Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212483.496ON2222229881e-137
KLTH0F14938g3.496ON2292307142e-95
SAKL0F02618g3.496ON2532534565e-56
Smik_16.4033.496ON2031503578e-42
ZYRO0D09812g3.496ON1851663542e-41
YPR151C (SUE1)3.496ON2061483518e-41
Suva_16.4793.496ON2121483511e-40
Kpol_1017.43.496ON1841563393e-39
Skud_16.4453.496ON2151483362e-38
KNAG0A079603.496ON1771383072e-34
KLLA0E03983g3.496ON1911422994e-33
TPHA0D033003.496ON1961482994e-33
NDAI0B058903.496ON2781392984e-32
TDEL0D056403.496ON1241572362e-24
CAGL0L08426g3.496ON1401492032e-19
NCAS0F035703.496ON2301391943e-17
Ecym_12333.496ON87521731e-15
TBLA0D029403.496ON71511702e-15
KAFR0G037103.496ON79511537e-13
ZYRO0F07480g8.682ON2361461381e-09
YPL159C (PET20)8.682ON2531581346e-09
AFR315C3.496ON77421212e-08
Smik_6.3568.682ON2531421293e-08
Suva_16.1518.682ON2531571259e-08
Skud_16.1238.682ON2551571232e-07
TDEL0A062708.682ON2421581213e-07
KNAG0J017608.682ON2581601214e-07
KLLA0D06061g8.682ON2491561126e-06
Kpol_1013.98.682ON2611461082e-05
Kpol_1072.128.682ON2221401046e-05
TPHA0G015708.682ON2551361037e-05
Kwal_26.88288.682ON2231481029e-05
KLTH0D11396g8.682ON225154974e-04
NCAS0C013108.682ON257140966e-04
TPHA0D012908.682ON218130920.002
NDAI0K013208.682ON258150910.003
SAKL0H06380g8.682ON21928900.003
TBLA0B038008.682ON32427810.059
TDEL0E007103.62ON476130810.062
KLLA0A07447g3.62ON486160810.073
Ecym_23908.682ON22727760.18
SAKL0C12342g3.62ON552130760.27
CAGL0M02101g8.682ON267140750.31
Kwal_23.52773.62ON470163750.39
NCAS0A099403.62ON49438750.41
KAFR0H023808.682ON22037720.59
Suva_14.443.62ON525158711.3
ZYRO0C02244g3.62ON46028692.3
Kpol_1066.443.62ON47927682.7
Skud_14.423.62ON52434683.1
Smik_14.363.62ON524130683.1
YNL295W3.62ON52434656.0
TPHA0P012603.62ON49428657.5
KLTH0A01364g3.62ON47641648.2
TBLA0B027208.798ON50238648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21248
         (222 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   385   e-137
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   279   2e-95
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   180   5e-56
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   142   8e-42
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   140   2e-41
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   139   8e-41
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   139   1e-40
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   135   3e-39
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   134   2e-38
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   122   2e-34
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   119   4e-33
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   119   4e-33
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   119   4e-32
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    96   2e-24
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    83   2e-19
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    79   3e-17
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    71   1e-15
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    70   2e-15
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    64   7e-13
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    58   1e-09
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    56   6e-09
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    51   2e-08
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    54   3e-08
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    53   9e-08
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    52   2e-07
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    51   3e-07
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    51   4e-07
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    48   6e-06
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    46   2e-05
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    45   6e-05
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    44   7e-05
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    44   9e-05
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    42   4e-04
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    42   6e-04
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    40   0.002
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    40   0.003
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    39   0.003
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    36   0.059
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    36   0.062
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    36   0.073
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    34   0.18 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    34   0.27 
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    33   0.31 
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    33   0.39 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    33   0.41 
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    32   0.59 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    32   1.3  
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   2.3  
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    31   2.7  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    31   3.1  
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    31   3.1  
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    30   6.0  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    30   7.5  
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    29   8.2  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    29   8.6  

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  385 bits (988), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/222 (86%), Positives = 193/222 (86%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP
Sbjct: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
           LFKETGWKTQRLREEPGSDTALTAAKESSKNAMA               TWRYNPRIPSK
Sbjct: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSK 120

Query: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPERPDNAGGDSEATSASDTPXXXX 180
           LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPERPDNAGGDSEATSASDTP    
Sbjct: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPERPDNAGGDSEATSASDTPAVQA 180

Query: 181 XXXXXXXXXXRKRKSSSEGSQDRKLSKQVGQFINYLREKDRG 222
                     RKRKSSSEGSQDRKLSKQVGQFINYLREKDRG
Sbjct: 181 AQAAQAKQHARKRKSSSEGSQDRKLSKQVGQFINYLREKDRG 222

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  279 bits (714), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 149/230 (64%), Positives = 162/230 (70%), Gaps = 9/230 (3%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           MA KRQF +EASKMLKR+SS+IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP
Sbjct: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
           LFKE GWKTQRLR E G+  + T  + S  NAMA               TWRYNPRIPSK
Sbjct: 61  LFKEAGWKTQRLRGERGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSK 120

Query: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPERP------DNAGGDSEATSASD 174
           LLP++LWS TSMAMEYHPEWLAVPRTVVNKLRPF SP RP      D   G S   +A+ 
Sbjct: 121 LLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESPHRPVAERSTDCKAGSSPTVTAAA 180

Query: 175 TPXXXXXXXXXXXXX--XRKRKSSSEGSQDRKLSKQVGQFINYLREKDRG 222
                             RKRK +  G +D KLSKQVG+FINYLREKDRG
Sbjct: 181 VAPATALPATGARAKAPARKRKPAEHG-EDNKLSKQVGEFINYLREKDRG 229

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  180 bits (456), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 138/253 (54%), Gaps = 35/253 (13%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           M Q R F   A+ M+K+++SDIFR LPKVPTTQ+LEP ELTRDIL+SGYRPV YPVKENP
Sbjct: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60

Query: 61  LFKETGWKTQRLREEPGS-----DTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNP 115
            F   G + + L  E  +     + A    ++   N MA               TWRYNP
Sbjct: 61  FF-NIGTQRKGLAGETSAKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNP 119

Query: 116 RIPSKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSP------------------ 157
           RIP+KLLP++LWSS++MAMEY+PEWL VP+T+ NKL+PF+ P                  
Sbjct: 120 RIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAF 179

Query: 158 -----ERPDNAGGDSEATSASDTPXXX-----XXXXXXXXXXXRKRKSSSEGSQDRKLSK 207
                E+   A  +      SD                     RK+K + +   D+KLSK
Sbjct: 180 NGVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGK-FLDKKLSK 238

Query: 208 QVGQFINYLREKD 220
           QV QFI YL+EK+
Sbjct: 239 QVDQFIKYLKEKE 251

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  142 bits (357), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 94/150 (62%), Gaps = 3/150 (2%)

Query: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQ 70
           +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ 
Sbjct: 41  SSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSL 100

Query: 71  RL---REEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLW 127
           ++    +E     A T  K   KN +                TW+YNP +P++LLPF+ W
Sbjct: 101 QMLLTADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWW 160

Query: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFNSP 157
           S++SM MEY PEW  +P  +  KL+PF+ P
Sbjct: 161 STSSMGMEYFPEWRNIPSYMTRKLKPFDKP 190

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  140 bits (354), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 96/166 (57%), Gaps = 11/166 (6%)

Query: 1   MAQKRQFCVEASKMLKRR--SSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKE 58
           M  KR F     +  KR+  SSDIFRS+P+VPTTQ+LE  ELTRDIL+SGYRPV+YPVKE
Sbjct: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60

Query: 59  NPLFKE---TGWKTQRLREEP------GSDTALTAAKESSKNAMAXXXXXXXXXXXXXXX 109
           NPLFKE    G  T  L+         G             + +A               
Sbjct: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASG 120

Query: 110 TWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFN 155
           TWR   ++PSKLLP+S WS+TSM ME+ PEW  VPR VV KL+PF+
Sbjct: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  139 bits (351), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 93/148 (62%), Gaps = 3/148 (2%)

Query: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF---KETGW 67
           +SK+LK      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF   K    
Sbjct: 43  SSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSL 102

Query: 68  KTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLW 127
           +T     E  +  A T  ++  KN +                TW+YNP +P++LLPF+ W
Sbjct: 103 QTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWW 162

Query: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 163 STSSMGMEYFPEWKNVPPYMMRKLKPFD 190

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  139 bits (351), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 94/148 (63%), Gaps = 5/148 (3%)

Query: 12  SKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQR 71
           SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++   K+ +
Sbjct: 51  SKLFKNAHFFDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQ 110

Query: 72  LR----EEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLW 127
           +     E+P ++   T   E  KN                  TW+YNP +P++LLP++ W
Sbjct: 111 MLLASDEKPATEAKATEKSE-HKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWW 169

Query: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 170 STSSMGMEYFPEWKNVPSYMMRKLKPFD 197

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  135 bits (339), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 95/156 (60%), Gaps = 16/156 (10%)

Query: 14  MLKRRSSD---IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETG---- 66
           M ++ SSD   IFRSLP+VPTTQ+LE   LT DIL+SGYRP+ YPVKENPLF+ TG    
Sbjct: 24  MKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKN 83

Query: 67  -WKTQRLREEPGSDTALTAAKESSK-------NAMAXXXXXXXXXXXXXXXTWRYNPRIP 118
            +    +  E  S+ A +  +E  K       N ++               TWR+NPR+P
Sbjct: 84  IFGQDLVNAESNSNDA-SLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVP 142

Query: 119 SKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPF 154
           SKLLP+S WS++ M MEY+PEW  +PR VV  L+P+
Sbjct: 143 SKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  134 bits (336), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (62%), Gaps = 3/148 (2%)

Query: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKT- 69
           +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++    + 
Sbjct: 50  SSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSL 109

Query: 70  QRLREEPGSDTALTAA--KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLW 127
           Q L     +  A   A  K+  KN +                TW+YNP +P++LLPF+ W
Sbjct: 110 QMLLAPDEAPAAEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWW 169

Query: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 170 STSSMGMEYFPEWKNVPSYMMRKLKPFD 197

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  122 bits (307), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 85/138 (61%), Gaps = 6/138 (4%)

Query: 22  IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTA 81
           +FR LPKVP T+YLE  EL +DILYSGYRPV+YPV+ENPLF+ +  K   +   P  DT 
Sbjct: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSN-KLMAI-SHPEHDTE 88

Query: 82  LTAA----KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYH 137
            T       ++    +                TW+Y P+IP K+LPF+ WS++S+AME +
Sbjct: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148

Query: 138 PEWLAVPRTVVNKLRPFN 155
           PEW +VP+ VV  L+PF+
Sbjct: 149 PEWSSVPKHVVKGLKPFD 166

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  119 bits (299), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 3/142 (2%)

Query: 16  KRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREE 75
           K +++ ++R LP+VPTT++L P ELT DIL+SGYRP++ P+++NPLF+    + +  RE+
Sbjct: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64

Query: 76  PGSD---TALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSM 132
            G     +    A E     MA               TWRYNPRIP+KLL  +LWSS++M
Sbjct: 65  NGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAM 124

Query: 133 AMEYHPEWLAVPRTVVNKLRPF 154
            ME++PEW  VP  V   L+P+
Sbjct: 125 GMEFYPEWNDVPNKVSASLKPY 146

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  119 bits (299), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 86/148 (58%), Gaps = 10/148 (6%)

Query: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETG------WKTQRLR 73
           + IF++LP+VPTT+YLE  +LT DIL+SGYRP+ YPVKENPLF+           TQ  +
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 74  EEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMA 133
           E+  ++  L      + + +                TW+YNP +P  LLP++ WS++ M 
Sbjct: 108 EK--NNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMG 165

Query: 134 MEYHPEWLAVPRTVVNKLRPF--NSPER 159
           MEY+PEW  VPR  +  L+PF  N P R
Sbjct: 166 MEYYPEWNNVPRRFLKTLKPFEVNEPLR 193

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  119 bits (298), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSD 79
           ++IFR++PKVP T+YLE  EL++D+LYSGYRP++YPVKENPLF+ T  K         + 
Sbjct: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTT 185

Query: 80  TALTAAKESSKNAMAXXX---XXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEY 136
           ++ ++ K+  +                      TWRY+PRIP+ LLP  +WS + M MEY
Sbjct: 186 SSSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEY 245

Query: 137 HPEWLAVPRTVVNKLRPFN 155
           +PEW  VP  +V  L+PF+
Sbjct: 246 YPEWKGVPFNIVKNLKPFD 264

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 95.5 bits (236), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 83/157 (52%), Gaps = 46/157 (29%)

Query: 5   RQFCVEASKMLKRRS--SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62
           R+F   +S++ +R+S   D+FR+LP+VPTT++LE   L+ DIL+SGYRPV+YPV+ENPLF
Sbjct: 12  RRFST-SSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF 70

Query: 63  KETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLL 122
              G KT    E P S                                      + S L 
Sbjct: 71  GR-GTKT----EAPAS--------------------------------------LESNLP 87

Query: 123 PFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPER 159
            + LWS+T+M +E  PEW  VPR VV KLRPF+   R
Sbjct: 88  RYDLWSTTTMGLERFPEWSNVPREVVRKLRPFDRHHR 124

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 76/149 (51%), Gaps = 30/149 (20%)

Query: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPL-----------FKET 65
           +R ++IFR LPKVP T+YLE   L+ D+LY+GYRP++YP++ENPL           + E+
Sbjct: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGES 61

Query: 66  GWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFS 125
             + Q+  EEP ++           + M                        PSK +   
Sbjct: 62  SNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-----------------PSK-VKLG 103

Query: 126 LWSSTSMAMEYHPEWLAVPRTVVNKLRPF 154
           L S + M MEY+PEW  VPR VV +++P+
Sbjct: 104 L-SYSIMGMEYYPEWEKVPRDVVKRIKPY 131

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 72/139 (51%), Gaps = 33/139 (23%)

Query: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEP 76
           + S++IFR LPKVP T+YLE  +L+++IL++GY+P++YPV+ENPLFK    K +  + E 
Sbjct: 112 KYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK-LKIKQEDAKREN 170

Query: 77  GSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEY 136
           G++     +  S K                                   +WS++ + ++ 
Sbjct: 171 GNEKRALGSSVSHKYK--------------------------------GIWSTSILGLQD 198

Query: 137 HPEWLAVPRTVVNKLRPFN 155
           +PEW  VP   +  L+PF+
Sbjct: 199 YPEWNNVPWNNIKNLKPFD 217

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 40/52 (76%)

Query: 14 MLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKET 65
          M+K +  +I R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLF+ +
Sbjct: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSS 52

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 13 KMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK 63
          +++ R S  + R LP+VPTT+YLE   L  DI +SGYRPV+YPVKENPLF+
Sbjct: 6  QVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 63.5 bits (153), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 42/51 (82%), Gaps = 1/51 (1%)

Query: 17 RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP-LFKETG 66
          R  S + ++LP+VPTT+YL+ ++L  DILY+GYRPV+YP+KENP L+++ G
Sbjct: 2  RGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNG 52

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 38/146 (26%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           LP+VP+T YL P +++  ILYSGYRP+      NP                  D   T+ 
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP------------------DELKTSQ 125

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAVPR 145
              + N  A                + +  ++  +L   SLW+S++   E +PEW  VP 
Sbjct: 126 DGGNANNGAR--------------LYEFAMKL-EELGEQSLWTSSATGQEIYPEWDYVPM 170

Query: 146 TVVNKLRPFNSPERPDNAGGDSEATS 171
            V  KL+PFN+P  P N   ++E  S
Sbjct: 171 EVQRKLKPFNAPA-PFNVDKEAEKNS 195

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 43/158 (27%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           + +K    V  S + K+RS   F  LP+VP+T +L+ +++T ++LYSGYRP+      NP
Sbjct: 80  ITKKEHSDVRGSHLKKKRSD--FSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFI----NP 133

Query: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
                     +L+E+ GS     A K    N                             
Sbjct: 134 -------NDPKLKEDTGSTLYEFAMKLEDLNE---------------------------- 158

Query: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPE 158
             P S W S++  +E+  EW  +P  ++  L+PF+ P+
Sbjct: 159 --PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPPK 194

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 22 IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK 63
           FR LP+VP+TQ+L   ++  DIL+S +RP+ YPV +NPL +
Sbjct: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 42/142 (29%)

Query: 16  KRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREE 75
           K++ SD F  LPKVP+T +L+ +++T ++LYSGYRP+      NP          +L+E+
Sbjct: 94  KKKRSD-FSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP-------NDPKLKED 141

Query: 76  PGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAME 135
            GS     A K    N                               P S W S++  +E
Sbjct: 142 TGSTLYEFAMKLEDLNE------------------------------PLSPWISSATGLE 171

Query: 136 YHPEWLAVPRTVVNKLRPFNSP 157
           +  EW  +P  ++  L+PF+ P
Sbjct: 172 FFSEWDNIPSELLRNLKPFHPP 193

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 67/157 (42%), Gaps = 43/157 (27%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           +A+     + AS   K+R    F  LP+VP+T +L+ +++T ++LYSGYRP+      NP
Sbjct: 80  IAKTDSTNIRASHSRKKRRD--FSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI----NP 133

Query: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
                     +L+E+ GS     A K    N                             
Sbjct: 134 -------NDPKLKEDTGSTLYEFAMKLDDLNE---------------------------- 158

Query: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSP 157
             P S W S++  +E+  EW  +P  ++  L+PF+ P
Sbjct: 159 --PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 43/157 (27%)

Query: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60
           +A+     + AS   K+R    F  LP+VP+T +L+  ++T ++LYSGYRP+      NP
Sbjct: 80  IAKNDSTSIRASHPRKKRRD--FSWLPRVPSTSHLKHTDMTTNVLYSGYRPLFI----NP 133

Query: 61  LFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK 120
                     +L+E+ GS     A K    N                             
Sbjct: 134 -------NDPKLKEDTGSTLYEFAMKLEDLNE---------------------------- 158

Query: 121 LLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSP 157
             P S W S++  +E+  EW  +P  ++  L+PF+ P
Sbjct: 159 --PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 39/158 (24%)

Query: 2   AQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPL 61
           +Q+++  VE S   +++    +  LP+VP+T  L+P +++  +LYSGYRP+      NP 
Sbjct: 72  SQQKKMTVEISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPLFI----NPD 127

Query: 62  FKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKL 121
             +T           GS T  T  + + K                             +L
Sbjct: 128 EIKT--------SSEGSGTGGTLYEFAMK---------------------------LEEL 152

Query: 122 LPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPER 159
              S W +++  +EY+ EW ++P  +  KL+PF +PE+
Sbjct: 153 GDQSPWVTSATGLEYYREWDSIPGELQKKLKPFTAPEQ 190

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 36/160 (22%)

Query: 15  LKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLRE 74
           L+ R    +  LP VP+TQ++E  ++  ++LYSGYRP+                     +
Sbjct: 85  LRTRKKYRYHPLPSVPSTQHIEANDMCTELLYSGYRPLFL-------------------D 125

Query: 75  EPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLL-PFSLWSSTSMA 133
               +  L AAKE +                    T      I  KL  P  +W++++  
Sbjct: 126 STALERGLLAAKEQA------------SFTQSASPTGSTFYEIAMKLEDPACIWANSATG 173

Query: 134 MEYHPEWLAVPRTVVNKLRPFNSPERPDNAGGDSEATSAS 173
           +E + EW  +P +V N L+PF     P ++GG +   +A+
Sbjct: 174 LEKYTEWDNIPYSVANSLKPF----VPPSSGGHAAVKAAA 209

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 62/156 (39%), Gaps = 55/156 (35%)

Query: 13  KMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIY---PVKENPLFKETGWKT 69
           KM  ++ S  +  LP+VPTT+++   E   D+LYSGYRP++      KEN L  +   K 
Sbjct: 99  KMATKKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLM-QFAMKL 157

Query: 70  QRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSS 129
           ++L E                                          +P        W S
Sbjct: 158 EKLSEP-----------------------------------------VP--------WVS 168

Query: 130 TSMAMEYHPEWLAVPRTVVNKLRPFNSP--ERPDNA 163
           ++   E+  EW  VP  ++  L+PF+ P  E  +NA
Sbjct: 169 SATGQEFFSEWDNVPSEIIKDLKPFHPPSIEETNNA 204

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 55/146 (37%), Gaps = 38/146 (26%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           LPKVP+T+ L   E+    LYSGYRP+                                +
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIY-----------------------------INS 142

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAVPR 145
           K S KN ++                   NP         S W S++  ME + EW  VP 
Sbjct: 143 KGSGKNKLSGTMKNGVNSTFYEIAMKLENP---------SPWMSSATGMELYSEWDHVPL 193

Query: 146 TVVNKLRPFNSPERPDNAGGDSEATS 171
            V+  L+PF+ PE  ++   +S+  S
Sbjct: 194 DVLKDLKPFHPPEETNSDPSNSDLES 219

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 56/140 (40%), Gaps = 42/140 (30%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV-IYPVK-ENPLFKETGWKTQRLREEPGSDTALT 83
           LPKVP+ + L   ++T DI YSG+RP+ I P + EN     + W    L       T  +
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTELENKDEDSSTWYEVSL-------TLDS 149

Query: 84  AAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAV 143
               S  N+                                 +W+S++  ME + EW +V
Sbjct: 150 PVPPSGHNS---------------------------------IWTSSATGMERYREWHSV 176

Query: 144 PRTVVNKLRPFNSPERPDNA 163
           P  V+N L PF  P+   N 
Sbjct: 177 PEEVINSLTPFQPPDIDGNV 196

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 55/136 (40%), Gaps = 38/136 (27%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTAL 82
           + SLPK PTT +L  +E   D+ YSGYRP+   +  N L  E        +E P +   +
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPL--SIDVNQLASE--------QENPCTCYEI 152

Query: 83  TAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLA 142
           + + +  K  +                                 W  ++   E + EW  
Sbjct: 153 SLSMDIVKKNLKVSTP----------------------------WLFSATGSELYKEWDN 184

Query: 143 VPRTVVNKLRPFNSPE 158
           +P++V++ L+ F+ P+
Sbjct: 185 IPKSVLDNLKCFHPPQ 200

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 48/148 (32%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRP-VIYPVKENPLFKETGWKTQRLREEPGSDTA 81
           F  LPK P+T +L+  +++  +LYSGYRP V+ P                  ++  +D+ 
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPA-----------------DQKQTDST 124

Query: 82  LTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWL 141
           L                            + +  ++ S   P   W S++   E++ EW 
Sbjct: 125 L----------------------------YEFAMKLESLGDPLP-WISSATGTEFYGEWD 155

Query: 142 AVPRTVVNKLRPFNSPERPDNAGGDSEA 169
            VP  V+ +LRPF  P   D A  D +A
Sbjct: 156 GVPADVIKQLRPFQPPA-DDGASKDKKA 182

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 62/154 (40%), Gaps = 47/154 (30%)

Query: 16  KRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREE 75
           K+R +D F  LPK P+T +L+  +++  +LYSGYRP +                    E+
Sbjct: 76  KQRKTD-FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSS----------------EQ 118

Query: 76  PGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAME 135
             +D+ L                            + +  ++ +   P    SS +   E
Sbjct: 119 KQTDSTL----------------------------YEFAMKLEALGDPLPWISSAT-GTE 149

Query: 136 YHPEWLAVPRTVVNKLRPFNSPERPDNAGGDSEA 169
           ++ EW  +P  V+ KLRPF  P   D A  D EA
Sbjct: 150 FYGEWDNIPADVIKKLRPFQPPT-DDPAAKDKEA 182

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 56/140 (40%), Gaps = 28/140 (20%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTAL 82
           + +LPKV     L   E++ DILYSGYRP+    K+         +    + E G+    
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD--------LENSSRKAEFGNSNNS 138

Query: 83  TAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTS-MAMEYHPEWL 141
           T  + + K                       +P   S     + W STS   ME   EW 
Sbjct: 139 TLYEIAMK-------------------LDDLSPEAISGSTSSNFWHSTSATGMEVFDEWD 179

Query: 142 AVPRTVVNKLRPFNSPERPD 161
            VP +++  L+PF +P + +
Sbjct: 180 NVPNSILKNLKPFQAPVKKN 199

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 52/130 (40%), Gaps = 35/130 (26%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           LPKVP T  +   E+T + LYSGYRP+    K+  L  +             + TA  A 
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDV------------NSTAQDAN 142

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPEWLAVPR 145
               + AM                         ++L   S W  ++  +E + EW  VP 
Sbjct: 143 SSIYEFAMKL-----------------------NELSEPSPWMMSATGLESYSEWDYVPS 179

Query: 146 TVVNKLRPFN 155
            V+ KL+P++
Sbjct: 180 KVIKKLKPYD 189

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 58/150 (38%), Gaps = 46/150 (30%)

Query: 15  LKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLRE 74
           L+R+    F  LPK+     L   +++  +LYSGYRP+  P   N  F       Q+ ++
Sbjct: 83  LQRKKVLNFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSF-------QQGQK 132

Query: 75  EPGSDTALTAAK----ESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSST 130
             GS     A K    +  KN+                                ++W ++
Sbjct: 133 NNGSTLYEFAMKLDEFKKDKNS--------------------------------TIWDTS 160

Query: 131 SMAMEYHPEWLAVPRTVVNKLRPFNSPERP 160
           +  +E   EW  VP +V+  L+PF  P  P
Sbjct: 161 ATGVETFTEWDNVPESVIRNLKPFQKPTSP 190

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVI 53
           LPK P+T++L+  E++ D+ YSGYRP+ 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIF 110

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 127 WSSTSMAMEYHPEWLAVPRTVVNKLRPFNSP 157
           W S++   E++ EW  VP  V+ KL+PF  P
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPFQPP 169

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 35.8 bits (81), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV 52
           LPKVPT + L+  ++  ++LYSGYRP+
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPL 193

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 127 WSSTSMAMEYHPEWLAVPRTVVNKLRPFNSPE 158
           W S++  +E + EW ++P  V+ KL+P  SP+
Sbjct: 235 WMSSAAGLEVYSEWDSIPIEVLKKLKPLQSPQ 266

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 6/130 (4%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           LP+VP+T Y+   E+  + L++GYRP+   +  + L  ET  +T  L     S   L   
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF--LGNSSLRPET--RTNALDNFFTSFANLKVT 130

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPE-WLAVP 144
            ES  +A                     N +  ++  P   W ++   M Y+   +  VP
Sbjct: 131 SESKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNR-KPIIPWDASISGMVYNDHSFKDVP 189

Query: 145 RTVVNKLRPF 154
           ++VV+KL+PF
Sbjct: 190 KSVVSKLKPF 199

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 18/160 (11%)

Query: 16  KRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREE 75
           K+R ++    +P+VP+T YL   +L  + L++GY+P+   +  +PL  E+      L   
Sbjct: 80  KKRKAEKSFLVPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL--ESNNNDVLLDGL 135

Query: 76  PGSDTALTAAKESSKNA-----MAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSST 130
             S   L  A+ +S+N      ++                    P+IP        W ++
Sbjct: 136 FSSIRKLKNAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDAS 187

Query: 131 SMAMEYHPE-WLAVPRTVVNKLRPFNSPERPDNAGGDSEA 169
              + Y+ E +  VPR+VV+KL+PF           D EA
Sbjct: 188 ISGLVYNDEPFKGVPRSVVSKLKPFKLVRVEKKNSKDKEA 227

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV 52
            P  P T++L+  ++  D+LYSGYRP+
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPL 115

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 51/130 (39%), Gaps = 10/130 (7%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           +P VP T Y+  +E+  + L++GY+P+            +    +R     G  T+LT  
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPL--------FLGNSSLDEKRADVLDGLFTSLTKI 212

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHP-EWLAVP 144
           K+ +                    T     +  S   P   W ++   M Y+   +  VP
Sbjct: 213 KKGTSAPNGEINVQEILDDLQKDDTME-TLKEKSHKKPVIPWDASISGMVYNDLPFKDVP 271

Query: 145 RTVVNKLRPF 154
           R VV KL+PF
Sbjct: 272 RNVVGKLKPF 281

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/140 (20%), Positives = 46/140 (32%), Gaps = 53/140 (37%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPV-----KENPLFKETGWKTQRLREEPG 77
           + +LP+V      +   ++ ++LYSGYRP+ + V     +E     E   K +  +E   
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMKLEEFQE--- 169

Query: 78  SDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYH 137
                                                          S W S++   E +
Sbjct: 170 ---------------------------------------------AMSPWVSSATGSEMY 184

Query: 138 PEWLAVPRTVVNKLRPFNSP 157
            EW  VP  V+  L+PF  P
Sbjct: 185 AEWDNVPGDVIKDLKPFTPP 204

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 68/163 (41%), Gaps = 36/163 (22%)

Query: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPV----IYPVKENPLFKETGWKTQRL 72
           RRS  +F   PKV +T +L+  E+  + L++G +P+    + P  + P           L
Sbjct: 74  RRSIYLF---PKVHSTDHLKQDEVHTEGLFAGNKPLFLGDLSPGPKRP--------NNAL 122

Query: 73  REEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSK--------LLPF 124
               G+ T +  A E SK                       +P +P+K        ++P 
Sbjct: 123 EGIFGTLTKIKRATEDSKGQEINIQSILKDLQSE-------DPEVPAKDSDIAEKAVIP- 174

Query: 125 SLWSSTSMAMEYHPE-WLAVPRTVVNKLRPFN--SPERPDNAG 164
             W ++   M Y+ E +  VPR VV+KL+PF     ER   AG
Sbjct: 175 --WDASISGMVYNDEPFKHVPRAVVSKLKPFKLFRIERKSTAG 215

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 5/38 (13%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV-----IYPVKE 58
           +PKVPTT Y+   E+  + L++GY+P+     + PVK+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKK 107

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 32.3 bits (72), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 23  FRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKEN 59
           + +LP+VP+T  ++  +L  ++L+S YRP+   +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 68/158 (43%), Gaps = 4/158 (2%)

Query: 1   MAQKRQFCVEASKMLKRRS---SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVK 57
           ++Q+R+  ++ S   ++++   S++   +PKV +T ++   E+  + L++GYRP+     
Sbjct: 84  LSQQRKQLLDISSSGRQKTTTGSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLFLGNS 143

Query: 58  ENPLFKETGWKTQRLREEPGSDTALTAAKESSKNAMAXXXXXXXXXXXXXXXTWRYNPRI 117
             P     G     L E   +   + A+++  K  +                +       
Sbjct: 144 SFPSDVRKGKNFHDLDEVLPNIQLVDASEKDGKLNVQEIIEDLQRTSLRESISNMEQSSS 203

Query: 118 PSKLLPFSLWSSTSMAMEYHPE-WLAVPRTVVNKLRPF 154
             K  P   W ++   M Y+   +  +P+ VV+KL+PF
Sbjct: 204 SHKRRPVIPWDASISGMVYNDMPFKHIPKNVVSKLKPF 241

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 26 LPKVPTTQYLEPAELTRDILYSGYRPVI 53
          +P+VP T Y+   E+  + L++GYRP+ 
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPLF 85

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPV 52
           LP+VP+T+ +   E+  D L++GYRP+
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPL 100

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVI 53
           S++   +PKV +T+Y+   E+  + L++GYRP+ 
Sbjct: 105 SNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPLF 138

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 1/130 (0%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTALTAA 85
           +PKV +T +++  E+  + L++GYRP+       P     G     L +   +   + A+
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFHELGDVLPNIQVIDAS 170

Query: 86  KESSKNAMAXXXXXXXXXXXXXXXTWRYNPRIPSKLLPFSLWSSTSMAMEYHPE-WLAVP 144
           ++  K  M                          K  P   W ++   M Y+   +  VP
Sbjct: 171 EKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIPWDASISGMVYNDMPFKHVP 230

Query: 145 RTVVNKLRPF 154
           ++VV +++PF
Sbjct: 231 KSVVLRMKPF 240

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVI 53
           S++   +P+V +T Y+   E+  + L++GYRP+ 
Sbjct: 105 SNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLF 138

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 26  LPKVPTTQYLEPAELTRDILYSGYRPVI 53
           +PKV +T  L  AE+  + L++GYRP+ 
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLF 116

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 127 WSSTSMAMEYHPE-WLAVPRTVVNKLRPFN--SPERPDNAG 164
           W ++   M Y+ + +  VPR VVNKL+PF     ER + +G
Sbjct: 181 WDASISGMVYNDQPFKQVPRGVVNKLKPFKLLKIERKNKSG 221

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSG--YRPV 52
           ++   I+  LP +P T YL    L +DI+ SG  Y P+
Sbjct: 267 KKGQMIYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPI 304

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,226,174
Number of extensions: 710326
Number of successful extensions: 1467
Number of sequences better than 10.0: 59
Number of HSP's gapped: 1453
Number of HSP's successfully gapped: 81
Length of query: 222
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 117
Effective length of database: 41,441,469
Effective search space: 4848651873
Effective search space used: 4848651873
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)