Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212463.495ON1601607262e-99
KLTH0F14894g3.495ON1661585398e-71
SAKL0F02706g3.495ON1611553687e-45
TPHA0D042603.495ON1581293471e-41
TDEL0D056303.495ON1501503424e-41
NCAS0E007803.495ON1711353444e-41
Kpol_480.133.495ON1571543331e-39
NDAI0G009103.495ON1631573304e-39
YGR133W (PEX4)3.495ON1831593282e-38
ZYRO0D09878g3.495ON1531523042e-35
Smik_6.2293.495ON1651603028e-35
Suva_7.4213.495ON1651612967e-34
CAGL0I10450g3.495ON1621322932e-33
Skud_7.4443.495ON1621602871e-32
TBLA0C045003.495ON1651522783e-31
KNAG0B007803.495ON1531562704e-30
KAFR0C019903.495ON1511572643e-29
AFR314W3.495ON1551522419e-26
Ecym_12343.495ON1611332202e-22
KLLA0E04027g3.495ON1581522192e-22
Smik_4.2973.308ON1481091809e-17
Suva_2.2183.308ON1481091801e-16
Skud_4.3143.308ON1481091801e-16
YDR059C (UBC5)3.308ON1481091801e-16
Skud_4.4418.375ON2151281787e-16
Suva_2.3438.375ON2151281787e-16
Smik_4.4258.375ON2151281787e-16
YDR177W (UBC1)8.375ON2151281788e-16
ZYRO0C03784g8.375ON2181601771e-15
TPHA0J017506.109ON1691041741e-15
TPHA0L008508.375ON2161351752e-15
Suva_4.3263.308ON1481371712e-15
KNAG0F025706.109ON1511111712e-15
Kpol_461.86.109ON1671041722e-15
ZYRO0C04950g6.109ON1681041722e-15
Smik_7.2226.109ON1711041723e-15
SAKL0A07260g6.109ON1691041723e-15
AAR156C6.109ON1701041723e-15
Ecym_30776.109ON1701041723e-15
Suva_7.2136.109ON1731041723e-15
YGL058W (RAD6)6.109ON1721041723e-15
Skud_2.2073.308ON1481371703e-15
Smik_2.2193.308ON1481371703e-15
YBR082C (UBC4)3.308ON1481371703e-15
TDEL0G036106.109ON1691041713e-15
KAFR0A047006.109ON1531041703e-15
Kpol_1030.108.375ON2151531743e-15
CAGL0I00352g6.109ON1671041704e-15
KLLA0C05632g6.109ON1641021704e-15
KNAG0J023403.308ON1611091695e-15
Ecym_74313.308ON1471091685e-15
CAGL0E04752g3.308ON1471371686e-15
KLTH0E14300g3.308ON1471091686e-15
SAKL0B06512g3.308ON1471091686e-15
AER173C3.308ON1471091686e-15
TPHA0A038503.308ON1481091686e-15
NDAI0A054903.308ON1471091677e-15
NCAS0A108003.308ON1481091677e-15
KLLA0E12563g3.308ON1481091678e-15
KAFR0C002703.308ON1471371678e-15
Kpol_1052.23.308ON1481091678e-15
Kwal_14.18286.109ON1521041679e-15
NCAS0D032206.109ON1711041681e-14
KLTH0H06732g6.109ON1601041671e-14
TBLA0F024406.109ON1741041681e-14
Kwal_27.124013.308ON2361041711e-14
TBLA0I021303.308ON1481091661e-14
TDEL0F021003.308ON1471091652e-14
KLLA0C18656g8.375ON2281321692e-14
ZYRO0G12870g3.308ON1471091642e-14
Kpol_1065.127.54ON1591061643e-14
CAGL0E00671g8.375ON2131061673e-14
Skud_7.2226.109ON1701041643e-14
Kpol_1075.1b8.230ON1521011633e-14
Smik_15.5177.54ON1561281634e-14
Ecym_60388.375ON2111061664e-14
Skud_4.3528.230ON1431011624e-14
NDAI0I016506.109ON1761021635e-14
KLTH0A07546g8.375ON2151061655e-14
AGR121C8.230ON1541011626e-14
SAKL0A00396g8.375ON2151031647e-14
NDAI0A011608.375ON2161061647e-14
TBLA0H031308.375ON2141281648e-14
SAKL0H17930g8.230ON1531011609e-14
ADR169C8.375ON2111031639e-14
Suva_2.2538.230ON1431011609e-14
CAGL0G08063g8.230ON1491011601e-13
KAFR0A024208.230ON1471011601e-13
TDEL0A013408.230ON1571011601e-13
YDR092W (UBC13)8.230ON1531011591e-13
KNAG0H029808.230ON1521011591e-13
KLTH0G14366g8.230ON1491011591e-13
Smik_4.3358.230ON1431011581e-13
NDAI0J015408.230ON1541011582e-13
Kwal_23.64858.375ON2151061612e-13
KNAG0A048108.375ON2141281612e-13
ZYRO0B11682g8.230ON1511011582e-13
TDEL0F049908.375ON2171221603e-13
YOR339C (UBC11)7.54ON1561221563e-13
Ecym_55638.230ON1641011574e-13
ABR059W2.569ON1651201564e-13
Kwal_26.82242.569ON1651201565e-13
CAGL0M07568g2.569ON1651201565e-13
Kwal_56.234828.230ON1491011555e-13
KLLA0C17622g8.230ON1591011556e-13
NCAS0B031508.375ON2141071586e-13
SAKL0D13552g2.569ON1651201556e-13
TPHA0B034108.230ON1521011548e-13
NCAS0B040108.230ON1531011539e-13
TBLA0F037908.230ON1511011531e-12
KLTH0D07986g2.569ON1651201531e-12
KAFR0B060608.375ON2131221516e-12
TDEL0B065702.569ON1651481486e-12
Ecym_45782.569ON1651201479e-12
Suva_8.3897.54ON1561061461e-11
ZYRO0E06358g2.569ON1651201471e-11
Skud_15.5047.54ON1561001461e-11
SAKL0B10582g7.54ON1611221452e-11
TDEL0H039707.54ON1561061424e-11
NDAI0E038707.54ON1641281426e-11
ZYRO0D04466g7.54ON1591061391e-10
Kwal_26.70097.54ON1611061382e-10
KAFR0A021602.569ON1651201382e-10
NDAI0B015202.569ON1651201382e-10
Suva_13.1892.569ON1651201373e-10
Smik_13.1862.569ON1651201363e-10
Skud_13.1762.569ON1651201364e-10
YMR022W (UBC7)2.569ON1651201364e-10
KAFR0H012303.308ON110941325e-10
KLTH0D01760g7.54ON1611221346e-10
NCAS0A127402.569ON1651201346e-10
KLLA0E07745g2.569ON1651201348e-10
TPHA0I024602.569ON1671201339e-10
TBLA0H026102.569ON1651491302e-09
TPHA0O009201.436ON226751314e-09
KNAG0M021502.569ON1701201285e-09
Smik_5.2467.392ON250831308e-09
CAGL0M03399g1.436ON214751289e-09
TDEL0B056701.436ON203751281e-08
YER100W (UBC6)7.392ON2501091291e-08
Kwal_34.161741.436ON213741271e-08
ZYRO0E03806g1.436ON209751262e-08
Kpol_1056.52.569ON1651201252e-08
KAFR0F030404.49ON1691131242e-08
TBLA0I029604.249ON157941232e-08
ZYRO0B12386g4.249ON1571101232e-08
KAFR0H029601.436ON187751242e-08
NCAS0A059404.49ON1931181243e-08
Skud_5.2257.392ON250831254e-08
NDAI0D011401.436ON245751244e-08
CAGL0D00814g4.249ON157941215e-08
CAGL0D06468g4.49ON1871171225e-08
Kpol_1030.181.436ON223751235e-08
KNAG0H018701.436ON210751225e-08
Smik_5.981.436ON215751226e-08
YEL012W (UBC8)1.436ON218751236e-08
Suva_5.531.436ON215751226e-08
Smik_12.3894.49ON1871281216e-08
NDAI0D029104.49ON1891111217e-08
KLTH0C06688g7.392ON246771237e-08
Suva_5.2197.392ON2491091227e-08
Suva_10.4014.49ON1871381218e-08
Skud_5.871.436ON210741218e-08
KLTH0D14344g4.249ON1571001198e-08
KLTH0H13816g1.436ON233751211e-07
YDL064W (UBC9)4.249ON157941181e-07
Kwal_23.42274.249ON122941171e-07
Ecym_32704.249ON157941181e-07
KNAG0B023607.392ON2511061211e-07
Ecym_13481.436ON211751201e-07
KAFR0L017507.392ON251771202e-07
KLLA0E05039g4.249ON157941172e-07
SAKL0H03058g4.249ON157941172e-07
NDAI0A016507.392ON251771202e-07
AEL045W1.436ON211751192e-07
TBLA0A012901.436ON219751192e-07
Kwal_27.108377.392ON246771192e-07
NCAS0A143907.392ON2401061192e-07
Skud_4.1914.249ON157941172e-07
Suva_4.1864.249ON157941172e-07
Smik_4.1714.249ON157941172e-07
SAKL0D10560g1.436ON207751182e-07
Skud_12.3894.49ON1871281163e-07
NCAS0G031301.436ON231631174e-07
KLLA0A11198g1.436ON202751164e-07
YLR306W (UBC12)4.49ON1881141164e-07
CAGL0I05478g7.392ON2461071165e-07
ZYRO0B03344g7.392ON2501061165e-07
KLLA0E20395g7.392ON251761165e-07
TBLA0E015704.49ON1941001155e-07
TDEL0E055604.49ON187681146e-07
ZYRO0G19910g4.49ON179761146e-07
Ecym_46837.392ON243801156e-07
TBLA0D006007.392ON2561061157e-07
NCAS0E026007.392ON2551061149e-07
AER056C4.249ON157941111e-06
SAKL0F12474g7.392ON251771122e-06
NDAI0D043804.249ON157941092e-06
KAFR0G032404.249ON157941093e-06
KLTH0H09504g4.49ON1841251093e-06
ADL035C4.49ON2001151103e-06
TDEL0C015507.392ON248801103e-06
NCAS0A024904.249ON157941083e-06
Kpol_483.164.249ON122941063e-06
AGR372W7.392ON242761104e-06
TDEL0E012204.249ON157941075e-06
KNAG0D043904.249ON1571001075e-06
Kpol_1045.397.392ON2531061095e-06
NDAI0E041707.392ON2571061086e-06
KNAG0I029404.49ON1971061077e-06
TPHA0B007704.249ON157941058e-06
NCAS0A107703.301ON2731171061e-05
KNAG0H010403.301ON2961141062e-05
NDAI0A055303.301ON2731171052e-05
TPHA0F003904.49ON193651032e-05
KLLA0C17248g4.49ON184831032e-05
Kpol_1065.453.301ON3231191042e-05
CAGL0E04598g3.301ON2951191033e-05
KAFR0H012703.301ON2871191034e-05
Suva_2.2113.301ON2971191024e-05
ZYRO0G12650g3.301ON2851191015e-05
TPHA0M012803.301ON4351191017e-05
Kpol_YGOB_414.24.49ON19365997e-05
Kpol_414.2singletonOFF19265997e-05
Smik_4.2903.301ON2971191009e-05
Skud_4.3063.301ON2971191001e-04
TDEL0D032603.301ON289114991e-04
SAKL0D02530g3.301ON272119991e-04
TBLA0G032703.301ON330115991e-04
YDR054C (CDC34)3.301ON295119991e-04
Kwal_27.104443.301ON278114981e-04
TPHA0K008207.392ON257106981e-04
Ecym_26693.301ON268119972e-04
KLTH0C04818g3.301ON275119963e-04
NDAI0A075703.301ON239120963e-04
AGL203C3.301ON270119945e-04
KLLA0D09196g3.301ON292114936e-04
NCAS0I014303.301ON258122937e-04
Ecym_83714.49ON26789910.001
KNAG0J022803.301ON217117890.002
KLLA0E19119g6.187ON13976850.004
SAKL0H24112g4.49ON18587850.005
Ecym_22306.187ON13865810.016
KAFR0C021406.187ON13862810.016
AFL064W6.187ON13860800.019
Kpol_1002.656.187ON10154780.026
KLTH0H04796g6.187ON13862790.029
Kwal_27.111826.187ON10157750.062
TDEL0G015806.187ON13862760.069
Suva_7.1826.187ON13776740.12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21246
         (160 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   284   2e-99
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   212   8e-71
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   146   7e-45
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   138   1e-41
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   136   4e-41
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   137   4e-41
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   132   1e-39
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   131   4e-39
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   130   2e-38
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   121   2e-35
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   120   8e-35
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   118   7e-34
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   117   2e-33
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   115   1e-32
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   111   3e-31
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   108   4e-30
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   106   3e-29
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...    97   9e-26
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...    89   2e-22
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    89   2e-22
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    74   9e-17
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    74   1e-16
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    74   1e-16
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    74   1e-16
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    73   7e-16
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    73   7e-16
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    73   7e-16
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    73   8e-16
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    73   1e-15
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    72   1e-15
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    72   2e-15
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    70   2e-15
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    70   2e-15
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    71   2e-15
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    71   2e-15
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    71   3e-15
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    71   3e-15
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    71   3e-15
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    71   3e-15
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    71   3e-15
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    71   3e-15
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    70   3e-15
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    70   3e-15
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    70   3e-15
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    70   3e-15
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    70   3e-15
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    72   3e-15
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    70   4e-15
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    70   4e-15
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    70   5e-15
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    69   5e-15
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    69   6e-15
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    69   6e-15
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    69   6e-15
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    69   6e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    69   6e-15
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    69   7e-15
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    69   7e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    69   8e-15
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    69   8e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    69   8e-15
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    69   9e-15
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      69   1e-14
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    69   1e-14
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    69   1e-14
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    70   1e-14
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    69   1e-14
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    68   2e-14
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    70   2e-14
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    68   2e-14
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    68   3e-14
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    69   3e-14
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    68   3e-14
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    67   3e-14
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    67   4e-14
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    69   4e-14
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    67   4e-14
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      67   5e-14
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    68   5e-14
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    67   6e-14
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    68   7e-14
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      68   7e-14
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    68   8e-14
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    66   9e-14
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    67   9e-14
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    66   9e-14
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    66   1e-13
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    66   1e-13
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    66   1e-13
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    66   1e-13
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    66   1e-13
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    66   1e-13
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    65   1e-13
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    65   2e-13
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    67   2e-13
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    67   2e-13
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    65   2e-13
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    66   3e-13
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    65   3e-13
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    65   4e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    65   4e-13
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    65   5e-13
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    65   5e-13
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    64   5e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    64   6e-13
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      65   6e-13
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    64   6e-13
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    64   8e-13
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    64   9e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    64   1e-12
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    64   1e-12
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    63   6e-12
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    62   6e-12
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    61   9e-12
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    61   1e-11
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    61   1e-11
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    61   1e-11
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    60   2e-11
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    59   4e-11
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    59   6e-11
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    58   1e-10
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    58   2e-10
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    58   2e-10
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    58   2e-10
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    57   3e-10
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    57   3e-10
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    57   4e-10
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    57   4e-10
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    55   5e-10
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    56   6e-10
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    56   6e-10
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    56   8e-10
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    56   9e-10
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    55   2e-09
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    55   4e-09
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    54   5e-09
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    55   8e-09
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    54   9e-09
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    54   1e-08
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    54   1e-08
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    54   1e-08
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    53   2e-08
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    53   2e-08
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    52   2e-08
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    52   2e-08
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    52   2e-08
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    52   2e-08
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     52   3e-08
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    53   4e-08
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    52   4e-08
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    51   5e-08
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    52   5e-08
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    52   5e-08
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    52   5e-08
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    52   6e-08
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    52   6e-08
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    52   6e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    51   6e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       51   7e-08
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    52   7e-08
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    52   7e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    51   8e-08
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    51   8e-08
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    50   8e-08
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    51   1e-07
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    50   1e-07
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    50   1e-07
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    50   1e-07
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    51   1e-07
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    51   1e-07
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    51   2e-07
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    50   2e-07
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    50   2e-07
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    51   2e-07
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    50   2e-07
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    50   2e-07
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    50   2e-07
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    50   2e-07
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    50   2e-07
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    50   2e-07
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    50   2e-07
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    50   2e-07
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    49   3e-07
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                50   4e-07
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    49   4e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    49   4e-07
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    49   5e-07
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    49   5e-07
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    49   5e-07
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    49   5e-07
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    49   6e-07
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    49   6e-07
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    49   6e-07
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    49   7e-07
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    49   9e-07
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    47   1e-06
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    48   2e-06
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    47   2e-06
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    47   3e-06
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    47   3e-06
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    47   3e-06
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    47   3e-06
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    46   3e-06
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    45   3e-06
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    47   4e-06
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    46   5e-06
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    46   5e-06
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    47   5e-06
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    46   6e-06
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    46   7e-06
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    45   8e-06
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    45   1e-05
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                45   2e-05
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    45   2e-05
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    44   2e-05
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    44   2e-05
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    45   2e-05
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    44   3e-05
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                44   4e-05
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    44   4e-05
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    44   5e-05
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    44   7e-05
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    43   7e-05
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    43   7e-05
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    43   9e-05
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    43   1e-04
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    43   1e-04
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    43   1e-04
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    43   1e-04
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    43   1e-04
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    42   1e-04
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    42   1e-04
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    42   2e-04
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    42   3e-04
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    42   3e-04
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    41   5e-04
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    40   6e-04
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                40   7e-04
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    40   0.001
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    39   0.002
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    37   0.004
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    37   0.005
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    36   0.016
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    36   0.016
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    35   0.019
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    35   0.026
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    35   0.029
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    33   0.062
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    34   0.069
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    33   0.12 
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    33   0.18 
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    32   0.21 
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    32   0.24 
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    32   0.34 
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    32   0.38 
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    31   0.78 
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    30   0.90 
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    30   0.93 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    30   1.9  
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    30   2.2  

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  284 bits (726), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 139/160 (86%), Positives = 139/160 (86%)

Query: 1   MSQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60
           MSQRLAKEY        EDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI
Sbjct: 1   MSQRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXX 120
           TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWD             
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160
           NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  212 bits (539), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 102/158 (64%), Positives = 117/158 (74%)

Query: 1   MSQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60
           MSQRLAKEY         DP Y++I  L PVS++NL  WE+ ITGP DTPY GHEF+L I
Sbjct: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXX 120
               AYPLEPPKVQF ARC+PHCNVDF+SGRIC+++L+ AHW+PAWD             
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158
           +PEPDSPLDVDLACL RAGD SAHN L+AYYLNGGSRG
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  146 bits (368), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 95/155 (61%), Gaps = 7/155 (4%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           QR+ KE+        EDP+Y+HI KL P    N+Y W ADI+GP +TPY    F+L + +
Sbjct: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63

Query: 63  PSAYPLEPPKVQF-----NARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXX 117
           P  YPLEPP+V+F     N  C  HCNVDF++G IC+++L R HWSP WD          
Sbjct: 64  PIQYPLEPPRVKFLPGSRNNIC--HCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121

Query: 118 XXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152
               P P+SPL+VD+A + +AGD  A+ GL+ YY+
Sbjct: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  138 bits (347), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%)

Query: 25  IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCN 84
           I  L PV+ +N   W A + GP +TPY  H F LLI +PS YPL PP + F    +PHCN
Sbjct: 24  IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCN 83

Query: 85  VDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAH 144
           V+F +G+IC+N+LE  HWSP W+              P  DSPL++DLA + RAGD SA+
Sbjct: 84  VEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAY 143

Query: 145 NGLVAYYLN 153
           +GL+ YYL 
Sbjct: 144 HGLINYYLQ 152

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  136 bits (342), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 90/150 (60%), Gaps = 3/150 (2%)

Query: 4   RLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIP 63
           R+A+EY         +   S +  L P+ D +L  W  +I GP+ TPY+GH FSL + + 
Sbjct: 3   RIAREYKHIQATLGSES--SLVVSLEPI-DGDLSRWAGEIRGPTGTPYEGHTFSLRLVLG 59

Query: 64  SAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPE 123
             YP  PP+V F  R +PHCNV++E+G IC+N+L   HWSPAWD             +PE
Sbjct: 60  DRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPE 119

Query: 124 PDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153
           PDSPLD+DLA + RA D SA+ GLV YYL 
Sbjct: 120 PDSPLDIDLANILRAQDRSAYYGLVNYYLQ 149

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  137 bits (344), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 83/135 (61%)

Query: 25  IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCN 84
           I  L P+S  +L  W+A I GP  TPY  HEF L I  P  YP+EPP + F    +PHCN
Sbjct: 34  ITYLHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCN 93

Query: 85  VDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAH 144
           V+F++G IC+++LE+ HW+PAW+             +P PDSPL+VD+A + R  D SA+
Sbjct: 94  VNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153

Query: 145 NGLVAYYLNGGSRGS 159
           NGL+ YYL+     S
Sbjct: 154 NGLLNYYLSASPSPS 168

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  132 bits (333), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 91/154 (59%), Gaps = 2/154 (1%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY             + I  L P+  D+L  W A I GP +TPY GH F L I +
Sbjct: 4   RRLLKEYQVVKKELGNHK--NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNP 122
              YPL+PP+V F+A  +PHCN++F++G+IC+N+L+ A+WSP W+             +P
Sbjct: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121

Query: 123 EPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGS 156
             DSPL++DL+ + +  D SA+ GL+ YYLN  S
Sbjct: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  131 bits (330), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 89/157 (56%), Gaps = 7/157 (4%)

Query: 4   RLAKEYXXXXXXX------XEDPAYSHIRKLRPVS-DDNLYVWEADITGPSDTPYQGHEF 56
           R+ KEY              +D   + I  L P+  D +L  WEA I GP  TPY G  F
Sbjct: 3   RIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62

Query: 57  SLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXX 116
            L ITIP  YP  PP  +F  R +PHCNV++ +G IC+++L++ HW+P W+         
Sbjct: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122

Query: 117 XXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153
               +P P+SPL+VDLA L R GD SA+NGL+ YYLN
Sbjct: 123 LLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  130 bits (328), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 87/159 (54%), Gaps = 5/159 (3%)

Query: 4   RLAKEYXXXXXXXXED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58
           R+ KEY         D     P    I  L P+ + +L  WEA I+GPSDTPY+ H+F +
Sbjct: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80

Query: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXX 118
           LI +PS+YP+ PPK+ F    + HCNV   +G IC+N+L+   W+P WD           
Sbjct: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140

Query: 119 XXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSR 157
              P  DSPLDVD+  + R GD SA+ G+V Y+L    R
Sbjct: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  121 bits (304), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 85/152 (55%), Gaps = 4/152 (2%)

Query: 4   RLAKEYXXXXXXXXE-DPAYSH-IRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           R AKEY        E D  YS  I  + P  D  L  WEA I GPS TPY+G  F L ++
Sbjct: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
           +P  YP+ PP V+F    +PH NVDF +G IC+++L + HWSPAWD              
Sbjct: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120

Query: 122 PEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153
           P   SPL+VD+A + +A D +A+ GLV YY+ 
Sbjct: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  120 bits (302), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 85/160 (53%), Gaps = 5/160 (3%)

Query: 4   RLAKEYXXXXXXXXED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58
           R+ KEY         D     P    IR L P+ + +L  WEA I GPS TPY+ ++F +
Sbjct: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62

Query: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXX 118
           LI +PS+YP+ PP++ F    + HCNV   +G IC+++L+   W+P WD           
Sbjct: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122

Query: 119 XXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158
              P  DSPLDVD+  + R  D SA+ G+V Y+L    R 
Sbjct: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  118 bits (296), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 83/161 (51%), Gaps = 5/161 (3%)

Query: 4   RLAKEYXXXXXXXXED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58
           R+ KEY         D     P    I  L P  + +L  WEA I GP  TPY+ ++F +
Sbjct: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62

Query: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXX 118
           LI +P +YP+ PPK+ F    + HCN++  +G IC+++L+   W+P WD           
Sbjct: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122

Query: 119 XXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGS 159
              P  DSPLDVD+  + R GD  A+ G+V Y+L    R +
Sbjct: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNN 163

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  117 bits (293), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 6/132 (4%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQF------NARCVP 81
           L PV D +L  W A I GP++TPY  +EF L I +P++YP+ PP ++F        R  P
Sbjct: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85

Query: 82  HCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDY 141
           HCNVD  +G IC+++L+   WSP WD              P PDSPLDVD+A + +  D 
Sbjct: 86  HCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDM 145

Query: 142 SAHNGLVAYYLN 153
           SA+NG++ Y+L 
Sbjct: 146 SAYNGIIRYFLT 157

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  115 bits (287), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 85/160 (53%), Gaps = 5/160 (3%)

Query: 4   RLAKEYXXXXXXXXED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58
           R+AKEY         +     P    I  L P+ + +L  WEA I GP+ TPY+ + F +
Sbjct: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62

Query: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXX 118
           LI +PS+YP+ PP ++F+   + HCN+   +G IC+++L+   W+P WD           
Sbjct: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122

Query: 119 XXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158
              P  DSPLDVD+  + R GD  A+ G++ Y+L    R 
Sbjct: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  111 bits (278), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 81/152 (53%), Gaps = 13/152 (8%)

Query: 22  YSHIRKLRPVSDD------------NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLE 69
           Y+HIRKL  + D+            +L  W + I GP D+PY    F L I IP+ YP  
Sbjct: 8   YNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSI 67

Query: 70  PPKVQFNARCVP-HCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPL 128
           PP ++FN   +P HCNV+F +G IC+N+L+  +WSP W+              P+P SPL
Sbjct: 68  PPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPL 127

Query: 129 DVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160
           ++DL+ L    D  A+N L+ YYL    +  L
Sbjct: 128 NIDLSRLLTLKDSKAYNSLIKYYLYNFPKPEL 159

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  108 bits (270), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 82/156 (52%), Gaps = 5/156 (3%)

Query: 1   MSQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60
           MSQR+ +EY             ++   L P    +L  WEA + GP  TPY+GH F L +
Sbjct: 1   MSQRVLREYRRLVAAG----GAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXX 120
           T+P  YP  PP V F  R +PH NV +++G +C++ L    W+P  D             
Sbjct: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLA 115

Query: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGS 156
            P P+SPL+++LA L R GD+ A++G++ Y L   S
Sbjct: 116 EPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSS 151

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  106 bits (264), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 83/157 (52%), Gaps = 6/157 (3%)

Query: 1   MSQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60
           M  R+ KEY        +     +I  L P+S D+L  WE  I GP  +P+  H F L I
Sbjct: 1   MESRILKEYKDSRSLQSQ-----YILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRI 55

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXX 120
            IP  YPL  P  +F    +PH NV+FE+G IC+++L+  +WSP ++             
Sbjct: 56  DIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLN 114

Query: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSR 157
            P   SPL++DLA L R  D  A++ L++Y+LN  ++
Sbjct: 115 EPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score = 97.4 bits (241), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 80/152 (52%), Gaps = 6/152 (3%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDN--LYVWEADITGPSDTPYQGHEFSLLI 60
           +R+ +EY          PA   +  L PV ++N  L+ WEA   GP +TPY G  F+L I
Sbjct: 2   RRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXX 120
            +P  YP EPPK  F    + H N+ + +G +C++LL+   WSP ++             
Sbjct: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLA 118

Query: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152
            P  DSPLDVDL+ L    D +A++G+V Y L
Sbjct: 119 EPGVDSPLDVDLSRL-YTTDRAAYDGVVNYRL 149

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score = 89.4 bits (220), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 2/133 (1%)

Query: 21  AYSHIRKLRPVSDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARC 79
           ++  I  L P  D  +L  WEA   GP +TPY    F+L I IP  YP EPP  +F    
Sbjct: 25  SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNH 84

Query: 80  VPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           + H N+ + +G +C++LL+   WSP ++              P  DSPLDVDLA L    
Sbjct: 85  ICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSV- 143

Query: 140 DYSAHNGLVAYYL 152
           D  A+ GLV Y L
Sbjct: 144 DKQAYQGLVTYRL 156

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 89.0 bits (219), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 81/152 (53%), Gaps = 5/152 (3%)

Query: 4   RLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIP 63
           R+ KEY        + P +S I  L PV DD+L  W     GPS++P++G E  L ITI 
Sbjct: 3   RIVKEYMGLQKRL-QTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61

Query: 64  -SAYPLE-PPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
              YP+   P+V F  R V H NV +++G IC++LL+ A W+P +              +
Sbjct: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLAD 120

Query: 122 PEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153
           P  DSPLD+D+A +  A DY A+  +V Y L 
Sbjct: 121 PGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.9 bits (180), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GPSD+PY G  F L I  P+ YP +PPKV F  + + H N++  S
Sbjct: 26  PVGDD-LYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SS 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKT 130

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GPSD+PY G  F L I  P+ YP +PPKV F  + + H N++  S
Sbjct: 26  PVGDD-LYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SS 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT 130

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GPSD+PY G  F L I  P+ YP +PPKV F  + + H N++  S
Sbjct: 26  PVGDD-LYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SS 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT 130

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GPSD+PY G  F L I  P+ YP +PPKV F  + + H N++  S
Sbjct: 26  PVGDD-LYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SS 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT 130

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +HI  L  VS+ +++  +    GP  TPY+G +F + I +P  
Sbjct: 4   AKRIMKEIQAVKDDPA-AHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK+QF+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMQFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +HI  L  VS+ +++  +    GP  TPY+G +F + I +P  
Sbjct: 4   AKRIMKEIQAVKDDPA-AHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK+QF+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMQFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +HI  L  VS+ +++  +    GP  TPY+G +F + I +P  
Sbjct: 4   AKRIMKEIQAVKDDPA-AHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK+QF+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMQFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 73.2 bits (178), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +HI  L  VS+ +++  +    GP  TPY+G +F + I +P  
Sbjct: 4   AKRIMKEIQAVKDDPA-AHI-TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK+QF+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMQFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 13/160 (8%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           ++RL KE         +DPA +    L  +S+ +++  +    GP +TPYQG  F + I 
Sbjct: 4   AKRLMKELQAVR----DDPAANIT--LEFISESDIHRLKGSFLGPPETPYQGGRFIIDIE 57

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
           +P  YP +PPK++F+ + V H N+   +G IC+++L+ A WSP                +
Sbjct: 58  VPMEYPFKPPKMKFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLAC--LRRAGDYSAHNGL---VAYYLNGGS 156
           PEP+ P D ++A   LR    +S    L   +    NGGS
Sbjct: 116 PEPNDPQDAEVAQHYLRDKESFSKTAALWTRLYASSNGGS 155

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ +W A I GPSDTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 5/135 (3%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L  VS+ +++  +    GP +TPY+G +F + I +P  YP +PPK++F+ + V H N+  
Sbjct: 24  LEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPFKPPKMKFDTK-VYHPNISS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLAC--LRRAGDYSAHN 145
            +G IC+++L+ A WSP                +PEP+ P D ++A   LR    ++   
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTA 141

Query: 146 GL-VAYYLNGGSRGS 159
            L    Y NGG   S
Sbjct: 142 ALWTKLYANGGDANS 156

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+AKE          DP  S      PV DD LY W+A I GP+D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTSC--SAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 57  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAHIYKT 130

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF-HPNV-YANGEIC 73

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAH 144
           +++L+   W+P +D             +P P SP +V+ A L +  DY + 
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK--DYKSQ 121

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+AKE          DP  S      PV DD LY W+A I GP+D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTSC--SAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 57  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAHIYKT 130

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+AKE          DP  S      PV DD LY W+A I GP+D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTSC--SAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 57  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAHIYKT 130

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+AKE          DP  S      PV DD LY W+A I GP+D+PY G  F L I 
Sbjct: 4   SKRIAKELSDLE----RDPPTSC--SAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIH 56

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 57  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 113

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 114 ANPDDPLVPEIAHIYKT 130

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF-HPNV-YANGEIC 73

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 74  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 74/153 (48%), Gaps = 7/153 (4%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +    L  VS+ +++  +    GP +TPYQG  F + I +P  
Sbjct: 4   AKRIMKEMQAVKDDPAANI--NLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK++F+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMKFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLAC--LRRAGDYSAHNGL-VAYYLNGG 155
            P D ++A   LR    ++    L    Y  GG
Sbjct: 120 DPQDAEVAQHYLRDRESFNKTATLWTTLYAEGG 152

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 3/102 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ +W A I GP+DTPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           +++L+   W+P +D             +P P SP +V+ A L
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL 129

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 39  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 95

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 96  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT 143

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 69.3 bits (168), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+AKE          DP  S      PV DD LY W+A I GP D+PY G  F L I 
Sbjct: 3   SKRIAKELSDLG----RDPPTSC--SAGPVGDD-LYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 56  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 112

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 113 ANPDDPLVPEIAHIYKT 129

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 26  PVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A L + 
Sbjct: 83  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT 130

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 26  PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT 130

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 26  PVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A L + 
Sbjct: 83  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT 130

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R++KE         +DP  S      PV DD L+ W+A I GP D+PY G  F L I 
Sbjct: 3   SKRISKELNDLR----KDPITSF--SAGPVGDD-LFHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
            P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSPA               +
Sbjct: 56  FPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICSLLTD 112

Query: 122 PEPDSPLDVDLACLRRA 138
             PD PL  ++A + + 
Sbjct: 113 ANPDDPLVPEIAHIYKT 129

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 26  PVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A L + 
Sbjct: 83  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT 130

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 68.9 bits (167), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP++TPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPNV-YANGEIC 73

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP++TPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP++TPY+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 27  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 84

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 85  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ +W A I GPSDTPY+   F L++     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (54%), Gaps = 4/104 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD LY W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 114 PVGDD-LYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 170

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           G IC+++L +  WSPA               +  PD PL  ++A
Sbjct: 171 GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIA 213

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 26  PVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-AN 82

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 83  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 130

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-IYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 69.7 bits (169), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+R+ KE         EDP      +L+ V++ +++  +    GPS TPY+G +F + I 
Sbjct: 4   SKRILKEIQAVK----EDPEAQ--IELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDIN 57

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXN 121
           IP  YP +PP+++F+ + V H NV   +G IC+++L+ A W+P                +
Sbjct: 58  IPVEYPYKPPQMKFDTK-VYHPNVSSVTGAICLDILKNA-WTPVITLKSALISLQALLQS 115

Query: 122 PEPDSPLDVDLA 133
           PEP+ P D  +A
Sbjct: 116 PEPNDPQDAQVA 127

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV DD +Y W+A I GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +
Sbjct: 25  PVGDD-VYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTK-IYHPNIN-AN 81

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           G IC+++L +  WSPA               +  PD PL  ++A + + 
Sbjct: 82  GNICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 129

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  ++NL  W   ITGP D+PY G  F + +T P  YP EPPKV+F    + H NVD  S
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF-VSPMWHPNVDL-S 93

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           G IC+++L +  WS  ++              P   SPL+   A L
Sbjct: 94  GNICLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAEL 138

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L  VS+ +++  +    GP  TPY+G +F + I +P  YP +PPK++F+++ V H N+  
Sbjct: 24  LEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPFKPPKMKFDSK-VYHPNISS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 3/104 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP+DT Y+   F LL+     YP +PP V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +++L+   W+P +D             +P P SP +V+ A L +
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  +E  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 58/128 (45%), Gaps = 19/128 (14%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV D++L  W   ITGP  TPY G +F + +  P  YP  PPK++F    + H NVD +S
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNVD-KS 89

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVD----------------LA 133
           G IC+++L +  WS  ++              P   SPL+                  LA
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTNMVEYRKKLLA 148

Query: 134 CLRRAGDY 141
           C    GDY
Sbjct: 149 CYEEIGDY 156

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 68.6 bits (166), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L  VS+ +++  +    GP  TPY G +F + I +P  YP +PPK+QF+ + V H N+  
Sbjct: 24  LSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPLEYPFKPPKMQFDTK-VYHPNISS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G IC+++L+ + WSP                +PEP+ P D ++A
Sbjct: 83  VTGAICLDILKNS-WSPVLTLKTSLISLQALLQSPEPNDPQDAEVA 127

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  R   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTRIY-HPNID-RLGRI 76

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 67.4 bits (163), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 3/102 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+ VW A I GP++TPY+   F LL+     YP+  P V+F +    H NV + +G IC
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSEMF-HPNV-YANGEIC 88

Query: 94  INLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           +++L+   W+P +D             +P P SP +V+ A L
Sbjct: 89  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL 129

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 68.2 bits (165), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L+ V+++++++ +    GP  TPY+  +F + I +P  YP +PPK++F+ + V H NV  
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPMEYPFKPPKMKFDTK-VYHPNVSS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 67.0 bits (162), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GP  +PY+   F L + +P  YP+EPPKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA                P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 2/103 (1%)

Query: 31  VSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
           VS+ +++  +    GP  TPY+G  F + I +P  YP +PPK+QF+ + V H N+   +G
Sbjct: 27  VSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPFKPPKMQFDTK-VYHPNISSVTG 85

Query: 91  RICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 86  AICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L  V++ +++  +    GP  TPY+G +F + I +P  YP +PPK++F+ + V H N+  
Sbjct: 24  LEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFDTK-VYHPNISS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 67.8 bits (164), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DPA +    L  V++ +++  +    GP  TPY+G  F + I +P  
Sbjct: 4   AKRIMKEMQAVKDDPAANIT--LDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK++F+ + V H N+   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMKFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 67.4 bits (163), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 2/103 (1%)

Query: 31  VSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
           VS+ +++  +    GP  TPY G  F + I +P  YP +PPK+QF+ + V H N+   +G
Sbjct: 27  VSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDTK-VYHPNISSVTG 85

Query: 91  RICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            IC+++L+ + WSP                +PEP+ P D ++A
Sbjct: 86  AICLDILKNS-WSPVLTLKTSLISLQALLQSPEPNDPQDAEVA 127

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 76

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GPS +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 25  DDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 82

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 83  CLDIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GP  +PY+   F+L + +P  YP+E PKV+F  + + H N+D + GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLTK-IYHPNID-KLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  +E  + GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  DDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 76

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 77  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  +   + GP+ +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 28  LRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDF 87
           L+ V+++++++ +    GP  TPY+  ++ + I +P  YP +PPK++F  + V H NV  
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPFKPPKMKFQTK-VYHPNVSS 82

Query: 88  ESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 83  VTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 4/128 (3%)

Query: 6   AKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSA 65
           AK          +DP  +HI  L  V++ +++  +    GP +TPY   +F + I +P  
Sbjct: 4   AKRIMKEMQAVKDDPE-AHIT-LEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPME 61

Query: 66  YPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPD 125
           YP +PPK++F+ + V H NV   +G IC+++L+ A WSP                +PEP+
Sbjct: 62  YPFKPPKMKFDTK-VYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPN 119

Query: 126 SPLDVDLA 133
            P D ++A
Sbjct: 120 DPQDAEVA 127

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  +   I GP ++PY+   F L + +P  YP+E PKV+F  R + H N+D   GRI
Sbjct: 29  EDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLTR-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 15/122 (12%)

Query: 25  IRKLRPVSDD-----NL-YVWEADI-------TGPSDTPYQGHEFSLLITIPSAYPLEPP 71
           +++++ V DD     NL +V E+DI        GP  TPY G  F + I +P  YP +PP
Sbjct: 8   MKEMQAVKDDPAAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPMEYPFKPP 67

Query: 72  KVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVD 131
           K++F+ + V H NV   +G IC+++L+ A WSP                +PEP+ P D +
Sbjct: 68  KMKFDTK-VYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAE 125

Query: 132 LA 133
           +A
Sbjct: 126 VA 127

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV D++L  W   ITGP DTPY G +F + +  P  YP  PP ++F +  + H NVD +S
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSP-MWHPNVD-KS 89

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVA 149
           G IC+++L +  WS  ++              P   SPL+   A L  A        ++A
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRKKVLA 148

Query: 150 YY 151
            Y
Sbjct: 149 CY 150

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GP  + Y+   F L + +P  YP+EPPKV+F  + + H N+D   GRI
Sbjct: 29  EDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA                P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PVS+DNL++W+  I GP+D+PY+G  F+  +  P  YPL PPK+ F    + H NV + +
Sbjct: 28  PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFTPSIL-HPNV-YPN 85

Query: 90  GRICINLL----------ERA--HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L          E A   WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 56/120 (46%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+DNL+VW+  I+GP D+PYQG  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P SDDNL+VW+  I GP DTPY G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           ++NL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 64.3 bits (155), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 65.5 bits (158), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 27  KLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVD 86
           +L  V++ +++  +    GP  TPY+G +F + I +P  YP +PP ++F+ + V H N+ 
Sbjct: 23  ELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPFKPPMMKFDTK-VYHPNIS 81

Query: 87  FESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
             +G IC+++L+ A WSP                +PEP+ P D ++A
Sbjct: 82  SVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 64.3 bits (155), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+DNL++W+  ITGP D+PY+G  F+ ++  P  YPL PP++ F    + H N+ + +
Sbjct: 28  PKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPRLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANIDACILWR 145

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 63.9 bits (154), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDNL  +   I GP  +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  DDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 63.5 bits (153), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  +   + GP+ +PY+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DNL  +   I GP D+ Y+   F L + +P  YP+E PKV+F  + + H N+D   GRI
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 93  CINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
           C+++L + +WSPA               +P P+ PL  D+A
Sbjct: 87  CLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 56/120 (46%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+DNL++W+  I+GP D+PYQG  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 62.8 bits (151), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 63/122 (51%), Gaps = 15/122 (12%)

Query: 25  IRKLRPVSDD------NLYVWEADI-------TGPSDTPYQGHEFSLLITIPSAYPLEPP 71
           +++L+ V DD        +V E+DI        GP  TPY+   F + I +P  YP +PP
Sbjct: 8   MKELQAVKDDPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPFKPP 67

Query: 72  KVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVD 131
           +++F+ + V H N+   +G IC+++L+ A WSP                +PEP+ P D +
Sbjct: 68  QMKFDTK-VYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAE 125

Query: 132 LA 133
           +A
Sbjct: 126 VA 127

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 64/148 (43%), Gaps = 20/148 (13%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
           S+RL KEY         DP    +    P S+ NL++W+  I GP DTPY+G  F+  + 
Sbjct: 6   SRRLLKEYQQLI----RDPPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFNARLD 59

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLE------------RAHWSPAWDXX 109
            P  YPL PPK+ F    + H N+ + +G +CI++L                WSP     
Sbjct: 60  FPKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVE 117

Query: 110 XXXXXXXXXXXNPEPDSPLDVDLACLRR 137
                       P  +S  +VD   L R
Sbjct: 118 KILLSVMSMLSEPNIESGANVDACILWR 145

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 61.2 bits (147), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV+++N+++W+  I GP D+PY+G  F+  +  P+ YPL PPK+ F    + H NV + +
Sbjct: 28  PVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDYPLSPPKLTFTPSIL-HPNV-YPN 85

Query: 90  GRICINLL----------ERA--HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L          E A   WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 52/106 (49%), Gaps = 3/106 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  D++L  W   ITGP  TPY   +F + +  P +YP  PPKV+F    + H NVD  S
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKF-VSPMWHPNVDM-S 89

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           G IC+++L +  WS  ++              P   SPL+   A L
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+++L+VW+  I GP DTPY+G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDYPLSPPKLTFTPSIL-HPNI-YHN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  +VD   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVDACILWR 145

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           PV D++L  W   I GP  TPY   +F + +  P  YP  PPKV+F    + H NVD +S
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF-VSPMWHPNVD-KS 89

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLD 129
           G IC+++L +  WS  ++              P   SPL+
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 56/122 (45%), Gaps = 3/122 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P ++D+L  W   ITGP  TPY+G  F + +  P +YP   P+V F    + H NVD  S
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF-VSPMWHPNVDM-S 95

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVA 149
           G IC+++L +  WS  ++              P   SPL+   A L           L+A
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKNMEEYKRKLMA 154

Query: 150 YY 151
            Y
Sbjct: 155 RY 156

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+D+L  W   I GP  TPY+  +F L +     YP +PPKV F    + H NVD  S
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF-VSPMWHPNVDM-S 90

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           G IC+++L +  WS  ++              P   SPL+   A L
Sbjct: 91  GNICLDIL-KDQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAEL 135

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 58/128 (45%), Gaps = 3/128 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  +++L  W A ITGP DTPY G  F L      +YP  PP V+F    + H NVD  S
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF-ISPMWHPNVDM-S 97

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVA 149
           G IC+++L +  WS  ++              P   SPL+   A L           L+A
Sbjct: 98  GNICLDIL-KDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAELWDDDMNEYKKRLLA 156

Query: 150 YYLNGGSR 157
            Y + G +
Sbjct: 157 RYEDIGDQ 164

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P ++D+L  W   I GP  TPY+  +F + +  P +YP  PPKV+F +    H NVD  S
Sbjct: 36  PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFISPMW-HPNVDM-S 93

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           G IC+++L +  WS  ++              P   SPL+   A L
Sbjct: 94  GNICLDIL-KDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAEL 138

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 51/106 (48%), Gaps = 3/106 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S+D+L  W   ITGP  TPY+G  F + +     YP   PKV+F    + H NVD  S
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF-VSPMWHPNVDM-S 95

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACL 135
           G IC+++L +  WS  ++              P   SPL+   A L
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P ++DN++ W+  + GP D+PY+G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P +++NL+VW+  + GP DT Y+G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S++N++VW+  I GP DTPY    F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S++N++VW+  I GP DTPY    F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S++N++VW+  I GP DTPY    F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P S++N+++W+  I GP DTPY    F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 55.5 bits (132), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 45  GPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSP 104
           GP D+PY G  F L I  P+ YP +PPK+ F  + + H N++  +G IC+++L +  WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNIN-ANGNICLDIL-KDQWSP 58

Query: 105 AWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
           A               +  PD PL  ++A + + 
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT 92

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 3/122 (2%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  +++L  W   ITGP  TPY+G  F + +     YP   PKV+F    + H NVD  S
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF-VSPMWHPNVDM-S 95

Query: 90  GRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVA 149
           G IC+++L +  WS  ++              P   SPL+   A L           L+A
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIA 154

Query: 150 YY 151
            Y
Sbjct: 155 RY 156

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P +++NL++W+  + GP DT Y+G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDACILWR 145

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P+ D NL+ W+  I GP D+ Y+G  F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 28  PIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPLNPPKLTFQPSIL-HPNI-YPN 85

Query: 90  GRICINLL------------ERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L            E   WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSILSEPNIESGANIDACILWR 145

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 55.8 bits (133), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  ++N++ W+  I+GP +TPY+   F+  +  P  YPL PPK+ F    + H N+ + +
Sbjct: 30  PSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSPPKLTFTPSLL-HPNI-YPN 87

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D + L R
Sbjct: 88  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDASILYR 147

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 59/149 (39%), Gaps = 16/149 (10%)

Query: 1   MSQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60
           MS+   K           DP    I    P ++ +L+ W+  + GP DTPY G  F+  +
Sbjct: 1   MSRTAQKRLLKELQQLTRDPPPGIIAA--PKTESDLFTWDCLVAGPPDTPYAGGLFNCQL 58

Query: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLE------------RAHWSPAWDX 108
             P+ YPL PP + F    + H NV + +G +CI++L                WSP    
Sbjct: 59  QFPTDYPLSPPTLTFTPSIL-HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSV 116

Query: 109 XXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
                        P  +S  ++D   L R
Sbjct: 117 EKILLSVVSMLSEPNVESGANIDACILWR 145

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+G  + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 28  NDNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 86

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 87  CLDVI-NSTWSPLYD 100

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P  + +L++W+  + GP D+PY+G  F   +  P  YPL PPK+ F    V H NV + +
Sbjct: 28  PQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTF-VPSVLHPNV-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWR 145

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 13/83 (15%)

Query: 29  RPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQF---NARCVPHCNV 85
           RP ++DN+  W   ITGP+DTPY+G ++   +T PS YP +PP ++    N R  P+   
Sbjct: 28  RP-NEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRMVTPNGRFKPNT-- 84

Query: 86  DFESGRICINLLERA--HWSPAW 106
                R+C+++ +     W+P W
Sbjct: 85  -----RLCLSMSDYHPDTWNPGW 102

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+G  + L + +P  YP + P + F  +   H N+D  SG I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSI 85

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 86  CLDVI-NSTWSPLYD 99

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+   + L + +P  YP + P + F  + + H N+D  SG I
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSI 72

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 73  CLDVI-NSTWSPLYD 86

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 19/109 (17%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++DN+  W   ITGP+DTPY+G ++   +T 
Sbjct: 8   KRLTKEYKLMVENP---PPYILARP----NEDNILEWHYIITGPADTPYKGGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQF---NARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++    N R  P+        R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRMITPNGRFKPNT-------RLCLSMSDYHPDTWNPGW 102

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           DN+  +     GP +TPY+G  + L + +P  YP + P + F    + H N+D  SG IC
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSIC 73

Query: 94  INLLERAHWSPAWD 107
           ++++  A WSP +D
Sbjct: 74  LDVINSA-WSPLYD 86

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 86

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 87  CLDVI-NSTWSPLYD 100

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFES 89
           P ++++L++W+  I GP DTPY+   F+  +  P  YPL PP + F    + H N+ + +
Sbjct: 28  PANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDYPLSPPTLTFTPAIL-HPNI-YPN 85

Query: 90  GRICINLLE------------RAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           G +CI++L                WSP                 P  +S  ++D   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 8/113 (7%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPA 105
           P +  Y G  F   +T   +YP++PP V    + + H N+D  +G+IC+N+L R  WSPA
Sbjct: 53  PDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQK-IYHPNIDL-NGKICLNIL-REDWSPA 109

Query: 106 WDXXXXXXXXXXXXXNPEPDSPLDVDLA--CLRRAGDYSAHNGLVAYYLNGGS 156
            D              P P  PL+ D A   +R + D++    LV   + GG+
Sbjct: 110 LDIQSVIVGLLFLFLEPNPRDPLNKDAASTLIRNSHDFAR---LVEKTMQGGN 159

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL +WEA I G   T + G  + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA                P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 5/110 (4%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +Q   + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDL--ACLRRAGDY 141
           ++L E   W PA               +P P+SP       A LR   DY
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFLRNRADY 144

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  NDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 53/118 (44%), Gaps = 4/118 (3%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHW 102
           I  P +  Y+   F   +     YP+EPPKV    R + H N+D + G++C+N+L R  W
Sbjct: 74  IISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNR-IYHPNIDVQ-GKVCLNIL-REDW 130

Query: 103 SPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160
           SPA D              P    PL+ D A +  + D +A    V   + G S  S+
Sbjct: 131 SPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAV-FSKDSNAFAKFVRKTMEGYSLNSV 187

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 13/83 (15%)

Query: 29  RPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQF---NARCVPHCNV 85
           RP ++DN+  W   ITGP++TPY+G ++   +T PS YP +PP ++    N R  P+   
Sbjct: 28  RP-NEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIRMVTPNGRFKPNT-- 84

Query: 86  DFESGRICINLLERA--HWSPAW 106
                R+C+++ +     W+P W
Sbjct: 85  -----RLCLSMSDYHPDTWNPGW 102

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 44  NDNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 102

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 103 CLDVI-NSTWSPLYD 116

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +Q   F + +  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 4/117 (3%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHW 102
           I  P +  Y+G +F    T    YP++PPKV  N + + H N+D   G+IC+N+L R  W
Sbjct: 68  IIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNNK-IFHPNID-PHGKICLNIL-REDW 124

Query: 103 SPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGS 159
           SPA D              P  + PL+ + A +    D      LV   ++G   GS
Sbjct: 125 SPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNK-DKLEFGNLVRLAMSGAMVGS 180

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP DTPY+   + L + +P  YP + P + F  + + H N+D  SG I
Sbjct: 27  NDNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSI 85

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 86  CLDVI-NSTWSPLYD 99

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 27  NDSMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSI 85

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 86  CLDVI-NSTWSPLYD 99

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 52.0 bits (123), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 5/128 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGH-EFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFE 88
           P S +  +  + +IT   D  Y  H   +  +     YP+EPPKV    R + H N+DF+
Sbjct: 52  PDSTNRTHSPKLEITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKR-IFHPNIDFK 110

Query: 89  SGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLV 148
            G +C+N+L R  WSPA D              P P+ PL+ D A L    D       V
Sbjct: 111 -GNVCLNIL-REDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKL-LCQDEKEFAEAV 167

Query: 149 AYYLNGGS 156
              ++GGS
Sbjct: 168 RSTMSGGS 175

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPA 105
           P +  Y+G  F+  +    AYP+EPP V   ++   H N+D + G++C+N+L R  WSPA
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTVICTSKLY-HPNIDID-GKVCLNIL-REDWSPA 129

Query: 106 WDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGS 156
            D              P    PL+ D A +  + D +    LV   + G S
Sbjct: 130 LDVQSIIIGLLFLLLEPNAKDPLNKD-AAMMLSTDTARFASLVNRSMAGYS 179

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 52.0 bits (123), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 6/77 (7%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           ++DN+  W   ITGP DTPY+G ++   +  PS YP +PP +    R V       E  R
Sbjct: 30  NEDNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAI----RMVTPSGRFKEDTR 85

Query: 92  ICINLLER--AHWSPAW 106
           +C+++ +     W+P+W
Sbjct: 86  LCLSMSDYHPDTWNPSW 102

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 19/109 (17%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++DN+  W   ITGP+DTPY+  ++   +T 
Sbjct: 8   KRLTKEYKLMVENP---PPYILARP----NEDNILEWHYIITGPADTPYKAGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQF---NARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++    N R  P+        R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRMITPNGRFKPNT-------RLCLSMSDYHPDTWNPGW 102

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 5/138 (3%)

Query: 20  PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGH-EFSLLITIPSAYPLEPPKVQFNAR 78
           P  +   K  P S D +   + ++    D  Y  H   S  +     YP+EPPKV    +
Sbjct: 42  PTVTLSIKASPQSTDRMQPPKLEVVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTC-LK 100

Query: 79  CVPHCNVDFESGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRA 138
            + H N+D  +G +C+N+L R  WSPA D              P P+ PL+ D A L   
Sbjct: 101 KIFHPNIDL-NGNVCLNIL-REDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKL-FC 157

Query: 139 GDYSAHNGLVAYYLNGGS 156
            D       V   ++GGS
Sbjct: 158 QDQKKFAETVILAMSGGS 175

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 34  DNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG IC
Sbjct: 26  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 84

Query: 94  INLLERAHWSPAWD 107
           ++++  + WSP +D
Sbjct: 85  LDVI-NSTWSPLYD 97

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 50.4 bits (119), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 29  RPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFE 88
           +P    NL  WEA I G   T ++   F + I  P  YP +PPKV+F A    H N+ + 
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YP 88

Query: 89  SGRICINLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           SG +C+++L E   W PA               +P P+SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDN+  +     GP  TPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G   T + G  + + +  P+ YP +PPKV+F A    H NV + SG IC+
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T ++   F + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 59

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T ++   + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P PDSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++DN+  W   ITGP +TPY+G ++   +T 
Sbjct: 8   KRLTKEYKLIVENP---PPYVTARP----NEDNILEWHYVITGPPETPYEGGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLER--AHWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRM---VTPNGRFK-ENTRLCLSMSDYHPDLWNPGW 102

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDN+  +     GP  TPY+   + L + +P  YP + P + F  +   H N+D  SG I
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           ++DN+  W   ITGPSDTPY   ++   +T PS YP +PP ++      P+     E+ R
Sbjct: 30  NEDNILEWHYVITGPSDTPYSSGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFK-ENTR 85

Query: 92  ICINLLER--AHWSPAW 106
           +C+++ +     W+P W
Sbjct: 86  LCLSMSDYHPDLWNPGW 102

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T ++   + L I  P  YP +PPKV+F A    H NV + SG IC+
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T ++   + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P PDSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           ++DN+  W   ITGP DTPY G ++   +T P+ YP +PP ++      P+     E+ R
Sbjct: 30  NEDNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYPYKPPAIRM---ITPNGRFK-ENTR 85

Query: 92  ICINLLER--AHWSPAW 106
           +C+++ +     W+P W
Sbjct: 86  LCLSMSDYHPDTWNPGW 102

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           DDN+  +     GP  TPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  +     GP +TPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 26  NDNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 85  CLDVI-NSTWSPLYD 98

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           ++DN+  W   ITGP DTPY G ++   +  PS YP +PP +    R V       E  R
Sbjct: 30  NEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAI----RMVTPSGRFKEDTR 85

Query: 92  ICINLLERA--HWSPAW 106
           +C+++ +     W+P+W
Sbjct: 86  LCLSMSDYHPDTWNPSW 102

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL+KEY        E+P    +   RP +++N+  W   ITGP DTPY G ++   +T 
Sbjct: 8   KRLSKEYKLII----ENPTPYILA--RP-NENNILEWHYIITGPPDTPYVGGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPFKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPGW 102

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G   T + G  + + +  P+ YP +PPKV+F A    H NV + SG IC+
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G   T + G  + + +  P+ YP +PPKV+F A    H NV + SG IC+
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G   T + G  + + +  P+ YP +PPKV+F A    H NV + SG IC+
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D++  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 14  NDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 73  CLDVI-NSTWSPLYD 86

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 58/128 (45%), Gaps = 5/128 (3%)

Query: 30  PVSDDNLYVWEADITGPSDTPYQGH-EFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFE 88
           P S D +   + ++T   D  Y  H   +  +     YP+EPPKV    + + H N+D +
Sbjct: 52  PDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVAC-LKKIFHPNIDLK 110

Query: 89  SGRICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLV 148
            G +C+N+L R  WSPA D              P P+ PL+ D A L    +      +V
Sbjct: 111 -GNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKL-FCQNEKKFAEIV 167

Query: 149 AYYLNGGS 156
              ++GGS
Sbjct: 168 RSTMSGGS 175

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 45  GPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSP 104
           GP DTPY+   + L + +P  YP + P + F    + H N+D  SG IC++++  + WSP
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 118

Query: 105 AWD 107
            +D
Sbjct: 119 LYD 121

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +D +  +     GP DTPY+   + L + +P  YP + P + F    + H N+D  SG I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 85

Query: 93  CINLLERAHWSPAWD 107
           C++++  + WSP +D
Sbjct: 86  CLDVI-NSTWSPLYD 99

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 51/114 (44%), Gaps = 4/114 (3%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHW 102
           I  P +  Y     +  +     YP+EPPKV    + + H N+D + G +C+N+L R  W
Sbjct: 67  IVRPDEGYYNYGSINFNLDFNEVYPIEPPKV-VCLKKIFHPNIDLK-GNVCLNIL-REDW 123

Query: 103 SPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGS 156
           SPA D              P P+ PL+ D A L   G+       V   ++GGS
Sbjct: 124 SPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEA-VRLTMSGGS 176

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 13/107 (12%)

Query: 2   SQRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLIT 61
            +RL KEY        E+P    I   RP +++N+  W   I+GP DTPY G ++   +T
Sbjct: 7   QKRLTKEYKMMV----ENPPPFII--ARP-NEENILEWHYVISGPPDTPYDGGQYHGTLT 59

Query: 62  IPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
            PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 60  FPSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGW 102

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RLAKE+        EDP    +   RP ++ N+  W   ITGP  TPY+  ++   +T 
Sbjct: 8   KRLAKEFKAMT----EDPPPYIM--ARP-NESNILDWHYIITGPPGTPYENGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLER--AHWSPAW 106
           PS YP +PP +    R V       E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPFQPPAI----RMVTPSGRFQENTRLCLSMSDYHPTTWNPGW 102

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+  W   ITGP  TPY+  ++   +T PS YP  PP ++      P+     E+ R+
Sbjct: 31  EDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRM---ITPNGRFK-ENTRL 86

Query: 93  CINLLER--AHWSPAW 106
           C+++ +     W+PAW
Sbjct: 87  CLSMSDYHPEAWNPAW 102

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPA 105
           P +  Y+   F   +    +YP+EPP V+F  + + H N+D  +G+IC+N+L R  WSP 
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKF-LKKIYHPNIDL-NGKICLNIL-REDWSPV 131

Query: 106 WDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHN 145
            D              P P  PL++      +AG+    N
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNL------KAGELLKEN 165

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 9/68 (13%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARC---VPHCNVDFESGRICINLLER 99
           I  P +  Y+   F+  +T    YP+EPP+V    RC   + H N+D + G+IC+N+L R
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQV----RCMNQIFHPNIDLQ-GKICLNIL-R 120

Query: 100 AHWSPAWD 107
             WSPA D
Sbjct: 121 EDWSPALD 128

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           +DD++ + +  +  P +  Y+G  F+  +     YP+EPPKV+   R + H N+D + GR
Sbjct: 48  TDDSIPLLQLAVK-PDEGYYKGGNFTFELLFNEQYPMEPPKVKCLNR-IYHPNIDTD-GR 104

Query: 92  ICINLLERAHWSPAWD 107
           +C+N+L R  W+PA D
Sbjct: 105 VCLNIL-RQDWTPALD 119

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQF---NARCVPHCNVDFE 88
           +D+N+  W   ITGP DTPY+G ++   +  P  YP +PP ++    N R   H      
Sbjct: 30  NDENILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIRISTPNGRFKQHT----- 84

Query: 89  SGRICINLLERA--HWSPAW 106
             R+C+++ +     W+P+W
Sbjct: 85  --RLCLSMSDYHPDTWNPSW 102

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++ N+  W   I GP DTPY G ++   +T 
Sbjct: 8   KRLTKEYKMMVETP---PPYITARP----NESNILEWHYIIIGPQDTPYDGGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGW 102

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++DN+  W   ITGP DTPY+  ++   +T 
Sbjct: 8   KRLTKEYKLMVENP---PPYILARP----NEDNILEWHYIITGPPDTPYKDGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPGW 102

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T ++   + + I  P  YP +PP+V+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           ++DN+  W   ITGP DTPY   ++   +  P+ YP +PP ++      P+     E+ R
Sbjct: 30  NEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAIRM---ITPNGRFK-ENTR 85

Query: 92  ICINLLER--AHWSPAW 106
           +C+ + +     W+PAW
Sbjct: 86  LCMTMSDYHPDTWNPAW 102

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +    + + I  P+ YP +PPKV+  A    H NV + SG IC+
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +    + L I  P  YP +PPKV+  A    H NV + SG IC+
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPAGFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 8/125 (6%)

Query: 32  SDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           S+  LY+   +IT P +  Y+   F    T    YP+EPPKV   ++ + H N+D + G 
Sbjct: 58  SNSRLYI---NIT-PDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSK-IFHPNIDLQ-GN 111

Query: 92  ICINLLERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYY 151
           +C+N+L R  WSP  D              P    PL+   A +  A  +      VA  
Sbjct: 112 VCLNIL-REDWSPVLDVQSILIGLLMLFLEPNATDPLNKVAADVLAANPHQFRRD-VATS 169

Query: 152 LNGGS 156
           L GG 
Sbjct: 170 LRGGQ 174

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 46/115 (40%), Gaps = 3/115 (2%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPA 105
           P +  Y+G  F   +     YP+EPP V+     + H N+D+ SG IC+N+L R  WSP 
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIYHPNIDY-SGNICLNVL-REDWSPV 139

Query: 106 WDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160
            D              P    PL+   A       Y     + A  + G   G +
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNVQATMMGGHLDGQV 194

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 7/80 (8%)

Query: 29  RPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFE 88
           RP +++N+  W   ITGP+DTPY   ++   +T PS YP +PP +    R V       E
Sbjct: 28  RP-NENNILEWHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAI----RMVTPNGRFRE 82

Query: 89  SGRICINLLER--AHWSPAW 106
           + R+C+++ +     W+P+W
Sbjct: 83  NTRLCLSMSDYHPNTWNPSW 102

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +    + + I  P+ YP +PPKV+  A    H NV + SG IC+
Sbjct: 37  NLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPANFY-HPNV-YPSGTICL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G + T +    + + I  P  YP +PPKV F  +   H NV + SG IC+
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
           +DN+ VW   ITGP +TPY+  ++   +  P+ YP  PP ++      P+     E+ R+
Sbjct: 31  EDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFNPPAIRM---LTPNGRFR-ENTRL 86

Query: 93  CINLLERA--HWSPAW 106
           C+++ +     W+P+W
Sbjct: 87  CLSMSDYHPDTWNPSW 102

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           NL  WEA I G   T +    + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA                P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 29  RPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFE 88
           +P    +L  WEA I G   T +    + L I  P  YP +PPKV+  A    H NV + 
Sbjct: 31  KPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPANFY-HPNV-YP 88

Query: 89  SGRICINLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           SG IC+++L E   W PA               +P P+SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY        E+P    I   RP ++ N+  W   ITGP D+PY   ++   +T 
Sbjct: 8   KRLTKEYKMMM----ENPTPYII--ARP-NESNILEWHYVITGPPDSPYHDGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRM---VTPNGRFK-ENTRLCLSMSDYHPDTWNPGW 102

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY          P Y   R     ++DN+  W   ITGP D+PY   ++   +T 
Sbjct: 8   KRLTKEYKTLTETP---PPYILARP----NEDNILEWHYIITGPPDSPYSEGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           P+ YP +PP ++      P+     E+ R+C+++ +     W+P+W
Sbjct: 61  PTDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDLWNPSW 102

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 45.8 bits (107), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 53  GHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXXXX 112
           GH F    TI   YP+EPPKV    + + H N++  +G IC+N+L R  WSPA D     
Sbjct: 89  GH-FRFQFTINENYPIEPPKVVCLTK-IYHPNIN-RTGEICLNIL-REDWSPALDLQSVI 144

Query: 113 XXXXXXXXNPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158
                    P P  PL+      ++A D   H+  V  ++   S  
Sbjct: 145 IGLLFLFIEPNPKDPLN------KQAADTLLHDPAVFKHIVQKSMA 184

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 35  NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICI 94
           +L  WEA I G + T +    + + I  P  YP +PPKV+F A    H N+ + SG +C+
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 95  NLL-ERAHWSPAWDXXXXXXXXXXXXXNPEPDSP 127
           ++L E   W PA               +P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 14/117 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D NL+VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +CI++L +             WSP                +P   SP +VD A   R
Sbjct: 94  LCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYR 150

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLAC 134
           +CI++L ++            WSP                +P   SP +VD A 
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAV 147

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 14/117 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D NL+VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           +CI++L +             WSP                +P   SP +VD A   R
Sbjct: 94  LCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYR 150

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 9/65 (13%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARC---VPHCNVDFESGRICINLLERAHW 102
           P + PY G  F   +     YP+EPP    +A C   + H N+D  +G+IC+N+L R  W
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPP----SAICLNKIFHPNIDL-NGKICLNIL-REDW 130

Query: 103 SPAWD 107
           SPA D
Sbjct: 131 SPALD 135

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 3/83 (3%)

Query: 51  YQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDXXX 110
           Y G  +   + I   YP+EPP V+   R + H N+D + G +C+NLL R  W+PA D   
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHR-IYHPNIDID-GNVCLNLL-REDWTPALDIQS 128

Query: 111 XXXXXXXXXXNPEPDSPLDVDLA 133
                      P    PL+ D A
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAA 151

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDELDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFIWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P  +SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     ++ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 42.7 bits (99), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHW 102
           +  P +  Y+  +F   +     YP+EPP V      + H N+D + G+IC+N+L R  W
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPPIV-LCMNKIFHPNIDLD-GKICLNIL-REDW 130

Query: 103 SPAWD 107
           SPA D
Sbjct: 131 SPALD 135

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 42.7 bits (99), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 43  ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHW 102
           +  P +  Y+  +F   +     YP+EPP V      + H N+D + G+IC+N+L R  W
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPPIV-LCMNKIFHPNIDLD-GKICLNIL-REDW 129

Query: 103 SPAWD 107
           SPA D
Sbjct: 130 SPALD 134

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++ W   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P  +SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++ W   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P  +SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++VW   +     ++ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLAC 134
           +CI++L ++            WSP                +P   SP +VD A 
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAV 147

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     D+ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 36  DSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 14/115 (12%)

Query: 35  NLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRIC 93
           NL++W   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR+C
Sbjct: 38  NLFIWNIGVMVLNEDSIYHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLC 95

Query: 94  INLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
           I++L ++            WSP                +P   SP +VD A   R
Sbjct: 96  ISILHQSGDPTTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYR 150

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++ W   +     D+ Y G  F   +  P  +P  PP+ +F    + H NV +  GR
Sbjct: 36  DSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P  +SP +VD A   R  
Sbjct: 94  LCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 14/114 (12%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     D+ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 36  DSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLL-----------ERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLAC 134
           +CI++L           +   WSP                +P   SP +VD A 
Sbjct: 94  LCISILHTSGDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAV 147

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 3   QRLAKEYXXXXXXXXEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62
           +RL KEY        E+P  +     RP ++ N+  W   I GP D+PY   ++   +T 
Sbjct: 8   KRLTKEYKMMN----ENP--TPFIMARP-NEANILEWHYIINGPPDSPYFEGQYHGTLTF 60

Query: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERA--HWSPAW 106
           PS YP +PP ++      P+     E+ R+C+++ +     W+P W
Sbjct: 61  PSDYPYKPPAIRM---ITPNGRFK-ENTRLCLSMSDYHPDTWNPGW 102

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     D+ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 36  DSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 46/119 (38%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     D+ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 36  DSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLL-----------ERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L           +   WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHTSGDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 50/120 (41%), Gaps = 14/120 (11%)

Query: 32  SDDNLYVWEAD-ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
           +D N++VW    I    D+ Y G  F   +  PS +P  PP  +F    + H NV ++ G
Sbjct: 36  NDSNIFVWHIGFIILNEDSIYNGGYFKSEMKFPSNFPYSPPHFKF-VPPIYHPNV-YKDG 93

Query: 91  RICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           ++CI++L ++            WSP                +P   SP +VD +   R  
Sbjct: 94  KLCISILHQSGDSMTSEPDNETWSPVQSVESVLISIISLLEDPNISSPANVDASVEYRKN 153

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 46/119 (38%), Gaps = 14/119 (11%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N++ W   +     D+ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 36  DSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGR 93

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRRAG 139
           +CI++L ++            WSP                +P   SP +VD A   R  
Sbjct: 94  LCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 46/114 (40%), Gaps = 14/114 (12%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGR 91
           D N+++W   +     ++ Y G  F   +  P  +P  PP  +F    + H NV +  GR
Sbjct: 35  DSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGR 92

Query: 92  ICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLAC 134
           +CI++L ++            WSP                +P   SP +VD A 
Sbjct: 93  LCISILHQSGNPTSDEPDEETWSPVQTVESVLISIVSLLEDPNISSPANVDAAV 146

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 48/122 (39%), Gaps = 20/122 (16%)

Query: 33  DDNLYVWEADITG-PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVP---HCNVDFE 88
           D N++ W   +     D+ Y G  F   +  P  +P  PP+ +F    +P   H NV + 
Sbjct: 43  DSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQFKF----IPPIYHPNV-YR 97

Query: 89  SGRICINLLERA-----------HWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLACLRR 137
            G++CI++L ++            WSP                +P   SP +VD A   R
Sbjct: 98  DGKLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYR 157

Query: 138 AG 139
             
Sbjct: 158 KN 159

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query: 45  GPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSP 104
            P +  Y+   F   ++   +YP++PP V+     + H N+D+ +G IC+N+L R  W+P
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKC-LTTIYHPNIDY-NGNICLNVL-REDWTP 205

Query: 105 AWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
             D              P P  PL+   A
Sbjct: 206 VLDLQTIVIGLLFLFLEPNPKDPLNKHAA 234

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 46/117 (39%), Gaps = 18/117 (15%)

Query: 31  VSDDNLYVWEAD-ITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVP--HCNVDF 87
           V   N++ WE   +    D+ Y G   + L+  P  +P  PP   F   C P  H NV F
Sbjct: 35  VEKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFPFSPPTFLF---CPPIYHPNV-F 90

Query: 88  ESGRICINLL-----------ERAHWSPAWDXXXXXXXXXXXXXNPEPDSPLDVDLA 133
            +G +CI++L           +   WSP                +P   SP +VD A
Sbjct: 91  SNGSLCISILHECGDDTNEEPDSETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 32  SDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
           SDD  +  W   I GP  + ++   +S+LI    +YP EPPKV+F ++    C V+  +G
Sbjct: 33  SDDITMTKWNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTG 91

Query: 91  RICINLLERAHWSPAW 106
            +   + E+ H    W
Sbjct: 92  EV---VKEKFHTLKEW 104

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 9/87 (10%)

Query: 46  PSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVP---HCNVDFESGRICINLLERAHW 102
           P +  Y+   F   +     YP+EPP V    +CV    H N+D + G +C+N+L R  W
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAV----KCVNKIYHPNIDTQ-GNVCLNIL-REDW 121

Query: 103 SPAWDXXXXXXXXXXXXXNPEPDSPLD 129
           SP  D              P    PL+
Sbjct: 122 SPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
          {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 35.8 bits (81), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 33 DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
          D  +  W   I GP  + ++   +S++I     YP +PP V+F ++    C VD  +G +
Sbjct: 35 DITMTTWNGTILGPPHSNHENRIYSVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEV 93

Query: 93 CINLL 97
            N+ 
Sbjct: 94 ETNMF 98

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 35.8 bits (81), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 32 SDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
          SDD  +  W   I GP  + ++   +SL I     YP EPPKV+F ++    C +D ++G
Sbjct: 33 SDDITMTNWNGTILGPPHSNHENRIYSLEIVCGPNYPDEPPKVKFVSKVNLPC-IDDKTG 91

Query: 91 RI 92
           I
Sbjct: 92 EI 93

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 35.4 bits (80), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 33 DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
          D ++  W   I GP  + ++   +S++I   + YP  PPKV+F +R    C VD  +G +
Sbjct: 35 DISMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPC-VDPSTGEV 93

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
          (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 34.7 bits (78), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 39 WEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
          W   I GP  + +    +SL I     YP EPPK++F +R    C VD  +G +
Sbjct: 4  WNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFISRVNLPC-VDVNTGEV 56

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 35.0 bits (79), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 32 SDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
          SDD  +  W   I GP  + ++   +S+ I    AYP +PPK++F ++    C VD  +G
Sbjct: 33 SDDITMTHWNGTILGPPHSNHENRIYSVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTG 91

Query: 91 RI 92
           +
Sbjct: 92 EV 93

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa]
          {ON} YGL087C (MMS2) - Similar to ubiquitin conjugating
          protein family [contig 30] FULL
          Length = 101

 Score = 33.5 bits (75), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 36 LYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92
          +  W   I GP  + ++   +S+ +   +AYP EPPK++F ++    C V+  +G +
Sbjct: 1  MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEV 56

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
          {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 33.9 bits (76), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 32 SDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
          SDD  +  W   I GP  + ++   +S+ I     YP EPPK++F ++    C VD  +G
Sbjct: 33 SDDITMTNWNGTILGPPHSNHENRIYSVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTG 91

Query: 91 RI 92
           +
Sbjct: 92 EV 93

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 33.1 bits (74), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 32  SDD-NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESG 90
           SDD  +  W   I GP  + ++   +SL I     YP  PPKV F ++    C V+  +G
Sbjct: 33  SDDITMTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTG 91

Query: 91  RICINLLERAHWSPAW 106
            I  +      W  A+
Sbjct: 92  EIQTDFHTLRDWKRAY 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,191,474
Number of extensions: 610388
Number of successful extensions: 1117
Number of sequences better than 10.0: 263
Number of HSP's gapped: 1019
Number of HSP's successfully gapped: 263
Length of query: 160
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 59
Effective length of database: 41,900,133
Effective search space: 2472107847
Effective search space used: 2472107847
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)