVVYGGDG 361

Query: 326 --EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVT 383
             +E +N+L  +A ++TI+F+E++ +T+ + LP+GV+VP++FYPQLYT+  K  LI+ + 
Sbjct: 362 AHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHII 421

Query: 384 KHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQ 443
               + + ++ S+L+ +N LKS+QGK+I + L STL ++  D+         N+    + 
Sbjct: 422 SKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDAD-----NEASKQIA 476

Query: 444 HIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISP 503
            +K  L+  +   M EYK ++ KL+ +WNLSHPE+ II   ++LGLI+ PYIL+ AV+SP
Sbjct: 477 SLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSP 536

Query: 504 FNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTN-TIRLNTRTASETPLMFTYFKESA 562
           ++YF R RD +W  +          + K  + +V    IR  T+ ASE PLMF Y +E  
Sbjct: 537 YSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGR 596

Query: 563 IDTNETLTEAIEKNTGVTSFAEQDQSSL 590
           I T++ +++A+E NTG   FA+ DQS+L
Sbjct: 597 IPTDDEVSKALENNTGCVKFAKDDQSTL 624

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  436 bits (1122), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/640 (38%), Positives = 362/640 (56%), Gaps = 54/640 (8%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQG----------PESK 50
           M   A+KSLL+MGI  +VA+EAL +T G++E +VN+IFS ELP QG          P   
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRIS 61

Query: 51  PLQPLHADAEQGPQKEEDRED-----------SALLEHTEYASVSNGPLEEPERYRDYTL 99
             + +  ++   P   E   D               + T+  S SN   E     ++Y  
Sbjct: 62  ENRIMAGNSYDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSNSTNEYRRAAQEYDH 121

Query: 100 STQEEAA-----------NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFL 148
            +  E +           NE K+  +DP VV P   N+L E+YF LF L V + FPH FL
Sbjct: 122 YSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFL 181

Query: 149 GPDFKDLNYGPDWARG-QFLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQK 207
            PDF+DLN+ PDW +G  F +P++RI +   +D +      L S  +  LQP LLWQ QK
Sbjct: 182 KPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQK 241

Query: 208 FLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG-- 265
            ++V ++    R  VSA+  T +LEPQ+  KL N+EHL++VLP+FI+SLA D+E+CPG  
Sbjct: 242 LISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIR 301

Query: 266 SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXXV 325
            Q  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP        V
Sbjct: 302 DQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEEEV 361

Query: 326 -------------EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTE 372
                         E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P++FYPQLYT+
Sbjct: 362 IRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQLYTK 421

Query: 373 DAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTEN 432
             K  LI+ +     + + R+  +L+ ++ LKS+QGK+  + L STL ++          
Sbjct: 422 RCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDAN-- 479

Query: 433 PQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDE 492
              N+    +  +K  L+  ++  M EYK ++ KL+ +WNLSHPE  II   ++LGLI+ 
Sbjct: 480 ---NEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIEN 536

Query: 493 PYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAK-TDAETVTNTIRLNTRTASET 551
           PY+LT A ISP++YFIR R+  W  +          V K + A  V   IR  T+ ASE 
Sbjct: 537 PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEM 596

Query: 552 PLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           PLMF Y +E  I T E + +A++ N G + FA+ DQSSL+
Sbjct: 597 PLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLR 636

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  435 bits (1119), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 246/644 (38%), Positives = 369/644 (57%), Gaps = 58/644 (9%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQ---GPESKPLQPLHA 57
           M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q   G E    QP  +
Sbjct: 2   MDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRIS 61

Query: 58  DAE------------QGPQKEEDREDSA-------------LLEHTEYASVSNGPLEEPE 92
           +               G Q++ D  D A             + E+   +S SN       
Sbjct: 62  ENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGPAAR 121

Query: 93  RYRDYTLSTQEEAA--------NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFP 144
            Y  Y++S    A         NE K   +DP VV P   N+L E+YF LF L V + FP
Sbjct: 122 DYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFP 181

Query: 145 HYFLGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLW 203
           H FL PDF+DLNY PDW +G  F  P++R+ +   +D +      L S  +  LQP LLW
Sbjct: 182 HVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLW 241

Query: 204 QFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELC 263
           Q QK ++V ++    R  VSAR  T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+C
Sbjct: 242 QLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMC 301

Query: 264 PG--SQSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYP----- 316
           PG   +  + LFIS+A + P     P+ET +SL HF+PEEYDSN+YKMFN LLYP     
Sbjct: 302 PGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEND 361

Query: 317 --------NXXXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQ 368
                             E +N+L  +A ++TI+F+E++ +T+ + LP+GV++P++FYPQ
Sbjct: 362 EEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEFYPQ 421

Query: 369 LYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSA 428
           LYT+  K  LI+ V     + + R+ ++L+ +N LKS+QGK+I + L STL ++      
Sbjct: 422 LYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYL-----Q 476

Query: 429 VTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLG 488
            + N   N     +  +K  L+  ++  M EYK ++ K++ +W+LSHPE  II+  ++L 
Sbjct: 477 ASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLR 536

Query: 489 LIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTN-TIRLNTRT 547
           LI+ PYILT A +SP++YF+R R+  W  V          +    + +V    I+  T+ 
Sbjct: 537 LIENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKY 596

Query: 548 ASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           ASETPLMF Y +E  I T E +++A++ NTG + FA+ D++SL+
Sbjct: 597 ASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLR 640

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  433 bits (1114), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/620 (40%), Positives = 367/620 (59%), Gaps = 34/620 (5%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQ 61
           +++++KS++DMGI  DVAI+AL++ NGD+E +VN+IFS ELP            +  +E 
Sbjct: 4   NKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTTSEH 63

Query: 62  GPQKEEDREDSALLEH--------------TEYASVSNGPLEEPERY-RDYTLSTQEEAA 106
                ++   +  L                T+   +S+  + +PE    D + + +  A 
Sbjct: 64  VNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIVENDISNNLKLPAY 123

Query: 107 NEVKNDQE-----DPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDW 161
           N VK++ E     DP VV P   N++ E+YF LF + + +  PH  L PDFKDLNY  +W
Sbjct: 124 NIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEW 183

Query: 162 ARG-QFLKPQFRIKFETNE---DVTIVPRETLTSQD-NLTLQPELLWQFQKFLAVQHSPS 216
             G +F+ P+F IK    E   D      E LT  D +L  QP+LLWQ QK   + +S  
Sbjct: 184 YNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTM 243

Query: 217 SYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQ--SIKELFI 274
           S R  VS++  +  L+     KL +AEHL++VLPSFI+ L +++E+CP  +   I+   I
Sbjct: 244 SERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELI 303

Query: 275 STAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXXVEETQNSLGN 334
           S+AYY P+ +  P++TL++L HF+P+EY+SN+YKMFN LLY +       ++E  NSL  
Sbjct: 304 SSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADDEDGDGAIDEG-NSLNY 362

Query: 335 LASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAH 394
           LA  +TI+FDE+DE +    LP GV +P++FYPQLYT++ K  LIK +     + Q+ + 
Sbjct: 363 LAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQDAQKESR 422

Query: 395 SILKTLNELKSFQGKHIHSFLNSTLDFIARDS---SAVTENPQINDLVDTLQHIKQDLSK 451
             LK LN LKSFQGK I  FLNSTLDF+ RD    + +TE      L++ L  IK+ L+K
Sbjct: 423 QHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGN--GKLMEGLTDIKEQLTK 480

Query: 452 KKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKR 511
           KKT+ M  YK ++ KLN  WNLS+PE+ II   +KLGLIDEPY L+ AV+SP  Y+I+KR
Sbjct: 481 KKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLYYIKKR 540

Query: 512 DSQWYHVLGKQHNDALNVAKTDAET-VTNTIRLNTRTASETPLMFTYFKESAIDTNETLT 570
           D  WY V   ++ D  ++ K  +   + + +R  TR  SETPLMF Y KE +I  ++++ 
Sbjct: 541 DGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETPLMFVYTKEGSIPDDDSVQ 600

Query: 571 EAIEKNTGVTSFAEQDQSSL 590
           + +E NTG   F + DQ  L
Sbjct: 601 KILEANTGCLQFLKDDQKLL 620

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 245/638 (38%), Positives = 372/638 (58%), Gaps = 63/638 (9%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPES----------- 49
           ++E++I SL++MGI RD+AI+ALS+ NG++E +VN+IFS ELP +   S           
Sbjct: 4   LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKA 63

Query: 50  --------KPLQP---LHADAEQGPQKEEDR----EDSALLEHTEYASVSNGPLEEPERY 94
                   +  QP       A Q P + E +    ++S  ++   Y  VS+  ++  + Y
Sbjct: 64  NHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNCY--VSDKIVDNMDYY 121

Query: 95  R---DYTL----------STQEEAANEVKNDQEDPLVVKPESSNALFENYFALFCLAVGL 141
               DY            S Q    ++ K+   DP V+ P   N++ ENYFAL+ L +  
Sbjct: 122 SSDSDYITNSVTDNLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITN 181

Query: 142 GFPHYFLGPDFKDLNYGPDWARGQ-FLKPQFRIKFETNEDVT-----IVPRETLTSQDNL 195
             PH  + PDFKDL++  DW +G  F KP+  +K  T+E  +     I P E +   D+ 
Sbjct: 182 YLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDD- 240

Query: 196 TLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRS 255
             QPELLWQ QK  ++ +S  S R  V A+  +  L+ Q   +L  A+HL++VLPSFI+ 
Sbjct: 241 --QPELLWQLQKLSSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKY 298

Query: 256 LANDVELCPGSQS--IKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNAL 313
           L  ++E CPG +   I++LFIS+A+Y P+ +  PI TL+SL HF+P+EYDSN+YKMFN L
Sbjct: 299 LVVNLESCPGFEEDEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVL 358

Query: 314 LYPNXXXXXXXV---EETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLY 370
           LYP+            E  NSLG+++ +++IVFDE +E +  I LP GVEVP++F+PQ+Y
Sbjct: 359 LYPDENDSDYESGDESEQGNSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIY 418

Query: 371 TEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVT 430
           T+D K  LIK +     + Q ++  IL  +N +KSFQGK I  F+NS+L+++ RD+ +  
Sbjct: 419 TKDCKNKLIKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKS-- 476

Query: 431 ENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLI 490
                +++ + L  IK D++  KT  M EY+ ++ KL N+WN+S+PE  I+E G KLGLI
Sbjct: 477 -----DNITEELLKIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLI 531

Query: 491 DEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAET-VTNTIRLNTRTAS 549
            EPY+L  AV+SP++Y+IR+R  +W  V         +V +  +E  V +TI+  TR AS
Sbjct: 532 GEPYLLVMAVLSPYSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHAS 591

Query: 550 ETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQ 587
           ETPLMF Y +   I     + ++ E N+G  +F ++DQ
Sbjct: 592 ETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQ 629

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  396 bits (1018), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 249/664 (37%), Positives = 364/664 (54%), Gaps = 87/664 (13%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKP----------- 51
           ES++ SLL+MGI+++VAI+AL K +G++E ++NYIFS ++  +  ++ P           
Sbjct: 5   ESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNNPFLEEH 64

Query: 52  --------LQPLHADAEQGPQKEEDREDSALLEHTEYASVSNGPLEEPERYRDYTLSTQE 103
                    +P   D    P+   D +D   L  ++      G L+ P    D T++ + 
Sbjct: 65  TVELSDSKFKPGDLDTVITPRAGGDEKDLIQLSSSDEEE---GSLQNP----DQTVAGET 117

Query: 104 EAAN------------------------------------------EVKNDQEDPLVVKP 121
           E  N                                          E K+D  DP +V P
Sbjct: 118 EKVNIPIDSQSSSYSSFSTSLSNENELRMSENTYNNPPEYSTVQHSERKSDIADPTIVLP 177

Query: 122 ESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFL-KPQFRIKFETNED 180
              N+L ENY AL+ L++   F   FL PDFKDLNY  +W R   + +P +R+KF   ++
Sbjct: 178 LPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKEWYRSSSIDEPFYRVKFNKADE 237

Query: 181 VT--IVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEK 238
               IVP   LT  D+   QP+LLWQ QK +AV +S  S R  VSA+    +   Q+  K
Sbjct: 238 TENEIVPAAELTETDHP--QPKLLWQLQKLIAVVNSDLSERAYVSAKIFNSSSNQQLQSK 295

Query: 239 LNNAEHLHDVLPSFIRSLANDVELCPGSQS--IKELFISTAYYKPASEPVPIETLVSLLH 296
           L +AEHL++VLP FI++LA D+E C G +S  IK+LFIS+A+YKP+      ET +S  H
Sbjct: 296 LGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPSQNEPLQETYLSFFH 355

Query: 297 FMPEEYDSNIYKMFNALLYPNX---XXXXXXVEETQNSLGNLASMITIVFDEMDESTDDI 353
           F+PEEYD+N+YKMFN LL P+           ++  NSL  ++  +TIVF+EMDESTDD 
Sbjct: 356 FLPEEYDTNLYKMFNVLLIPDEDDEESGESDEDQPDNSLNIISPFLTIVFNEMDESTDDN 415

Query: 354 RLP----HGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGK 409
                   GV++P +FYPQLYT+  K  LIK +     E + +   IL+ +N LKS+ GK
Sbjct: 416 MTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGK 475

Query: 410 HIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNN 469
            I  FLNST+DF+ +DS+A  E+    ++   L  ++  ++ +K     EYK +S KL+N
Sbjct: 476 DILMFLNSTIDFLQKDSNA--ESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHN 533

Query: 470 DWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDS--QWYHVLGKQHNDAL 527
           +WNLS+P+L II+  + LGLID PY+LTT VISP+ YF+R R    QW  V         
Sbjct: 534 EWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDF 593

Query: 528 NVAK-TDAETVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQD 586
           ++    D E V+ TI+  T+  +E+PLMF Y KE+ I + + + + IE+N G +SF + D
Sbjct: 594 HITNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKAD 653

Query: 587 QSSL 590
           Q  L
Sbjct: 654 QLHL 657

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  357 bits (915), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/569 (35%), Positives = 319/569 (56%), Gaps = 56/569 (9%)

Query: 67  EDREDSALLEHTEYASVSNGPL----EEPERYRDYTLSTQEEAANEV------------- 109
           E+  DS++    EY      PL     +P  Y+D+T+++ + +                 
Sbjct: 117 ENSSDSSIDSKEEYQ-----PLYLTDTQPPTYQDFTMTSNDNSQQIFVPPVYSKGTYKVQ 171

Query: 110 KNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARG-QFLK 168
           K+  +DP V+     + L  NYF LF +++ L  P  F+GPDF +LN+  +W +G Q   
Sbjct: 172 KSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNFNDNWNKGLQIDT 231

Query: 169 PQFRIKFETN------EDVTIVPRETLTSQDN-LTLQPELLWQFQKFLAVQHSPSSYRKQ 221
           P++ +K+  N      + + IV    L+ ++  LT QP +LWQ QK +++ +S  S R  
Sbjct: 232 PEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQKVISIMNSQISSRAY 291

Query: 222 VSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG--SQSIKELFISTAYY 279
           +S+   +  L+    +KL    HL+D+LP+FIRSL ND +  P      +K +F+S A++
Sbjct: 292 ISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQNRMKNMFVSKAFH 351

Query: 280 KPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLY------------PNXXXXXXXVEE 327
           +      P +  + L HF+PEEYDSN+YKMFN+LLY             N        +E
Sbjct: 352 QIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRTNQNSADSSSSDDE 411

Query: 328 TQN----SLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVT 383
             N    SL  +++++T++FDE+D+ T+ I  P GVE+P +FYP+LYT+  K+ LI  + 
Sbjct: 412 ISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFYPELYTKKCKEKLINGIL 471

Query: 384 KHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQ 443
               + + +   +L  LN LKSF+GK I  FLNSTL+++ RD     E P +N     L 
Sbjct: 472 HTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQRDGK---EGPMVN----KLS 524

Query: 444 HIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISP 503
           ++K+ LS+ KT+ M EYK IS  L N+WN+  PEL IIEQ + LGLI +P++L  AV+SP
Sbjct: 525 YVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLGLIGDPHLLVMAVLSP 584

Query: 504 FNYFIRKRDSQWYHVLGKQHNDALNVAKTDAE-TVTNTIRLNTRTASETPLMFTYFKESA 562
           + YF R R ++W+            + K +++ TV + I+LNT++ASETP+MF Y K+ A
Sbjct: 585 YLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKSASETPIMFVYCKKDA 644

Query: 563 IDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           I  +  + +   KN G ++FA+ D+ SLK
Sbjct: 645 IPNDSLVLQKFAKNQGCSAFAQADEMSLK 673

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 12 MGITRDVAIEALSKTNGDVENSVNYIF 38
          MGI +DVA   L+K  G++E ++N+IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  352 bits (904), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/512 (38%), Positives = 294/512 (57%), Gaps = 30/512 (5%)

Query: 105 AANEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARG 164
           A   +K++ + P ++ P   N++ ENY +LF L   +  P +FL  DFKDLNY  +W +G
Sbjct: 171 AKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKG 230

Query: 165 -QFLKPQFRIKFETNEDVTIVP---------RETL------TSQDNLTLQPELLWQFQKF 208
             F  P+F ++F+++ D T +          R+ +      TS      QP LLWQ QK 
Sbjct: 231 TSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKL 290

Query: 209 LAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGS-- 266
            A+     S R   SAR  +     QV   L+ +++L DVLP FI+S+  D++LCP +  
Sbjct: 291 AAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSD 350

Query: 267 -QSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYP-----NXXX 320
            +S ++LFI++A++ P      +ET ++  HFMPEEY+ N+YKMFN LLYP     N   
Sbjct: 351 DESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNED 410

Query: 321 XXXXVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIK 380
                E   NSL   A +IT++F+E D  T ++    GVE+P+ FYPQLY +  K  LIK
Sbjct: 411 NGEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIK 470

Query: 381 DVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVD 440
            + +   +   R+  +L  + +LKSF+GK I   L S  +++ ++     ENP   +L +
Sbjct: 471 HILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKE-----ENPMGKNLHE 525

Query: 441 TLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAV 500
           T+  I+  +++KK   M EYK +S +L+ DWNLSHPEL IIE  + LGLIDEPY+LTT +
Sbjct: 526 TITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTVI 585

Query: 501 ISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDA-ETVTNTIRLNTRTASETPLMFTYFK 559
           ISP+ Y+IRK+D  WY V          V++ ++   V   I+  T   +ETPLMF + +
Sbjct: 586 ISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETPLMFLFCR 645

Query: 560 ESAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           ES I   +T+ +A+E+N G   FA+QDQ SL+
Sbjct: 646 ESIIPDEDTVRKAMEENLGCLQFAKQDQLSLE 677

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 3/92 (3%)

Query: 5  AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQGPQ 64
           +K+LL+MGI R+VA++AL +T G++E++V +IFS ELPQ   E +P  P++ + +    
Sbjct: 6  TVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQE-QPYIPININDQDPLP 64

Query: 65 KEEDREDSALLEHTEYASV--SNGPLEEPERY 94
           E+D  +         +SV  SN P  E   Y
Sbjct: 65 SEQDLANQDYRSSNTPSSVPGSNNPFRESNNY 96

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  344 bits (882), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/593 (36%), Positives = 325/593 (54%), Gaps = 58/593 (9%)

Query: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGEL----PQQGPESKPLQPLHADAE 60
           A +SL++MGIT +VA  AL +T+G++E +VNYIFSGE+    P   P+S P+      + 
Sbjct: 3   AQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQSAPMPGFAPGSL 62

Query: 61  QGPQKEEDREDSALLEHTEYASVSNG-PLEEPERYRDYTLSTQEEAANEVKNDQEDPLVV 119
            G    +  +D      +    +S   P  +   +   +   + E  +  K+   DP VV
Sbjct: 63  SGVMTNQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSEGVEIEIQSPKKSLVTDPTVV 122

Query: 120 KPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNE 179
            P   ++LFENYFALF L++    PH    P+  DL Y P WA+G               
Sbjct: 123 IP-LPHSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQG--------------- 166

Query: 180 DVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKL 239
                      S D  T     + Q Q+  +V ++  S R  VSA+     L+  +  KL
Sbjct: 167 -----------SSDPST---SFIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKL 212

Query: 240 NNAEHLHDVLPSFIRSLANDVELCP--GSQSIKELFISTAYYKPASEPVPIETLVSLLHF 297
             AEHLH+VLPSFIRSL + +E C       I+ LF+S+A    +SE    ++L+S+L F
Sbjct: 213 AEAEHLHEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSAL---SSE---CKSLLSVLQF 266

Query: 298 MPEEYDSNIYKMFNALLYPNXXXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRLPH 357
           MPEEY+S++Y MFNALLYP         EE+ NSL +LA ++TIVFDEMD  T+ +    
Sbjct: 267 MPEEYESSLYAMFNALLYPELEEG----EESGNSLLDLAPVLTIVFDEMDADTE-VTSNR 321

Query: 358 GVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNS 417
           GV+VP++FYPQLYT+  K ++++ + +     Q+R+  +L  +N LKS+QGK    F+NS
Sbjct: 322 GVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINS 381

Query: 418 TLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPE 477
           TLD++ RD+       Q  +++D L+ +K  ++  KT    EYK +S KL+ +WNLSHP 
Sbjct: 382 TLDYLQRDN-------QSKEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHPT 434

Query: 478 LGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETV 537
             I E  E+ GLIDEPY+L   V+SP +Y  R R  QW  +  +  ++ + ++      V
Sbjct: 435 YLINEAMER-GLIDEPYLLAMVVLSPGHYLQRSRSGQWKMI--RTDSNMIRISDCAPSQV 491

Query: 538 TNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSL 590
             TIR +T   S+TPLM  Y K S +  +  +++++E N G+T+F   DQ  L
Sbjct: 492 QATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQEEL 544

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  343 bits (880), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 229/696 (32%), Positives = 347/696 (49%), Gaps = 113/696 (16%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQ 61
           S  ++ SL++MGI R+VA+ AL + NG++E +V +IFS E+P +  E+  +   +   +Q
Sbjct: 3   SNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTGQQ 62

Query: 62  GPQKEEDRED----------SALLEHTEYASVSNGPLEEPERYRDYTLSTQEE------- 104
            P +   R +          S   EH       N P  +    ++Y  ++ +E       
Sbjct: 63  EPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQHG 122

Query: 105 ------AANEVKNDQE--------------------------------DPLVVKPESSNA 126
                   N  +ND+                                 DP ++ P   N+
Sbjct: 123 EDRDDDGDNIQENDESTFSSSSTSSQSPAPSPPNYNVVTYTQLKARVTDPTIILPVPMNS 182

Query: 127 LFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLK-PQFRIKFETNEDV---- 181
           L ENY AL  LA+ +  P  FL PDFKDLNY  DW +G  L  P + +K + + D     
Sbjct: 183 LLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADDEG 242

Query: 182 TIVPRET--------LTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEP 233
              P +T          +Q N  +QP+LLWQ QK ++V +S  S R  +S +  +  L P
Sbjct: 243 VSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGLTP 302

Query: 234 QVVEKLNNAEHLHDVLPSFIRSLANDVELCP---GSQ----------------------- 267
            V   L N E+L DVLP F +SLA ++E C    GS                        
Sbjct: 303 DVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNGNSEERM 362

Query: 268 --SIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXX-XXXX 324
              ++ LF+STA Y+ A+    ++T V+ L F PEEY+SN+YKMFN LL+P         
Sbjct: 363 RGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSKTA 422

Query: 325 VEETQ----NSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIK 380
           V E        L  +A + T+VF  MD +TD++ LP GV++PM+FYPQLYT   + +L++
Sbjct: 423 VSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDALVR 482

Query: 381 DVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVD 440
           DV     E  + +  +L+  N+L+SFQGK I  FL ST+D++ +D  + T+  +   +++
Sbjct: 483 DVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILE 542

Query: 441 TLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLI-DEPYILTTA 499
           TL      ++  K   M +YKA+S  L    N+SHPE+ II+Q +   LI DEPY+LT A
Sbjct: 543 TL------INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMA 596

Query: 500 VISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTNT---IRLNTRTASETPLMFT 556
           VISP  YFIR R  +WY V     +    +  T+ E++ N    I+  T  A+E PLMF 
Sbjct: 597 VISPLAYFIRNRQGKWYLVRFNMISTEFQI--TECESIRNVQTAIKQCTIHANEEPLMFI 654

Query: 557 YFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKI 592
           Y ++SAI  +  + + +E N G   F++ DQ +L +
Sbjct: 655 YCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDV 690

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 213/666 (31%), Positives = 322/666 (48%), Gaps = 90/666 (13%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQ-------QGPESKPLQP- 54
           + A+ SL +MGI  DVA++AL + NG++  +VNYIFS ++P        Q  ES  L+P 
Sbjct: 5   QDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSDLKPG 64

Query: 55  -----LHADAEQGPQ---------------KEEDREDSALLEHTEYASVSNGPLEE---- 90
                L      GPQ                +ED   +  L+  +   V +  L E    
Sbjct: 65  DLDQVLRESQRTGPQLNQLVQLDSHPAADTNDEDTGGNIYLDEDDNIEVGSVQLNEVSPA 124

Query: 91  -------------------PERYRDYTLSTQEEAANEVKNDQEDPLVVKPESSNALFENY 131
                              P  Y    +   EE A       E P      ++     NY
Sbjct: 125 TSIPPNSDIGSSPDDGTGDPPEYGGCKVPAAEEGA-------ERPDSGAAPAAERYATNY 177

Query: 132 FALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNED---VTIVPRET 188
             LF  AV    P  F+  DFK+LNY  +W  G  ++    I  +   D     IVP E 
Sbjct: 178 LVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPEEE 237

Query: 189 LTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDV 248
           +TS  +  +QPE+LWQ Q+ ++V HS  S R  VSA+  TK  + +V   + +++HL++ 
Sbjct: 238 VTS--DTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEA 295

Query: 249 LPSFIRSLANDVELCPGSQS---IKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSN 305
           LPSFI+S+  D E+CP   S   +K +F+S+A         P ET + L HF PEEY++N
Sbjct: 296 LPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNAN 355

Query: 306 IYKMFNALLYPNXXXXXXXVE----------ETQNSLGNLASMITIVFDEMDEST----- 350
           +YKMFNALLYP                    + + SL  LA ++TI+F+E D        
Sbjct: 356 LYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQLSAGA 415

Query: 351 --DDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILKTLNELKSFQG 408
               I  P GVEVP  FYPQLYT + K+ ++K + +     +      L  +N+LKS++G
Sbjct: 416 QDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKSYEG 475

Query: 409 KHIHSFLNSTLDFIA-RDSSAVTENPQINDLVDTLQH---IKQDLSKKKTDGMAEYKAIS 464
           K   +FL    + +A R   +   +   N++ + +Q    IK  L++++     +Y  +S
Sbjct: 476 KGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYVDLS 535

Query: 465 HKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRD--SQWYHVLGKQ 522
           +KL N+WN+S+PE  +I + ++LGL+D+P++L+  V+SP+ Y +R     S W  V    
Sbjct: 536 NKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQSNS 595

Query: 523 HN-DALNVAKTDAETVTNTIRLNTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTS 581
           +  D L       E V   IR  T+TA++ PLMF Y +E    + E    AIEKN G + 
Sbjct: 596 YGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMGCSE 655

Query: 582 FAEQDQ 587
           F + DQ
Sbjct: 656 FNKADQ 661

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  299 bits (766), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 220/631 (34%), Positives = 326/631 (51%), Gaps = 86/631 (13%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-------GELPQQGPESKPL--Q 53
           E  ++SLL+MGI RDVA +AL + NGDVE ++NYIF+         +  Q   S P+  Q
Sbjct: 4   EGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEIDNDAMAGQQMGSVPVGTQ 63

Query: 54  PLHADA-----EQGPQKEEDREDSALLEHT------------EYASVSNGPLEEPERYRD 96
            +  D+     E  P + +   +  L++                 S S+  LE+ +    
Sbjct: 64  GIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDSDSSSSLEQSQ---- 119

Query: 97  YTLSTQEEAANEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKD-- 154
           YT S  +    + KN  + P VV P  +      Y ALF L + +  PHYF+  D  D  
Sbjct: 120 YT-SIDDLIPQQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYFVKADHDDMP 178

Query: 155 LNYGPDWARGQFLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHS 214
           L + PDW           I  E  ++  +V R+                Q  K +AVQ+S
Sbjct: 179 LLFSPDWFND--------IDREPEDEPLLVLRD----------------QLHKLIAVQNS 214

Query: 215 PS-SYRKQVSARYLTKAL-------EPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGS 266
              S R  V+++     L       EP +     N  HL+ +LPSFI+++AN       S
Sbjct: 215 NDHSARAFVTSKMFDVDLQSVIQSNEPMLTNP--NYFHLYQILPSFIKTIAN------LS 266

Query: 267 QSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNXXXXXXXVE 326
            + K LFIS+A           E+L+SL HF+PEEY+SN+YKMFN LLYP+        E
Sbjct: 267 YTEKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDHDIGEDE 326

Query: 327 E--TQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTK 384
           +  ++NSL  LA ++TI+F+E +   ++  + +GVEVP+KFYPQLYT+  K  LI  V  
Sbjct: 327 DEVSENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLYTKKCKDQLISHVLS 386

Query: 385 HAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQH 444
              +G++    ILK +  LKS+QGK I SF+NS+LD++ +D          + + + L  
Sbjct: 387 KRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTKDKDD-------SGIAEELHK 439

Query: 445 IKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPF 504
           +K +L+ KKT+ M  YK IS K++ +WN+ +PEL I+E   KLGLIDEPY L  AV+SPF
Sbjct: 440 LKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAVVSPF 499

Query: 505 NYFIRKRDSQWYHVLGKQHN---DALNVAKTDAET-VTNTIRLNTRTASETPLMFTYFKE 560
            YF+R R  +WY V     N   D ++V K D    V   ++ +T   + TPLMF Y K+
Sbjct: 500 FYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLMFVYSKD 559

Query: 561 SAIDTNETLTEAIEKNTGVTSFAEQDQSSLK 591
           S +  +  + E + +N  +  F +QDQ  L+
Sbjct: 560 SYMADDTEMQELLSQNKTLLDFFKQDQIYLQ 590

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  271 bits (694), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 292/526 (55%), Gaps = 27/526 (5%)

Query: 81  ASVSNGPLEEPERYRDYTLSTQEEAANEVKNDQEDPLVVKPESSNALFENYFALFCLAVG 140
           +S ++G    P R  +  L+T  E  +  K D    + + P+ S+AL E+YF LF L + 
Sbjct: 21  SSSNDGITSLPSRLPNSLLNTTIE--HWWKKDPSQLVGILPKGSSALLESYFPLFALCMA 78

Query: 141 LGFPHYFLGPDFKDLNYGPDWARGQFLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPE 200
           +  P  FL  DFK+L Y P W +G+ ++  +R+       + I  RE LT  + L +QPE
Sbjct: 79  VNVPTKFLNVDFKELVYNPHWFKGELVQSDYRLVHRNAGPLLIHKRE-LTGSEYLEMQPE 137

Query: 201 LLWQFQKFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDV 260
           L+ + Q  + + + P S R+ V++  + K  +  V   L+  +HL +V P FI++L ND+
Sbjct: 138 LIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSRALSECDHLSEVFPQFIKNLHNDM 197

Query: 261 ELC-PGSQSIKELFISTAYYKP-ASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNX 318
           +LC    +S  +LF+S A ++P   EP    T +S+L+F PE Y   +Y+MFN +L P  
Sbjct: 198 DLCLKDDKSTSKLFLSKALHRPNVLEPFQ-PTSLSVLNFSPENYAYTLYEMFNPMLLPED 256

Query: 319 XXXXXXVEETQNSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSL 378
                 +E   N+   LA + TI+FD+MD++T+++ L HGV++P++FYPQLYT++A + +
Sbjct: 257 SGRGYEIE---NAFDFLAPVFTIIFDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKV 313

Query: 379 IKDVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDL 438
           +  V +     +      +  ++ L+SFQGK I SFLNS+++++  +   + +  +  +L
Sbjct: 314 VVPVLEETDALRNTNKLKVDQMSSLQSFQGKQISSFLNSSINYL--EEIPLGDEDKSKEL 371

Query: 439 VDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTT 498
           VDTL+ IK  LS KK + MA+Y     +++   +   P   II+  +++G+IDEPY+L  
Sbjct: 372 VDTLEKIKYQLSNKKREMMADYTETQRQIDL-LSFEGPSEKIIDLAKQVGIIDEPYLLRL 430

Query: 499 AVISPFNYFIRKRDS---------------QWYHVLGKQHNDALNVAKTDAETVTNTIRL 543
            V SP +Y I +  S               Q+   + +  + +L   +  A+   +  + 
Sbjct: 431 VVFSPNDYIIARGISADDGNTGMETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKS 490

Query: 544 NTRTASETPLMFTYFKESAIDTNETLTEAIEKNTGVTSFAEQDQSS 589
           +TR ASETP++F Y K+  ID  + +  +I +N  +T+F +++ ++
Sbjct: 491 HTRHASETPILFVYIKKDHIDAPQDILASISENETLTNFLKEEHTT 536

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  249 bits (636), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/509 (31%), Positives = 255/509 (50%), Gaps = 68/509 (13%)

Query: 115 DPLVVKPESSNALFENYFALFCLAVGLGFP-HYFLGPDFKDLNYGPDWARGQFLKPQFRI 173
           DP V+ P S N L ENY +LF  ++ +  P   F    F DL Y   W            
Sbjct: 183 DPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY----------- 231

Query: 174 KFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEP 233
                         ++++ +  T    L  Q Q+  ++ +S  S R  +S +  + A   
Sbjct: 232 --------------SISNNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNK 277

Query: 234 QVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVS 293
            +   L+ ++HL+++   FI SL   V L P     K++ ++TA  K +       + +S
Sbjct: 278 DLNYLLSQSDHLNEIFNPFIESLVTTV-LPPI---FKDILVTTAINKDSQTNEIFRSPIS 333

Query: 294 LLHFMPEEYDSNIYKMFNALLYPNXXXXXXXVEETQN--------------SLGNLASMI 339
           +++F+PEEY+SN+YKMFN L+YPN        +  ++              +L  ++ + 
Sbjct: 334 MINFLPEEYESNLYKMFNNLVYPNEYGRNDDEQSDESLQTDDDDNDDANDSALEEISPIF 393

Query: 340 TIVFDEMDES-TDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILK 398
           TI+F+E DES +    LP GVE+P++FYPQLY++     LIK +     E Q ++ S+L 
Sbjct: 394 TILFEEYDESDSSSTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLN 453

Query: 399 TLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMA 458
            +N LKSFQGK I   L ST+D+I +DS   T++       + L +I  ++   K   M 
Sbjct: 454 EINSLKSFQGKDIMKILQSTIDYIEKDSQRETKS------ANNLTNILTEMKNCKNLKMD 507

Query: 459 EYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHV 518
           +YK ++ KL+++WNLSHPE  IIE  ++L LID PY L+  + SP  Y I+K +  WY +
Sbjct: 508 QYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLI 567

Query: 519 LGKQHN----------------DALNVAKTDAET-VTNTIRLNTRTASETPLMFTYFKES 561
             +  N                D   + K ++E  + + I+  TR  SETPLMF Y KES
Sbjct: 568 DCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKES 627

Query: 562 AIDTNETLTEAIEKNTGVTSFAEQDQSSL 590
            +   + + ++ E N   T F ++DQ +L
Sbjct: 628 FLPNEDDVMKSFESNMACTKFLKEDQLTL 656

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%)

Query: 6  IKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQP 54
          I++L+DMGI  DVA  AL   NG+VE +VNYIFS ELP Q  +   L P
Sbjct: 7  IQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPP 55

>KNAG0G01580 Chr7 (352916..354136) [1221 bp, 406 aa] {ON} Anc_8.185
           YER143W
          Length = 406

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           SE+AI  L+D+G TR   I+AL  T G+ E + +Y+F
Sbjct: 369 SEAAINQLMDLGFTRTEVIKALDMTGGNAELAASYLF 405

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 27/37 (72%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           +ES IK L+D+G +R  AI AL+KT G+V+ + + +F
Sbjct: 377 AESDIKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK L+D+G  RD  ++AL +TNG+ E + + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 36/55 (65%), Gaps = 5/55 (9%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF-----SGELPQQGPESK 50
           ++E ++ S++ MG+ ++++ +AL   NGD+  S+ ++F     +GELP++   S+
Sbjct: 640 INEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEENTASQ 694

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 5/50 (10%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQQ 45
           + + AI S+  MG+   +  +AL   NGDV +SV+++F+     GELPQ+
Sbjct: 648 IDQEAISSMTAMGLDAKLCKKALILNNGDVTSSVDWVFNNMDDDGELPQK 697

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK L+D+G  RD  + AL +TNG+ E + + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 6/56 (10%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQ-QGPESK 50
           + E+++ S+L MG+  ++  +AL   NGDV  SV +IF+     G LP  +GP  +
Sbjct: 650 VDETSLTSILSMGLNPNLCRKALILNNGDVNRSVEWIFNNMDDDGRLPDPEGPTGR 705

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 5/48 (10%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF-----SGELP 43
           + E ++ S+L MG++  +  +AL   NGDV  SV ++F     +GELP
Sbjct: 650 VDEDSLASMLSMGLSPKLCRKALIINNGDVNRSVEWVFNNMDDNGELP 697

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 4   SAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQQGPESK 50
           +++ S+L MG+   +  +AL   +GDV  SV ++F+     GELP++ P +K
Sbjct: 655 NSLNSMLSMGLDPKLCRKALILNSGDVNRSVEWVFNNMDDDGELPKEEPTTK 706

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK L+D+G  RD  ++AL +T G+ E + + +F
Sbjct: 392 EQTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>Kpol_526.23 s526 (62128..63399) [1272 bp, 423 aa] {ON}
           (62128..63399) [1272 nt, 424 aa]
          Length = 423

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           ES IK L+D+G +R   I+AL++T G+ E + + +F
Sbjct: 387 ESTIKKLMDLGFSRAEVIKALTQTGGNAEFAASLLF 422

>CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143w DDI1 induced in response to DNA alkylation
           damage
          Length = 426

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK L+D+G +R   I+AL  TNG+ E + + +F
Sbjct: 390 EKTIKQLMDLGFSRQEVIQALVSTNGNAEFAASLLF 425

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK L+D+G  RD  ++AL +TNG+ + + + +F
Sbjct: 392 EKTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>ZYRO0G06864g Chr7 complement(548758..550014) [1257 bp, 418 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 418

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS 39
           ES IK L D+G +R  AI AL +T+G+ E + + +F 
Sbjct: 382 ESNIKQLTDLGFSRSEAINALDQTDGNAELAASLLFG 418

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 31/50 (62%), Gaps = 5/50 (10%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF-----SGELPQQ 45
           + + ++ +++DMG+   ++I+AL    GD+  S+ ++F     +GELP +
Sbjct: 665 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSE 714

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAE 60
           + E+++ S+  MG+  ++  +AL   NGDV  SV ++F+  +   G  S+P  P     E
Sbjct: 650 VDEASLASMQSMGLNPNLCRKALIINNGDVSRSVEWVFNN-MDDDGKLSEPEVP----TE 704

Query: 61  QGPQKEED 68
           Q  Q+++D
Sbjct: 705 QQQQRQKD 712

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 27/38 (71%), Gaps = 1/38 (2%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKT-NGDVENSVNYIF 38
           ++ +I  LL+MG T++ ++ AL  T N D E+++N++F
Sbjct: 587 NQCSISQLLEMGFTQNASVRALFNTGNQDAESAMNWLF 624

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  + S++ MG +++ A+ AL  T  +VE ++N+IF
Sbjct: 585 EDKVISIISMGFSKNAALRALYNTGSEVERALNWIF 620

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS 39
           E+ IK L+D+G +R+  I+AL  T G+ + + +++F+
Sbjct: 380 ENTIKQLMDLGFSRNEVIKALDATGGNADFAASFLFN 416

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQ 44
           A+ S+  MG+   +  +AL   NGDV  SV ++FS     GELP+
Sbjct: 637 ALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPE 681

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E+ IK L+D+G  R+  I AL++T G+ E +   +F
Sbjct: 426 ENTIKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>TBLA0A08670 Chr1 complement(2127049..2128395) [1347 bp, 448 aa]
           {ON} Anc_8.185 YER143W
          Length = 448

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS 39
           E+ IK L+D+G ++   + AL  TNG+ E + + +FS
Sbjct: 411 EATIKQLMDLGFSKMEVVHALDMTNGNAEMAASLLFS 447

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 1   MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS 39
           + E ++ S+L MG+  ++  +AL   NGDV  SV ++F+
Sbjct: 650 VDEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFN 688

>TPHA0D04300 Chr4 (928596..929870) [1275 bp, 424 aa] {ON} Anc_8.185
           YER143W
          Length = 424

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 26/37 (70%)

Query: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           S+  I+ L ++G +R  A++AL +TNG+VE + + +F
Sbjct: 387 SDETIRQLTNLGFSRAEALKALDQTNGNVEFAASLLF 423

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 3   ESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           E  IK + D+G TR  AI AL++T G+ E +   +F
Sbjct: 436 EPLIKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
           AI+ L  MG T D A++AL K N D++ + N++ 
Sbjct: 841 AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLL 874

>CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} similar to
            uniprot|P34216 Saccharomyces cerevisiae YBL047c
          Length = 1311

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 5    AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIF 38
            A++ L+ MG   D A++AL K+N D+E + N + 
Sbjct: 1275 AVEELMGMGFKEDEAVKALEKSNWDLETATNLLL 1308

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {ON}
           Anc_2.649 YKL012W
          Length = 658

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 207 KFLAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGS 266
           ++  V   PS +++Q+  +YL+   E Q++++ N     HD     ++S  ++++     
Sbjct: 209 RYWVVDDDPS-WKQQIFEKYLSNRSEDQLIKESNEISKFHDAFILMLKS-KSEIKYYTRW 266

Query: 267 QSIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNA 312
            + K +F        A+EP+ + + VS  H   + Y   I  + NA
Sbjct: 267 GTAKRIF--------ANEPIYVHSAVS-KHIQKKVYKEYIDSLINA 303

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 6   IKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQQ 45
           + ++  MG+   ++++AL    GDV  SV ++F+     GELPQ+
Sbjct: 652 LANMTAMGLDEKLSLKALVLNKGDVNRSVEWVFNNMDDDGELPQE 696

>KNAG0M01500 Chr13 (265547..266653) [1107 bp, 368 aa] {ON} Anc_5.300
           YDR289C
          Length = 368

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 171 FRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKA 230
           F   F+T   +  V  ET+  QD  T++ EL+ + QK   +Q + +  + Q+    +  A
Sbjct: 199 FMENFKTVSKIGKVATETI--QDRQTVRNELISKLQKLFEIQRA-ALEQDQIMLNEIDFA 255

Query: 231 LEPQVVEKLNNAEHLHDVLPSF 252
           L+ +  E++N    + DVLP++
Sbjct: 256 LDSKDPEQVNQDAAIEDVLPTY 277

>Suva_11.161 Chr11 (300508..303420) [2913 bp, 970 aa] {ON} YKL064W
           (REAL)
          Length = 970

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 381 DVTKHAGEGQQRAHSILKTLNE----LKSFQGKHIHSFLNSTLDFIARDSSAVTENPQIN 436
           D+ +  GE ++R  SIL+ L      +K F  ++   +  S    IA     + +   I 
Sbjct: 813 DMLRRIGECRKRVMSILRLLGSKADVIKGFAKRYNEQWEASPQSEIAMYLGDIQD--HIV 870

Query: 437 DLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYIL 496
            +V +L H ++ LS+  ++ +A+      K+NND N       ++ +   LG I  P  +
Sbjct: 871 TMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMN------DVLGKITILGTIVLPMNV 924

Query: 497 TTA-----VISPFNYFIRKRDS-QWY 516
            T      VI P  Y    RDS  W+
Sbjct: 925 ITGLWGMNVIVPGQY----RDSLTWF 946

>YKL064W Chr11 (317764..320673) [2910 bp, 969 aa] {ON}  MNR2Vacuolar
           membrane protein required for magnesium homeostasis;
           putative magnesium transporter; has similarity to Alr1p
           and Alr2p, which mediate influx of Mg2+ and other
           divalent cations
          Length = 969

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 381 DVTKHAGEGQQRAHSILKTLNE----LKSFQGKHIHSFLNSTLDFIARDSSAVTENPQIN 436
           D+ +  GE ++R  SIL+ L      +K F  ++   +  S    IA     + +   I 
Sbjct: 812 DMLRRIGECRKRVMSILRLLGSKADVIKGFAKRYNEQWEASPQSEIAMYLGDIQD--HIV 869

Query: 437 DLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYIL 496
            +V +L H ++ LS+  ++ +A+      K+NND N       ++ +   LG I  P  +
Sbjct: 870 TMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMN------DVLGKITILGTIVLPMNV 923

Query: 497 TTA-----VISPFNYFIRKRDS-QWY 516
            T      VI P  Y    RDS  W+
Sbjct: 924 ITGLWGMNVIVPGQY----RDSLTWF 945

>KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1148

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 233 PQVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTA---YYK---PASEP 285
           P V E +N  E + DV+P+   S AND+    G+ S K   I++A   Y++   P S+P
Sbjct: 60  PGVEESMNEIEEIKDVIPNLTDSQANDLLQKAGTSSDKRERIASAVEIYFENHGPQSKP 118

>Smik_11.184 Chr11 (304067..306988) [2922 bp, 973 aa] {ON} YKL064W
           (REAL)
          Length = 973

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 22/146 (15%)

Query: 381 DVTKHAGEGQQRAHSILKTLNE----LKSFQGKHIHSFLNSTLDFIARDSSAVTENPQIN 436
           D+ +  GE ++R  SIL+ L      +K F  ++   +  S    IA     + +   I 
Sbjct: 816 DMLRRIGECRKRVMSILRLLGSKADVIKGFAKRYNEQWEASPQSEIAMYLGDIQD--HIV 873

Query: 437 DLVDTLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYIL 496
            +V +L H ++ LS+  ++ +A+      K+NND N       ++ +   LG I  P  +
Sbjct: 874 TMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMN------DVLGKITILGTIVLPMNV 927

Query: 497 TTA-----VISPFNYFIRKRDS-QWY 516
            T      VI P  Y    RDS  W+
Sbjct: 928 ITGLWGMNVIVPGQY----RDSLTWF 949

>NCAS0F01160 Chr6 (229393..230943) [1551 bp, 516 aa] {ON} Anc_5.545
           YDR434W
          Length = 516

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 21/128 (16%)

Query: 189 LTSQDNLTLQPELLWQFQKF------LAVQHSPSSYRKQVSARYLTKALEPQVVEKLNNA 242
           +T+  NL    E LW   K       +AV   PS     V+      +L  Q++E LNN 
Sbjct: 373 ITTLSNLQKATETLWSLIKLTKSFEQMAV---PSDVMTNVTKAL---SLRLQIIELLNNP 426

Query: 243 EHLHDVLPSFIRSLAND-VELCPGS----QSIKELFI----STAYYKPASEPVPIETLVS 293
           E   D++ +   SL+N  V LC  +    + +++ F       A Y P   P+ + TL+ 
Sbjct: 427 EKGGDLVWNEALSLSNTLVSLCETAFFHGEMVQQNFFPQEHKVAVYLPLIGPLTVVTLLG 486

Query: 294 LLHFMPEE 301
            ++ M E+
Sbjct: 487 FINIMKEK 494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,789,761
Number of extensions: 3119566
Number of successful extensions: 9775
Number of sequences better than 10.0: 92
Number of HSP's gapped: 10094
Number of HSP's successfully gapped: 105
Length of query: 604
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 489
Effective length of database: 40,294,809
Effective search space: 19704161601
Effective search space used: 19704161601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)