Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.21247na 1ON1341346971e-95
Kwal_23.2807singletonON1291285224e-69
KLTH0F14916gna 1ON1511344862e-63
ZYRO0C18436gsingletonON1291274731e-61
KLLA0E04005gna 1ON1371354611e-59
KLLA0B14817gsingletonON1311264434e-57
SAKL0F02684gna 1ON1381284351e-55
SAKL0F16654gsingletonON1311264297e-55
KLTH0C11880gsingletonON1311274132e-52
TDEL0D00210singletonON1301263811e-47
ZYRO0D09856gna 1ON1561263343e-40
KLTH0E03168gsingletonON1481253264e-39
SAKL0F02640gsingletonON1161163201e-38
Kwal_47.16590singletonON1261243184e-38
YER057C (HMF1)7.238ON129991612e-14
ZYRO0C08074g7.238ON1431031604e-14
KAFR0L008607.238ON128991577e-14
NCAS0E032407.238ON1281031578e-14
TDEL0H020607.238ON1771031608e-14
Skud_5.1717.238ON1291021551e-13
Smik_5.1877.238ON1291021533e-13
Suva_5.1657.238ON1291021525e-13
NDAI0E047507.238ON1281031525e-13
Kpol_1033.127.238ON1431281501e-12
KNAG0D016207.238ON1421011491e-12
ADL077C7.238ON1421011492e-12
TPHA0C011007.238ON1421031492e-12
CAGL0M12386g7.238ON1421031473e-12
KAFR0I018307.238ON143991473e-12
NCAS0A134907.238ON148991457e-12
TBLA0D040907.238ON1551061432e-11
NDAI0A025507.238ON1441031422e-11
SAKL0F08558g7.238ON1441031413e-11
Skud_9.1187.238ON1451041379e-11
KLLA0C08349g7.238ON1401031361e-10
Smik_9.1397.238ON1451001361e-10
YIL051C (MMF1)7.238ON1451001342e-10
KNAG0L014507.238ON1311021324e-10
TPHA0K009207.238ON128981315e-10
Kpol_1009.257.238ON1271011315e-10
Suva_9.1487.238ON1451041326e-10
KLTH0A04224g7.238ON1411051317e-10
Kwal_23.58047.238ON141971239e-09
ZYRO0F14014g8.349ON669761234e-08
TBLA0J014207.238ON1261051132e-07
CAGL0M04521g8.349ON688831023e-05
TDEL0F047308.349ON694671023e-05
Kpol_1036.868.349ON69766962e-04
SAKL0H14938g8.349ON69187860.004
Skud_12.2148.349ON68465830.009
TPHA0C006508.349ON71167830.009
Suva_10.2398.349ON68983830.010
AGL164W8.349ON68665820.014
TBLA0A041108.349ON695116800.024
Kwal_27.113108.349ON68892800.024
NCAS0C031508.349ON68974800.030
KLTH0G11594g8.349ON68465780.049
KNAG0A028708.349ON70482760.091
Smik_12.2098.349ON68465750.11
YLR143W8.349ON68565730.25
ZYRO0C01980g8.248ON125156710.40
KLLA0D16984g8.349ON69678652.8
KLTH0G07106g5.268ON49148643.2
Ecym_42238.349ON69183643.2
YBR043C (QDR3)3.245ON68994643.2
Skud_2.1553.245ON68894634.5
Skud_3.1456.340ON51540634.8
NCAS0D03530singletonON34146625.3
NDAI0B006605.5ON32257626.1
KAFR0H021508.349ON70283626.5
Skud_4.252.41ON61354626.6
CAGL0K04741g2.41ON61354616.9
CAGL0C05379g2.41ON61354616.9
TBLA0B00420singletonON33838617.4
AFR326W7.123aON130949617.4
NDAI0E020502.441ON69076617.5
Skud_14.1682.92ON111061618.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21247
         (134 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   273   1e-95
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   205   4e-69
KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   191   2e-63
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   186   1e-61
KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   182   1e-59
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   175   4e-57
SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   172   1e-55
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   169   7e-55
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   163   2e-52
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 151   1e-47
ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...   133   3e-40
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...   130   4e-39
SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...   127   1e-38
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...   127   4e-38
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    67   2e-14
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    66   4e-14
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    65   7e-14
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      65   8e-14
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    66   8e-14
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    64   1e-13
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    64   3e-13
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    63   5e-13
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    63   5e-13
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    62   1e-12
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    62   1e-12
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    62   2e-12
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    62   2e-12
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    61   3e-12
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    61   3e-12
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    60   7e-12
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    60   2e-11
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    59   2e-11
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    59   3e-11
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    57   9e-11
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    57   1e-10
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    57   1e-10
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    56   2e-10
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    55   4e-10
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    55   5e-10
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    55   5e-10
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    55   6e-10
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    55   7e-10
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    52   9e-09
ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} simi...    52   4e-08
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    48   2e-07
CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} simil...    44   3e-05
TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.3...    44   3e-05
Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON} (2251...    42   2e-04
SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]...    38   0.004
Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143...    37   0.009
TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {O...    37   0.009
Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143...    37   0.010
AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic ho...    36   0.014
TBLA0A04110 Chr1 (1019317..1021404) [2088 bp, 695 aa] {ON} Anc_8...    35   0.024
Kwal_27.11310 s27 (742973..745039) [2067 bp, 688 aa] {ON} YLR143...    35   0.024
NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {O...    35   0.030
KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {...    35   0.049
KNAG0A02870 Chr1 complement(342659..344773) [2115 bp, 704 aa] {O...    34   0.091
Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143...    33   0.11 
YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative p...    33   0.25 
ZYRO0C01980g Chr3 (153854..157609) [3756 bp, 1251 aa] {ON} simil...    32   0.40 
KLLA0D16984g Chr4 (1439669..1441759) [2091 bp, 696 aa] {ON} simi...    30   2.8  
KLTH0G07106g Chr7 (568012..569487) [1476 bp, 491 aa] {ON} simila...    29   3.2  
Ecym_4223 Chr4 complement(465547..467622) [2076 bp, 691 aa] {ON}...    29   3.2  
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    29   3.2  
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    29   4.5  
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    29   4.8  
NCAS0D03530 Chr4 (657458..658483) [1026 bp, 341 aa] {ON}               28   5.3  
NDAI0B00660 Chr2 complement(148409..149377) [969 bp, 322 aa] {ON...    28   6.1  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    28   6.5  
Skud_4.25 Chr4 (41208..43049) [1842 bp, 613 aa] {ON} YNL209W (REAL)    28   6.6  
CAGL0K04741g Chr11 complement(463860..465701) [1842 bp, 613 aa] ...    28   6.9  
CAGL0C05379g Chr3 complement(512277..514118) [1842 bp, 613 aa] {...    28   6.9  
TBLA0B00420 Chr2 (80517..81533) [1017 bp, 338 aa] {ON}                 28   7.4  
AFR326W Chr6 (1025588..1029517) [3930 bp, 1309 aa] {ON} Non-synt...    28   7.4  
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    28   7.5  
Skud_14.168 Chr14 complement(317492..320824) [3333 bp, 1110 aa] ...    28   8.5  

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  273 bits (697), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN 60
           MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN
Sbjct: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN 60

Query: 61  LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE 120
           LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE
Sbjct: 61  LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE 120

Query: 121 LECIAEAGPAKPKF 134
           LECIAEAGPAKPKF
Sbjct: 121 LECIAEAGPAKPKF 134

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  205 bits (522), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 102/128 (79%), Positives = 110/128 (85%), Gaps = 1/128 (0%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNS-DLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           MA+QV W  VGPGKGY IL+PAYV S S DLVFTSGCVGTDPVTG LP DLEQQ+ NALE
Sbjct: 1   MAKQVQWSAVGPGKGYDILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALE 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NLKNVL ASGSSLE+V+KVLLFVSD SYA  VN+VYS YFP APARSCIVV+FP  +LKV
Sbjct: 61  NLKNVLHASGSSLERVLKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALKV 120

Query: 120 ELECIAEA 127
           ELECIAEA
Sbjct: 121 ELECIAEA 128

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  191 bits (486), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 88/134 (65%), Positives = 110/134 (82%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN 60
           MA++VTW+EVG  KG  +L+PA+VTS S LVFTSGC+G+DPVT ELP DLEQQ RNAL+N
Sbjct: 16  MAKKVTWQEVGATKGIDLLSPAFVTSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQN 75

Query: 61  LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE 120
           L+NVL ASGS+ ++V+KVLLFV+DG+Y+  VN++Y E FP +PARSC+VVSFPN  +KVE
Sbjct: 76  LRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVE 135

Query: 121 LECIAEAGPAKPKF 134
           LECIAE  P    F
Sbjct: 136 LECIAEVQPKARWF 149

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  186 bits (473), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/127 (70%), Positives = 108/127 (85%), Gaps = 1/127 (0%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSD-LVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           M  Q+TW +VGP  G  +L+PAYVT+++  LVFTSGCVGTDP TG L  +L+QQVRNALE
Sbjct: 1   MPTQITWNQVGPLGGSSLLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALE 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NLKNVL+ASGSS++ V+KVLLFV+DGS+A  VNK+Y EYFPGAPARSCIVVSFP+  LKV
Sbjct: 61  NLKNVLKASGSSIDNVLKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLKV 120

Query: 120 ELECIAE 126
           ELECIA+
Sbjct: 121 ELECIAQ 127

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  182 bits (461), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 109/135 (80%), Gaps = 2/135 (1%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           MAR++TWK+VG   G+P+++P + T S + L+F+SGCVGTDPVT ELP DLEQQ RN++ 
Sbjct: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NLK VL  SGSS++ V+K+LLFVSDGSYA  VNKV+ E+FP  PARSCIVV+FPN  LKV
Sbjct: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120

Query: 120 ELECIAEAGPAKPKF 134
           ELECIAE  P+K ++
Sbjct: 121 ELECIAEI-PSKKRW 134

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  175 bits (443), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (81%), Gaps = 1/126 (0%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTS-NSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           M R+V WKEVG   G   LAPAYVTS +++LV+TSGCVG+D +TGE+P DLE+QVRNAL+
Sbjct: 1   MVRRVEWKEVGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALD 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NL  VL+AS SS + V+K+LLFV+DGSYA  VN VY EYFP  PARSCIVVSFP+ +LKV
Sbjct: 61  NLGRVLKASNSSFDDVLKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLKV 120

Query: 120 ELECIA 125
           ELEC+A
Sbjct: 121 ELECVA 126

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  172 bits (435), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 84/128 (65%), Positives = 101/128 (78%), Gaps = 2/128 (1%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           M  + TWK++G  +   +L+PA+VT SN+ LV+TSGCVGTDP TGELP DLEQQ RNA+E
Sbjct: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60

Query: 60  NLKNVLRASG-SSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLK 118
           NL+ VL  SG SSL+QV+KVLLFV+DG YAP VNKVY EYF   P RSC+VV FPN  +K
Sbjct: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120

Query: 119 VELECIAE 126
           VELEC+AE
Sbjct: 121 VELECVAE 128

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  169 bits (429), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 100/126 (79%), Gaps = 1/126 (0%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTS-NSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           MAR++ W +VG   G+ +L+P ++ S + D++FTSG VGTDP +GE+P DL  Q +NALE
Sbjct: 1   MARKIEWNQVGVTSGHALLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALE 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NLK  L A GSSL+ V+KVLLFV+DGSYA  VN+VY EYFPG+PARSCIVVSFP+  LK+
Sbjct: 61  NLKTTLEAGGSSLDNVLKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLKL 120

Query: 120 ELECIA 125
           ELECIA
Sbjct: 121 ELECIA 126

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  163 bits (413), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 97/127 (76%), Gaps = 1/127 (0%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTS-NSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           M R++ W+EVG   G   L+P  V+S N DL+FTSGCVG DP+TGE P D+E Q RNA+E
Sbjct: 1   MVRKLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAME 60

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           N+K VL ++ S+ + V+K LLF+SD SYA AVNKVY E+FPG P+RSCIVVSFP+  LK 
Sbjct: 61  NMKRVLESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLKF 120

Query: 120 ELECIAE 126
           E+EC+AE
Sbjct: 121 EMECVAE 127

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  151 bits (381), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTS-NSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           MA Q+ W++V  G  + +L+P YVT+ NS L+FTSGCVGTD  +G+L   +E Q + ALE
Sbjct: 1   MATQIQWEDVN-GPSHSLLSPGYVTAKNSQLLFTSGCVGTDK-SGKLAEGVEAQTKLALE 58

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NLK VL A GSSL  V+KVLLFV DGSYA AVN VY EYFPG P RSC+VV+FP+ ++KV
Sbjct: 59  NLKVVLEAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIKV 118

Query: 120 ELECIA 125
           ELEC+A
Sbjct: 119 ELECVA 124

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score =  133 bits (334), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 70/126 (55%), Positives = 90/126 (71%), Gaps = 5/126 (3%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSD-LVFTSGCVGTDPVTGELPTDLEQQVRNALE 59
           M+R V W ++G     P+L+PA+V S++  LVFTSGC+GTD    +LP    +Q +NA E
Sbjct: 26  MSR-VDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFE 81

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           NL  VL ASGSSL  VIKVLLFV D +  P VN++Y +YFP  PARSCIVV+FPN  ++V
Sbjct: 82  NLSKVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQV 141

Query: 120 ELECIA 125
           ELEC+A
Sbjct: 142 ELECVA 147

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score =  130 bits (326), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 1   MARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALEN 60
           +A+++TW+ +  GK +P L+PA+V++    VFTSG +G+   TGE+   +E QV  A++N
Sbjct: 24  VAKKITWESI-EGKEHPTLSPAFVSNGH--VFTSGIIGSKYGTGEVSQQIEDQVHLAIQN 80

Query: 61  LKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVE 120
           L+NVL  +GSSLEQV KV +F+S   Y+  VN++Y +YFP  PARSC+VV+F +A++K E
Sbjct: 81  LENVLAVAGSSLEQVFKVTMFISHAEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYE 140

Query: 121 LECIA 125
           LE +A
Sbjct: 141 LEAVA 145

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score =  127 bits (320), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 84/116 (72%), Gaps = 2/116 (1%)

Query: 18  ILAPAYV-TSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASG-SSLEQV 75
           + + A++ TSN+ LV+TSGCVGTDP TGELP DLEQQ RNA+ENL+ VL  SG SSL+QV
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 76  IKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVELECIAEAGPAK 131
           +KVLLFV+DG Y P  NKVY +YF     +S  VV F N  +K+E   +A++  A+
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSSEAE 116

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score =  127 bits (318), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 2   ARQVTWKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENL 61
           A ++TW+ +  GK +P L+P YV++    VFTSG +G +  TGE+P ++E QV  A++NL
Sbjct: 3   AEKITWEAI-KGKEHPTLSPGYVSNGH--VFTSGIIGANYGTGEVPHEIEDQVHLAIKNL 59

Query: 62  KNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVEL 121
           + VL A GSSL +V KV +F+S   Y+  VN++Y  YFP  PARSC+VV+F +A++K EL
Sbjct: 60  ETVLVAGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFPHKPARSCVVVAFMDAAIKYEL 119

Query: 122 ECIA 125
           E IA
Sbjct: 120 EAIA 123

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87
           ++L+F SG +   P    +   +  +    ++N+KNVL AS SSL++V+KV +F++D ++
Sbjct: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86

Query: 88  APAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
               N VY++YF    PARSC+ V+     + +E+E IA
Sbjct: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 66.2 bits (160), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           S+L+F SG +       PV G +    EQ       N+K++L+A  SSLE+V+KV +F++
Sbjct: 41  SNLLFVSGQIPYTPDNKPVEGSISDKTEQ----VFSNVKSILQAGNSSLERVVKVNVFLA 96

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           D  Y    NKVY++YF    PARSC+ V+    +  +E+E IA
Sbjct: 97  DIKYFEEFNKVYAKYFNEHQPARSCVAVAALPKNCDLEMEVIA 139

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 65.1 bits (157), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 29  DLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYA 88
           ++++ SG +   P    +   +  +    LEN+K VL+AS SSLE ++KV +F++D  Y 
Sbjct: 27  NMIYLSGQIPLTPDGKPVEGSIADKTTQVLENIKTVLKASNSSLENIVKVNIFLADIKYF 86

Query: 89  PAVNKVYSEYFPGA-PARSCI-VVSFP-NASLKVELECI 124
             +N VY++YF    PARSC+ V + P NA L++E+  +
Sbjct: 87  SELNVVYAKYFKAHKPARSCVAVAALPLNADLEIEVVAV 125

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 65.1 bits (157), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 61/103 (59%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++L+F SG +       PV G +    EQ     ++N+KNVL AS SSLE+++KV +F++
Sbjct: 26  NNLIFLSGQIPMTAENKPVEGSIADKAEQ----VIQNIKNVLEASNSSLEKIVKVNIFLA 81

Query: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           D +     N VY++YF    PARSC+ V+    +  +E+E IA
Sbjct: 82  DINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 61/103 (59%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++L+F SG +       PV G +    EQ      +N++N+L AS SS E+VIKV +F++
Sbjct: 69  NNLIFVSGQIPYTPENKPVEGSIADKAEQ----VFKNVRNILEASDSSFERVIKVNVFLA 124

Query: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           D +     NKVY++YF    PARSC+ V+    ++ +E+E IA
Sbjct: 125 DINNFAEFNKVYAKYFSTHKPARSCVAVAALPLNVDLEMEVIA 167

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 64.3 bits (155), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 63/102 (61%), Gaps = 7/102 (6%)

Query: 28  SDLVFTSGCVGTDPVTGE---LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSD 84
           ++L+F SG +   PVT +   +   + ++    L+N+KNVL +S SSL++V+KV +F++D
Sbjct: 27  NNLIFLSGQI---PVTQDNKLVEGSIAEKAEQVLQNVKNVLESSNSSLDRVVKVNIFLAD 83

Query: 85  GSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
             +    N VY++YF    PARSC+ V+     + +E+E IA
Sbjct: 84  IKHFAEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIA 125

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 63.5 bits (153), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 63/102 (61%), Gaps = 7/102 (6%)

Query: 28  SDLVFTSGCVGTDPVTGE---LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSD 84
           ++L+F SG +   PVT +   +   +  +    ++N+KNVL +S SSL++V+KV +F++D
Sbjct: 27  NNLIFLSGQI---PVTSDNKLVEGSIADKAEQVIQNIKNVLESSNSSLDRVVKVNIFLAD 83

Query: 85  GSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
            ++    N VY++YF    PARSC+ V+     + +E+E IA
Sbjct: 84  INHFAEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIA 125

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 63.2 bits (152), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 63/102 (61%), Gaps = 7/102 (6%)

Query: 28  SDLVFTSGCVGTDPVTGE---LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSD 84
           ++L+F SG +   P+T +   +   +  +    ++N+K+VL AS SSL+++IKV +F++D
Sbjct: 27  NNLIFLSGQI---PMTSDNKLVEGSIADKAEQVIQNIKDVLAASNSSLDRIIKVNIFLAD 83

Query: 85  GSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
             Y    N VY++YF    PARSC+ V+    ++ +E+E IA
Sbjct: 84  IKYFAEFNSVYAKYFTTHKPARSCVAVAALPLNVDMEVEIIA 125

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 63.2 bits (152), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 60/103 (58%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++L+F SG +       PV G +    EQ     ++N+K VL AS SSLE++IKV +F++
Sbjct: 26  NNLIFLSGQIPLTSDNKPVEGSIADKAEQ----VIQNVKKVLEASNSSLERIIKVNIFLA 81

Query: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           D +     N VY++YF    PARSC+ V+    +  +E+E IA
Sbjct: 82  DINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 62.4 bits (150), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (51%), Gaps = 3/128 (2%)

Query: 1   MARQVTWKEVGPGKGYPILAPAY--VTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNAL 58
           +AR++T       K  P  A +Y      ++L+F SG +   P    +   +  +     
Sbjct: 11  LARRLTTLTPVSTKSAPPAAASYSQAMKANNLIFVSGQIPYTPENKPVEGSISDKAEQVF 70

Query: 59  ENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASL 117
            N+ N+L AS SSL++VIKV +F+ D       N VY++YF    PARSC+ V+    ++
Sbjct: 71  SNVTNILEASNSSLDRVIKVNVFLKDIKNFQEFNSVYAKYFNVHKPARSCVAVAALPLNV 130

Query: 118 KVELECIA 125
            +E+E IA
Sbjct: 131 DLEMEVIA 138

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 62.0 bits (149), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 9/101 (8%)

Query: 30  LVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDG 85
           +VF SG +       PV G +    +Q      +N+KN+L AS SSL+++IKV +F+ D 
Sbjct: 42  MVFVSGQIPYTHDNKPVEGSISKKADQ----VFQNIKNILDASNSSLDKIIKVNVFLKDI 97

Query: 86  SYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           +     N VY++YF    PARSC+ V+     + VE+E IA
Sbjct: 98  NNFKEFNGVYAKYFNVHKPARSCVAVAALPLDVDVEVEVIA 138

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 62.0 bits (149), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 9/101 (8%)

Query: 30  LVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDG 85
           +VF SG +       PV G +    EQ     + N++NVL AS S L++V KV +F++D 
Sbjct: 42  MVFVSGQIPYTPDNKPVEGSVADKTEQ----VIANVRNVLEASNSGLDRVAKVNVFLADM 97

Query: 86  SYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           +Y    N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 98  AYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEMEVIA 138

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 62.0 bits (149), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++LVF SG +       PV G +    EQ      +N+KN+L AS SS ++VIKV +F++
Sbjct: 40  NNLVFVSGQIPYTKDNVPVKGSISDKTEQ----VFQNVKNILDASNSSFDKVIKVNVFLA 95

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           D +     N+VY++YF    PARSC+ V+       +E+E IA
Sbjct: 96  DINNFKEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIA 138

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 61.2 bits (147), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++L++ SG +       PV G +    EQ     ++N++N+L+ S S L +++KV +F++
Sbjct: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQ----VIQNVQNILKDSNSDLNRIVKVNIFLA 95

Query: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           D +     NKVY++YF    PARSC+ V+     + +E+E IA
Sbjct: 96  DMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 61.2 bits (147), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 57/99 (57%), Gaps = 1/99 (1%)

Query: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87
           ++ V+ SG +   P    +   L  +     +N+KN+L AS SS+ +++KV +F++D  +
Sbjct: 41  NNFVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVKNILEASNSSMNKIVKVNVFLADMKF 100

Query: 88  APAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
               N VY++YF    PARSC+ V+    ++ +E+E +A
Sbjct: 101 FQEFNSVYAKYFNVHKPARSCVAVASLPLNVDLEVEVVA 139

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 60.5 bits (145), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87
           ++ V+ SG +   P    +   +  +     +N+KN+L+ SGSS+++++KV +F++D + 
Sbjct: 43  NNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINN 102

Query: 88  APAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
               N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 103 FKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 9/106 (8%)

Query: 25  TSNSDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLL 80
           T  ++L++ SG +       PV G +    EQ      +N++N+L++  SSL +V+KV +
Sbjct: 48  TQFNELLYVSGQIPFTPDNKPVEGSISDKAEQ----VFQNVENILKSGNSSLNEVVKVNV 103

Query: 81  FVSDGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           F+ D       NKVY++YF    PARSC+ V+    ++ +E+E IA
Sbjct: 104 FLKDIDNFAEFNKVYAKYFTVHKPARSCVAVAALPLNVDLEMEVIA 149

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 59.3 bits (142), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++ V+ SG +       PV G +    EQ      +N++N+L AS SSL++++KV +F++
Sbjct: 43  NNFVYVSGQIPYTPENKPVEGSISDKAEQ----VFQNVRNILEASNSSLDKIVKVNVFLA 98

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           D +     N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 99  DINNFKEFNGVYAKYFNTHKPARSCVAVKALPLNVDLEVEVIA 141

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 58.9 bits (141), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           +++VF SG +       PV G +    EQ     ++N+KN+L  + SSL +++KV +F++
Sbjct: 42  NNMVFVSGQIPYTHENKPVEGSIADKAEQ----VIQNVKNILEEANSSLNKIVKVNVFLA 97

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           D +     N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 98  DINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 140

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 57.4 bits (137), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           +  V+ SG +       PV G +    EQ      +N+KN+L  S SSL+ ++KV +F++
Sbjct: 43  NSFVYVSGQIPYTAANKPVQGSISDKAEQ----VFQNVKNILAESNSSLDNIVKVNVFLA 98

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCI-VVSFPNASLKVELECIA 125
           D       N VY++YF    PARSC+ V S P  ++ +E+E IA
Sbjct: 99  DMKNFAEFNSVYAKYFHTHKPARSCVGVASLP-LNVDLEMEVIA 141

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 57.0 bits (136), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++L+F SG +       PV G +    EQ     ++N+KN+L  + S L++++KV +F++
Sbjct: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQ----VIQNVKNILVEANSDLDKIVKVNIFLA 93

Query: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           D +     N VY++YF    PARSC+       ++ +E+E IA
Sbjct: 94  DINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 57.0 bits (136), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87
           ++ V+ SG +   P    +   +  +     +N+KN+L  S SSL+ ++KV +F++D   
Sbjct: 43  NNFVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKN 102

Query: 88  APAVNKVYSEYF-PGAPARSCI-VVSFPNASLKVELECIA 125
               N VY++YF    PARSC+ V S P  ++ +E+E IA
Sbjct: 103 FGEFNSVYAKYFHTHKPARSCVGVASLP-LNVDLEMEVIA 141

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 56.2 bits (134), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87
           ++ V+ SG +   P    +   + ++     +N+KN+L  S SSL+ ++KV +F++D   
Sbjct: 43  NNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKN 102

Query: 88  APAVNKVYSEYF-PGAPARSCI-VVSFPNASLKVELECIA 125
               N VY+++F    PARSC+ V S P  ++ +E+E IA
Sbjct: 103 FAEFNSVYAKHFHTHKPARSCVGVASLP-LNVDLEMEVIA 141

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 55.5 bits (132), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%), Gaps = 7/102 (6%)

Query: 28  SDLVFTSGCVGTDPVTGE---LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSD 84
           ++LVF SG V   P+T +   L   + ++    + N+K +L AS S+L++V+K  +F++D
Sbjct: 28  NNLVFVSGQV---PLTADNKMLEGSIAEKAEQVITNIKTILAASNSALDRVVKCNIFLAD 84

Query: 85  GSYAPAVNKVYSEYFPGA-PARSCIVVSFPNASLKVELECIA 125
            +     N VY+++F    PARSC+ V+    +  +E+E IA
Sbjct: 85  INNFAEFNTVYAKHFHDHKPARSCVAVAALPLNADLEMEVIA 126

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 55.1 bits (131), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 29  DLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYA 88
           D ++ SG +  +     +   +  +     EN++ VL A+ S L+ V+K  +F+ D    
Sbjct: 27  DTIYLSGQIHLNEDNKLVGGSIADKAEQIFENVQKVLAAANSDLDHVVKCNVFLKDIKDF 86

Query: 89  PAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
              N VY++YF    PARSC+ V+    +  VE+ECIA
Sbjct: 87  AEFNTVYAKYFNSHKPARSCVAVAALPLNADVEMECIA 124

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 55.1 bits (131), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 58/101 (57%), Gaps = 9/101 (8%)

Query: 30  LVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDG 85
           +++ SG +       P+ G +    EQ +    +N+KN+L ++ SSL +++KV +F++D 
Sbjct: 28  MIYVSGQIPYTKENKPIGGTVSDQAEQMI----QNVKNILESANSSLNKIVKVNVFLTDM 83

Query: 86  SYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125
           ++    N VY++YF    PARSC+ V+       +E+E +A
Sbjct: 84  NHFQEFNVVYAKYFSEHKPARSCVAVAALPLDNIMEMEVVA 124

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 55.5 bits (132), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83
           ++ V+ SG +       PV G +    EQ      +N+KN+L  S SSL  V+KV +F++
Sbjct: 43  NNFVYVSGQIPYTAENKPVQGSISDKAEQ----VFQNVKNILAESNSSLNSVVKVNVFLA 98

Query: 84  DGSYAPAVNKVYSEYF-PGAPARSCI-VVSFPNASLKVELECIA 125
           D       N VY+++F    PARSC+ V S P  ++ +E+E IA
Sbjct: 99  DMKNFAEFNSVYAKHFHTHKPARSCVGVASLP-LNVDLEMEVIA 141

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 55.1 bits (131), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 60/105 (57%), Gaps = 13/105 (12%)

Query: 28  SDLVFTSGCVGTDPVTGE------LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLF 81
           +++VF SG +   P T E        TD  +QV   ++N+KN+L  + S+L +++KV +F
Sbjct: 39  NNMVFVSGQI---PYTAENKRVEGTMTDKAEQV---IQNVKNILEEANSALNKIVKVNIF 92

Query: 82  VSDGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           ++D +     N VY +YF    PARSC+ V     ++ +E+E +A
Sbjct: 93  LADINDFAEFNGVYGKYFNEHKPARSCVAVKDLPLNVDLEMEVVA 137

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 52.0 bits (123), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 30  LVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAP 89
           +VF SG +        +   +  +    ++N++N+L  + S L++++KV +F++D     
Sbjct: 41  MVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFA 100

Query: 90  AVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
             N VY +YF    PARSC+ V      + +E+E +A
Sbjct: 101 EFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137

>ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} similar
           to uniprot|Q07261 Saccharomyces cerevisiae YLR143W
           Hypothetical ORF
          Length = 669

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 48  TDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PG 101
           T LE+Q+++  + L ++L+ + +   QV+   L + D S  P VN++YS YF      P 
Sbjct: 327 TTLEEQMQDIFKQLDDILKKNRTKPSQVLHCTLILDDMSLFPQVNQIYSSYFDVIKNGPL 386

Query: 102 APARSCIVVSFPNASL 117
            PAR+CI     N SL
Sbjct: 387 PPARACISSMLGNGSL 402

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 22  AYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLF 81
           ++    +  ++ SG +   P    +   +  +     +N+  +L  +GSSL ++IKV +F
Sbjct: 20  SHAMKGNGFIYVSGQIALLPDGTRVEGSISDKAHQIFKNISAILETAGSSLNKIIKVNIF 79

Query: 82  VSDGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125
           +++       N  Y +YF    PARSC+ V+       VE+E +A
Sbjct: 80  LANIKDFEEFNATYIKYFNTHKPARSCVAVAALPLGADVEVEVVA 124

>CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} similar
           to uniprot|Q12429 Saccharomyces cerevisiae YLR143w
          Length = 688

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 6/83 (7%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103
           +++QV++ L+ L N+L+ +  + + V+   L ++D S   +VN+ YS++F      P  P
Sbjct: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396

Query: 104 ARSCIVVSFPNASLKVELECIAE 126
           AR+CI  +  N    ++L  + +
Sbjct: 397 ARACIESNIINDGSALQLSVVVK 419

>TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.349
           YLR143W
          Length = 694

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 48  TDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PG 101
           + LE Q R  L+ L  ++   G S  Q I   L +S  S    VN++YSEYF      P 
Sbjct: 335 SSLENQTRQVLDALNVIIEKWGISPSQAINCTLVLSSMSNFAVVNEIYSEYFDISKYGPL 394

Query: 102 APARSCI 108
            P+R+CI
Sbjct: 395 PPSRACI 401

>Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON}
           (225185..227278) [2094 nt, 698 aa]
          Length = 697

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 49  DLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGA 102
           D+E+QV N    L ++L     S  QV+   L++ + S    VNK+Y+ YF      P  
Sbjct: 337 DIERQVENVFNQLDSILGEKTYSRAQVLNSSLYLFNMSDFSKVNKIYNNYFDIQKFGPLP 396

Query: 103 PARSCI 108
           P+R+C+
Sbjct: 397 PSRACV 402

>SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]
           {ON} similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 691

 Score = 37.7 bits (86), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 6/87 (6%)

Query: 46  LPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------ 99
            P    +Q  +  + L  +L   G    QV+   L +SD S    VN VY+++F      
Sbjct: 327 FPGSTVEQASDVFKQLDTILNERGLYPSQVLSCALILSDISAFALVNDVYNKFFNIWKIG 386

Query: 100 PGAPARSCIVVSFPNASLKVELECIAE 126
           P  P+RSC+        + ++L  + +
Sbjct: 387 PLPPSRSCVGSKLLGKDVALQLSVVVD 413

>Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSE------YFPGAP 103
           +E+Q ++    L  +LR++G+S   ++   L V D      +N +Y+E      Y P  P
Sbjct: 335 VEEQCQDIFAELAAILRSNGTSRNHILSSSLIVRDMCDFGKINNIYNEFLDLTKYGPLPP 394

Query: 104 ARSCI 108
           +R+C+
Sbjct: 395 SRACV 399

>TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {ON}
           Anc_8.349 YLR143W
          Length = 711

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 48  TDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PG 101
           T +E Q+++  ++L  +L  +     Q++   L++S+      VNKVY+++F      P 
Sbjct: 337 TSIEVQIKSLFQHLDKILIENNIKPSQILSSTLYLSNIRDFANVNKVYNDFFDIEKNGPL 396

Query: 102 APARSCI 108
            P+R+C+
Sbjct: 397 PPSRACV 403

>Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143W
           (REAL)
          Length = 689

 Score = 36.6 bits (83), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSE------YFPGAP 103
           +E+Q ++    L ++LR++      ++   L V D S    +NK+Y+E      Y P  P
Sbjct: 335 VEEQSKDIFTELADILRSNRIPRSHILSSSLLVKDMSNFGKINKIYNEFLNVTKYGPLPP 394

Query: 104 ARSCIVVSFPNASLKVELECIAE 126
           +R+C+   +      V+L  + +
Sbjct: 395 SRACVGSGYLPEGCHVQLSVVID 417

>AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR143W
          Length = 686

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103
           LE+Q R+  + L   L   G    QV+  +L ++D      +N  Y+ YF      P  P
Sbjct: 329 LEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPP 388

Query: 104 ARSCI 108
           +R+CI
Sbjct: 389 SRACI 393

>TBLA0A04110 Chr1 (1019317..1021404) [2088 bp, 695 aa] {ON}
           Anc_8.349 YLR143W
          Length = 695

 Score = 35.4 bits (80), Expect = 0.024,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 10/116 (8%)

Query: 18  ILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIK 77
           I  P       ++++ S  V T  V       +E+QV +  + LK  L         +I 
Sbjct: 316 IFDPMSSHKIENIIYISNLVCTSSVR----KTVEEQVIDIFKKLKLCLNEYNVVQSHIIS 371

Query: 78  VLLFVSDGSYAPAVNKVYSEYF------PGAPARSCIVVSFPNASLKVELECIAEA 127
             L + + +    VN +Y+ +F      P  P+R+C+  S  N++  V+L  I ++
Sbjct: 372 STLLLKNMADFSKVNTIYNNFFSVSEWGPLPPSRACVGTSLLNSTYLVQLSVIIDS 427

>Kwal_27.11310 s27 (742973..745039) [2067 bp, 688 aa] {ON} YLR143W -
           Hypothetical ORF [contig 28] FULL
          Length = 688

 Score = 35.4 bits (80), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 9/92 (9%)

Query: 41  PVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF- 99
           P  G  P   +++V++    L ++LR    S  Q++  L+ ++D      VN+ Y+E+F 
Sbjct: 326 PKGGSSP---DEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFH 382

Query: 100 -----PGAPARSCIVVSFPNASLKVELECIAE 126
                P  P+R+C+  S   +   ++L  I +
Sbjct: 383 VARNGPLPPSRACVGSSLVGSENILQLSVIVD 414

>NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {ON}
           Anc_8.349 YLR143W
          Length = 689

 Score = 35.4 bits (80), Expect = 0.030,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 41  PVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF- 99
           P   EL  ++EQQ +   + L  +++ +     Q++   L +++ S    VN+VY+++F 
Sbjct: 331 PKDSEL--NVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANMSNFATVNQVYNDFFR 388

Query: 100 -----PGAPARSCI 108
                P  P+R+C+
Sbjct: 389 INKWGPLPPSRACV 402

>KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {ON}
           similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 684

 Score = 34.7 bits (78), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103
           ++++ +N L+ L  +L     S  Q++   L +SD S    VN++YS +F      P  P
Sbjct: 335 VKEKAQNILDELGTLLADQKVSPSQIMASSLLLSDMSDFHQVNEIYSAFFQVKHVGPLPP 394

Query: 104 ARSCI 108
           AR+C+
Sbjct: 395 ARACV 399

>KNAG0A02870 Chr1 complement(342659..344773) [2115 bp, 704 aa] {ON}
           Anc_8.349 YLR143W
          Length = 704

 Score = 33.9 bits (76), Expect = 0.091,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 33  TSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVN 92
           TS  VG D       T +E+Q R+    + ++L A      Q I   L +SD +    VN
Sbjct: 328 TSRKVGED-------TTIEEQTRDIFAQVDDILSAKQLYPSQTISSSLILSDMTTFARVN 380

Query: 93  KVYSEYFPG------APARSCI 108
            +Y+ +F         P+R+C+
Sbjct: 381 HIYNSWFSTEKWGSLPPSRACV 402

>Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 33.5 bits (75), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSE------YFPGAP 103
           +E+Q  +    L ++LR++      ++   L + D S    +NK+Y+E      Y P  P
Sbjct: 335 VEEQGDDIFSELADILRSNQIPRNHILSSSLLIKDMSNFGRINKIYNEFLDLTKYGPLPP 394

Query: 104 ARSCI 108
           +R+C+
Sbjct: 395 SRACV 399

>YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-tagged protein localizes to the cytoplasm; YLR143W
           is not an essential gene
          Length = 685

 Score = 32.7 bits (73), Expect = 0.25,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSE------YFPGAP 103
           +E+Q  +    L ++L ++      ++   L + D S    +NK+Y+E      Y P  P
Sbjct: 335 VEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPP 394

Query: 104 ARSCI 108
           +R+C+
Sbjct: 395 SRACV 399

>ZYRO0C01980g Chr3 (153854..157609) [3756 bp, 1251 aa] {ON} similar
           to uniprot|Q03868 Saccharomyces cerevisiae YDR104C SPO71
           Meiosis-specific protein of unknown function required
           for spore wall formation during sporulation dispensable
           for both nuclear divisions during meiosis
          Length = 1251

 Score = 32.0 bits (71), Expect = 0.40,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 15  GYPILAPAYVTSNSDLVFTSGCV-GTDPVTGEL---PTDL--EQQVRNALENLKNV 64
           G P L PAY  ++ +L+FT G +  T PV  EL    TD   E++V  +L++L  V
Sbjct: 805 GKPYLKPAYFFTSENLLFTMGSIKSTPPVPLELLISATDQSDEEKVNTSLKDLPEV 860

>KLLA0D16984g Chr4 (1439669..1441759) [2091 bp, 696 aa] {ON} similar
           to uniprot|Q07261 Saccharomyces cerevisiae YLR143W
           Hypothetical ORF
          Length = 696

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 41  PVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF- 99
           P  GE    L+++  +    L ++L +      Q++   L +SD +    VN  Y+EYF 
Sbjct: 332 PSKGE---SLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNSYYNEYFN 388

Query: 100 -----PGAPARSCIVVSF 112
                P  PAR+C+  SF
Sbjct: 389 VTKIGPLPPARACVESSF 406

>KLTH0G07106g Chr7 (568012..569487) [1476 bp, 491 aa] {ON} similar
           to uniprot|P11914 Saccharomyces cerevisiae YHR024C MAS2
           Larger subunit of the mitochondrial processing protease
           essential processing enzyme that cleaves the N-terminal
           targeting sequences from mitochondrially imported
           proteins
          Length = 491

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 6/48 (12%)

Query: 7   WKEVGPGKGYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQV 54
           ++++ PG G P + PA+ T          C+   PV G LP     Q+
Sbjct: 226 FEDMAPGNGRPTIKPAHYTGGET------CIPPGPVFGNLPELFHIQI 267

>Ecym_4223 Chr4 complement(465547..467622) [2076 bp, 691 aa] {ON}
           similar to Ashbya gossypii AGL164W
          Length = 691

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103
           L  Q  +    L  +L+  G    Q++   L +SD      +N +YS +F      P  P
Sbjct: 334 LIDQASDVFNQLDEILKRRGVFRSQILSSSLLLSDMRNFSEINGIYSSFFDISKVGPLPP 393

Query: 104 ARSCIVVSFPNASLKVELECIAE 126
           +R+CI  S   +++ ++L  I +
Sbjct: 394 SRACIESSLLPSNICLQLSVILD 416

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 38  GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAP----AVNK 93
           G D  T ++        + A    +N LR   ++LE+ +K +L  + G  AP    AV K
Sbjct: 393 GIDATTAQVTRIRSTDPKLARSIRENSLRKLQTNLEEQVKKVLSSNGGEIAPKQVSAVRK 452

Query: 94  VYSEYFPG--APARSCIVVSFPNASLKVELECIA 125
           V+  +F     P +S   + +P  +L +    I+
Sbjct: 453 VWDTFFVYFIKPLKSLHFLEYPPVALAITFSAIS 486

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 28.9 bits (63), Expect = 4.5,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 38  GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAP----AVNK 93
           G D  T ++        + A    +N LR   ++LE+ +K +L  + G  AP    AV K
Sbjct: 392 GIDATTAQVTKIRSTDPKLARSIRENSLRKLQTNLEEQVKKVLSNNGGEIAPKKVSAVRK 451

Query: 94  VYSEYFPG--APARSCIVVSFPNASLKVELECIA 125
           V+  +F     P +S   + +P  +L +    I+
Sbjct: 452 VWDIFFVYFIKPLKSLYFLQYPPVALAITFSAIS 485

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 28.9 bits (63), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 37  VGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVI 76
           VG    TG+ P   E+  + ALEN + + + +GSS E ++
Sbjct: 336 VGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMV 375

>NCAS0D03530 Chr4 (657458..658483) [1026 bp, 341 aa] {ON} 
          Length = 341

 Score = 28.5 bits (62), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 20  APAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVL 65
           A A+ T N ++V   GCV      G L TDL++     L+ + N +
Sbjct: 230 AKAWATKNKEIVDEIGCVSVSCYPGNLKTDLQRGWNPILKRIFNYI 275

>NDAI0B00660 Chr2 complement(148409..149377) [969 bp, 322 aa] {ON}
           Anc_5.5 YGR284C
          Length = 322

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query: 68  SGSSLEQVIKVLL-----FVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119
           +GSSL Q  +  L      + + S+ P +N++   Y P A AR CIVV+F   S+++
Sbjct: 47  TGSSLLQKTQKTLDNWNDMLEELSHHPFINRI-KPYIP-AIARFCIVVTFYEDSMRI 101

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 28.5 bits (62), Expect = 6.5,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 50  LEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYF------PGAP 103
           +E Q  +  E L  VL     S  Q++   L +S+ S    VNK+Y+E+F      P  P
Sbjct: 333 VESQATDIFEQLFMVLNEYKLSQSQILSSSLILSNMSNFGTVNKIYNEFFNISKWGPLPP 392

Query: 104 ARSCIVVSFPNASLKVELECIAE 126
           +RSC+  +    +++++L  + +
Sbjct: 393 SRSCVGSNLLGDNVQLQLSVVID 415

>Skud_4.25 Chr4 (41208..43049) [1842 bp, 613 aa] {ON} YNL209W (REAL)
          Length = 613

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 55  RNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCI 108
           ++ LE ++ VL+ +  S  Q+ +V+L V   +  P V K+ S+YF G      I
Sbjct: 314 KSTLEPVEQVLKDAKISKSQIDEVVL-VGGSTRIPKVQKLLSDYFDGKQLEKSI 366

>CAGL0K04741g Chr11 complement(463860..465701) [1842 bp, 613 aa]
           {ON} highly similar to uniprot|P40150 Saccharomyces
           cerevisiae YNL209w SSB2
          Length = 613

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 55  RNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCI 108
           ++ LE ++ VL+ +  S  Q+ +V+L V   +  P V K+ S+YF G      I
Sbjct: 314 KSTLEPVEQVLKDAKISKSQIDEVVL-VGGSTRIPKVQKLLSDYFDGKQLEKSI 366

>CAGL0C05379g Chr3 complement(512277..514118) [1842 bp, 613 aa] {ON}
           highly similar to uniprot|P40150 Saccharomyces
           cerevisiae YNL209w SSB2 or uniprot|P11484 Saccharomyces
           cerevisiae YDL229w SSB1
          Length = 613

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 55  RNALENLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCI 108
           ++ LE ++ VL+ +  S  Q+ +V+L V   +  P V K+ S+YF G      I
Sbjct: 314 KSTLEPVEQVLKDAKISKSQIDEVVL-VGGSTRIPKVQKLLSDYFDGKQLEKSI 366

>TBLA0B00420 Chr2 (80517..81533) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 28.1 bits (61), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 15  GYPILAPAYVTSNSDLVFTSGCVGTDPVTGELPTDLEQ 52
           G  + A A+ T N  +V   GCV T    G L TDL++
Sbjct: 222 GNIMQAKAWATVNKKIVEEIGCVSTSVYPGNLNTDLQR 259

>AFR326W Chr6 (1025588..1029517) [3930 bp, 1309 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR011W
           (SNQ2), YNR070W and YOR011W (AUS1)
          Length = 1309

 Score = 28.1 bits (61), Expect = 7.4,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 60  NLKNVLRASGSSLEQVIKVLLFVSD-----GSYAPAVNKVYSEYFPGAP 103
           NL    +A+G  L QV KVL+ + D     GSY   +    S YFP  P
Sbjct: 206 NLFGCTQANGILLGQVDKVLVLIGDYQVFYGSYQDCILFFESLYFPKDP 254

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 28.1 bits (61), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 3/76 (3%)

Query: 27  NSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLR--ASGSSLEQVIKVLLFVSD 84
           NSDL+   G    D VTG +     +  R ALE    ++    S  ++ +V++  + V +
Sbjct: 369 NSDLIIAVGTRFDDRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAV-E 427

Query: 85  GSYAPAVNKVYSEYFP 100
           G  A  + K+ S  FP
Sbjct: 428 GDAAANIEKMLSMIFP 443

>Skud_14.168 Chr14 complement(317492..320824) [3333 bp, 1110 aa]
           {ON} YNL163C (REAL)
          Length = 1110

 Score = 28.1 bits (61), Expect = 8.5,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 6/61 (9%)

Query: 39  TDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVL--LFVSDGSYAPAVNKVYS 96
           T P++ ++ T L Q       ++KN+LRAS S++E +I+      + + S+  A+ +V S
Sbjct: 789 TVPLSDKITTFLSQH----QNSIKNILRASTSNIEPIIETTGGALLDNNSFLTALEEVVS 844

Query: 97  E 97
           +
Sbjct: 845 Q 845

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,068,718
Number of extensions: 536364
Number of successful extensions: 1280
Number of sequences better than 10.0: 87
Number of HSP's gapped: 1237
Number of HSP's successfully gapped: 87
Length of query: 134
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 37
Effective length of database: 42,358,797
Effective search space: 1567275489
Effective search space used: 1567275489
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)