Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212403.494ON28326713250.0
KLTH0F14872g3.494ON28026712711e-178
SAKL0F02728g3.494ON28226611891e-166
Suva_7.4203.494ON28726511311e-157
CAGL0I10472g3.494ON28826611231e-155
TDEL0D056203.494ON27926511161e-155
Smik_6.2283.494ON28726411151e-154
TPHA0D032903.494ON28526011141e-154
YGR132C (PHB1)3.494ON28726211081e-153
Skud_7.4433.494ON28726211031e-152
NCAS0E007903.494ON32726410961e-151
Kpol_1017.53.494ON28326610871e-150
NDAI0G009203.494ON29625910811e-149
TBLA0D029503.494ON28226510791e-149
Ecym_12353.494ON28326610581e-146
KAFR0C019803.494ON28326210571e-145
ZYRO0D09900g3.494ON28326510441e-144
KNAG0B007903.494ON28426710261e-141
AFR313C3.494ON28327010101e-138
KLLA0D16302g3.494ON2262149851e-135
ADL141W5.98ON3072347231e-94
KAFR0B042505.98ON3102387204e-94
TBLA0H022205.98ON3072317161e-93
CAGL0L06490g5.98ON3132437152e-93
Kwal_27.127475.98ON3072357134e-93
YGR231C (PHB2)5.98ON3102347091e-92
Skud_7.5655.98ON3102317083e-92
NCAS0F006005.98ON3132317074e-92
Smik_16.755.98ON3102347065e-92
KLTH0C01672g5.98ON3072317031e-91
SAKL0G15510g5.98ON3082317031e-91
Suva_7.5235.98ON3102357031e-91
NDAI0D025305.98ON3162387022e-91
TPHA0A050905.98ON3102317012e-91
Kpol_1050.615.98ON3102316996e-91
KNAG0A015805.98ON2882316951e-90
ZYRO0B15136g5.98ON3102316919e-90
KLLA0E15731g5.98ON3082356892e-89
TDEL0G012105.98ON3092346857e-89
ZYRO0G20042g2.436ON11569645.2
TPHA0I013002.117ON37950659.2
ADL067C7.246ON63975659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21240
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   514   0.0  
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   494   e-178
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   462   e-166
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   440   e-157
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   437   e-155
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   434   e-155
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   434   e-154
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   433   e-154
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   431   e-153
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   429   e-152
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     426   e-151
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   423   e-150
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     421   e-149
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   420   e-149
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   412   e-146
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   411   e-145
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   406   e-144
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   399   e-141
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   393   e-138
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   384   e-135
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   283   1e-94
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   281   4e-94
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   280   1e-93
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   280   2e-93
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   279   4e-93
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   277   1e-92
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   277   3e-92
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   276   4e-92
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   276   5e-92
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   275   1e-91
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   275   1e-91
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   275   1e-91
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   275   2e-91
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   274   2e-91
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   273   6e-91
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   272   1e-90
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   270   9e-90
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   270   2e-89
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   268   7e-89
ZYRO0G20042g Chr7 complement(1662136..1662483) [348 bp, 115 aa] ...    29   5.2  
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    30   9.2  
ADL067C Chr4 complement(560732..562651) [1920 bp, 639 aa] {ON} S...    30   9.4  

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/267 (95%), Positives = 255/267 (95%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYIS            IRRI
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267
           EASKEIAKTLANSSNVTYLPSNQQGAE
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  494 bits (1271), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/267 (91%), Positives = 250/267 (93%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MSR ADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFL+PWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKAVL+DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLK+IVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGR+FTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERAR+VVELAEQERQASVIRAEGEAESAEYIS            IRRI
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267
           EASKEIAKTLANSSNVTYLPS+   +E
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHSASE 267

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  462 bits (1189), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/266 (83%), Positives = 246/266 (92%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MS+ ADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFL+PWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           Q+A+++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGR+FTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESA+YIS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266
           EASKEIA+TLANSSNVTYLPSN  G 
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGG 266

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  440 bits (1131), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/265 (79%), Positives = 237/265 (89%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           SRF D + K+ALP+GL AS LQYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAEYIS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSNQQGA 266
           ASK+IA+TLANSSNV YLPS   G+
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGS 269

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  437 bits (1123), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/266 (79%), Positives = 234/266 (87%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           + F   + K+A+P+G+A S LQYSMYDV+GGSR VIFDRL GV+  VVGEGTHFL+PWLQ
Sbjct: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLGLDYDERVLPSI
Sbjct: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE VSQ+IRQELS RA+EF IRLEDVSITHMTFG +FTKA
Sbjct: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERARF+VE AEQERQASVIRAEGEAESAEYIS            IRR+E
Sbjct: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245

Query: 242 ASKEIAKTLANSSNVTYLPSNQQGAE 267
           ASKEIA+TLANS+N+TYLPSN  G +
Sbjct: 246 ASKEIAQTLANSNNITYLPSNHAGGD 271

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  434 bits (1116), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 209/265 (78%), Positives = 234/265 (88%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MSR  ++LA++A+PLG+  S +QYSMYDV+GGSRAVIFDRLSGVQ+QVVGEGTHFL+PWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKA+++D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR ELS RASEF IRLEDVSITHMTFG +FTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+F+VE AEQ R+ASVIRAEGEAESAEYIS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQG 265
           EASKEIA+TLA SSN+TYLP    G
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHG 265

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  434 bits (1115), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 206/264 (78%), Positives = 235/264 (89%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           SR  D + K+ALP+G+ AS +QYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSNQQG 265
           ASK+IA+TLANSSNV YLPS   G
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSG 268

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  433 bits (1114), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/260 (80%), Positives = 234/260 (90%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           ++  D L KIA+PLG+A S +QY+MYDVKGGSRAVIFDRLSGV+QQV+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA++FDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV +LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLK+IVAQFDAAELITQRE VS +IR+ELS+R++EF I+LEDVSITHMTFG++FTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESAEYIS            IRR+E
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPS 261
           ASKEIAKTL+ SSNVTYLPS
Sbjct: 243 ASKEIAKTLSQSSNVTYLPS 262

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  431 bits (1108), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/262 (77%), Positives = 234/262 (89%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           ++  D + K+ALP+G+ AS +QYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSNQ 263
           ASK+IA+TLANSSNV YLPS  
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQH 266

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  429 bits (1103), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 203/262 (77%), Positives = 234/262 (89%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           SR  D + K+ALP+G+ A+ +QY+MYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+IS            IRR+E
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAKTLANSSNVTYLPSNQ 263
           ASK+IA+TLANSSNV YLPS  
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQH 266

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  426 bits (1096), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/264 (77%), Positives = 232/264 (87%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           ++  + + ++ALPLG+ A+ L+YSMYDVKGGSR VIFDRLSGVQ++V+GEGTHFL+PWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KAV++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE VSQRI+ ELS RA EF IRLEDVSITHMTFG +FTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAEYIS            IRR+E
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIAKTLANSSNVTYLPSNQQG 265
           ASK+IA+TLANS N+TYLP  Q G
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGG 310

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  423 bits (1087), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 203/266 (76%), Positives = 231/266 (86%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MS+  D++AK+ALP+G+  S +Q+SMYDVKGGSRAVIFDR+SGV+Q ++GEGTHFLIPWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           I NEVLK+IVAQFDAAELITQRE VS RIR EL  R++EF IRLEDVSITHMTFG +FTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVE KQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESAEYIS            IRR+
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266
           EASKEIA TL+ SSNVTYLP+    A
Sbjct: 241 EASKEIAATLSQSSNVTYLPNGHGNA 266

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  421 bits (1081), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 203/259 (78%), Positives = 228/259 (88%)

Query: 3   RFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQK 62
           +F + L K+ALP+GL  + + YSMYDVKGGSR VIFDRLSGV+  VVGEGTHFL+PWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 63  AVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIG 122
           AV++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 123 NEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAV 182
           NEVLKSIVAQFDAAELITQRE VSQRI+ ELS+RA+EF +RLEDVSITHMTFG +FTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 183 EQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEA 242
           EQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+IS            IRR+EA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 243 SKEIAKTLANSSNVTYLPS 261
           SK+IA+TLANS NVTYLP 
Sbjct: 253 SKDIAQTLANSPNVTYLPG 271

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  420 bits (1079), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/265 (76%), Positives = 229/265 (86%)

Query: 3   RFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQK 62
           + A+ LAKIA+PLG+  S + YSMYDVKGGSRAVIFDR+ GV+Q VVGEGTHFL+PWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  AVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIG 122
           +V+FD+RTKPKNI TNTGT+DLQMVSLTLR+LHRPD+++LP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAV 182
           NEVLKSIVAQFDAAELITQRE VSQRIR+EL+ RA+EF IRLEDVSITHMTFG +FTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 EQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEA 242
           EQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE IS            IRR+E 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 243 SKEIAKTLANSSNVTYLPSNQQGAE 267
           SKEIA+TLA S +VTYLP     AE
Sbjct: 245 SKEIAETLAGSPHVTYLPGGGNQAE 269

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  412 bits (1058), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/266 (73%), Positives = 234/266 (87%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MSRF +++A IA+P+G+A  A Q  +YDV+GG+RAVIFDRLSGVQQ+VVGEGTHFLIPWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKAV++DVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQ+IRQEL+ RA  F+I+LEDV+ITHM FG +FTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           +VE+KQIAQQ++ERA+++V+LAEQER A+VIRAEG+AE+AEYIS            IRR+
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266
           EASK+IA+TLA SSN+TYLPS+ +G 
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGG 266

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 230/262 (87%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           +R  + + K+A+P GL  +A+ YSMYDVKGGSR VIFDR+SGV++ V+GEGTHFL+PWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KA+++DVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLKSIVAQFDAAELITQRE VSQRIR+E+S RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VEQKQIAQQDAERARF+VE AEQERQASVIRAEGEAESAE IS            IRR+E
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPSNQ 263
           ASK+IA+TL+ SSN+TYLP  +
Sbjct: 243 ASKDIARTLSKSSNITYLPGGK 264

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  406 bits (1044), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/265 (77%), Positives = 234/265 (88%)

Query: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61
           SR A+++AK+A+PLG+ AS +QYSMYDV+GGSRAVIFDRLSGVQQ+VVGEGTHFL+PWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121
           KAV++DVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GNEVLK+IVA++DAAELITQRE VS  IR ELS RASEF+IRLEDVSITHMTFG +FTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIE 241
           VE KQIAQQDAERA+F+VE AEQ R+ SVIRAEGEAE+AE IS            IRR+E
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAKTLANSSNVTYLPSNQQGA 266
           ASK+IA+TLANSSNVTYLPS Q G 
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGG 267

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  399 bits (1026), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/267 (77%), Positives = 231/267 (86%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MS+  + L+K+A+P GL   A  Y+MYDVKGGSR VIFDR+SGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QKA+++DVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLKSIVAQFDAAELITQRE VSQRIR+ELS RA EF IRLEDVSITHMTFG +FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRI 240
           AVEQKQIAQQDAERA+F+VE AEQ RQASVIRAEGEAESAE IS            IRR+
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267
           EASKEIA+TL+ SSNVTYLPS   G +
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGK 267

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  393 bits (1010), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/270 (75%), Positives = 234/270 (86%), Gaps = 3/270 (1%)

Query: 1   MSRFADSLAKIALPL---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLI 57
           MSR ADSL ++ LPL    LA SA+Q+SMYDV+GG+RA+IFDR+SGV+  VVGEGTHFLI
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERV 117
           PWLQKA++FDVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRD 177
           LPSIGNEVLK+IVAQF+A+ELITQRE VSQ+IR EL+ RASEFNIRLEDVSITHMTFG++
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXI 237
           FTKAVEQKQIAQQ+++RA+FVVE AEQER+A+VIRAEGEAE+AE+IS            I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRIEASKEIAKTLANSSNVTYLPSNQQGAE 267
           RR+EASK IA+TLANS NVTYLPS  Q A+
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQAAD 270

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  384 bits (985), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/214 (84%), Positives = 201/214 (93%)

Query: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60
           MSR AD +A+IA+P+GL  SA+QYSMYDV+GG RAVIFDRL GVQQ V+GEGTHFL+PWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120
           QK++LFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR ELS RA EF+I+LEDVSITHMTFG++FTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAE 214
           AVEQKQIAQQDAERARF+VE AEQER+A+VIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  283 bits (723), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGT 81
           L  S+++V GG RA+++ RLSGVQQ V GEGTHF+IPWL+  VL+DVR+KP+ +++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
            DLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVEL 201
           RE+VS+ IR  L  RAS FNI L+DVSIT+MTF  +FT AVE KQ+AQQDA+RA F VE 
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A+QE+Q+ +++A+GEA+SAE I             ++R++ ++EIA  LA S N
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAGILAASPN 286

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  281 bits (720), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 135/238 (56%), Positives = 183/238 (76%), Gaps = 1/238 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGT 81
           LQ S+++V GG RA+++ R++GV  ++  EGTHF++PWL+  +++DVR KP+N+A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 82  KDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVEL 201
           RE VS+ IR+ L  RAS+FNI L+DVSIT MTF  +FT+AVE KQIAQQDA+RA F+V+ 
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           A QE+Q  V++A+GEA+SAE I             ++R++ ++EIA+ LANS N   L
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTAREIARILANSPNRVVL 289

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  280 bits (716), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RLSGV  ++  EGTHF+IPWLQ  +++DVR KP+N+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RA +FNI L+DVSIT MTF  +FT AVE KQIAQQDA+RA F+V+ A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ SK+IAK LA SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDISKDIAKILATSSN 284

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 183/243 (75%), Gaps = 1/243 (0%)

Query: 13  LPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKP 72
           L LG  A     ++++V GG RA+++ R+ GV Q++  EGTH +IPW++  +++DVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 73  KNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQ 132
           +N+A+ TGTKDLQMV++T RVL RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 133 FDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDA 192
           F+A++LITQRE VS+ IR  L  RAS FNI L+DVSIT+MTF  +FT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 193 ERARFVVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLAN 252
           +RA F+V+ A QE+Q  V++A+GEA+SAE I             ++R++ +K+IAK LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIG-DAIKKSRDYVELKRLDTAKDIAKILAN 285

Query: 253 SSN 255
           S N
Sbjct: 286 SPN 288

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  279 bits (713), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 181/235 (77%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RL+GVQ ++  EGTHF IPWL+  +++DVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS+FN+ L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  L++S N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSSSPNKVIL 290

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  277 bits (709), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGT 81
           +  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   +++DVR KP+N+A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV++LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVEL 201
           RE VS+ IR+ L  RAS+FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ 
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A QE+Q  V+RA+GEA+SAE I             ++R++ +++IAK LA+S N
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  277 bits (708), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   +++DVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RA+ FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ +++IAK LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILANSPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  276 bits (707), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 133/231 (57%), Positives = 176/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ R+SGV  ++  EGTHF+IPW++  +++DVR KP+N+A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  R+S FNI L+DVSIT MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V+RA+GEA+SAE I             ++R++ ++EIA  LA S N
Sbjct: 239 EKQGMVVRAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILAKSPN 288

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  276 bits (706), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 131/234 (55%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGT 81
           +  ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   +++DVR KP+N+A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV++LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVEL 201
           RE VS+ IR+ L  RAS+FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ 
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A QE+Q  V++A+GEA+SAE I             ++R++ +++IAK LA+S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  275 bits (703), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+I+ RL+GVQ ++  EGTHF IPW +  +++DVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSQSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  275 bits (703), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 180/231 (77%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ G+QQ++  EGTHF +PWL+  +++DVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS+FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA+ L+ S N
Sbjct: 238 EKQGMVVKAQGEAQSAELIG-EAIKKSKDYVELKRLDTAREIAEILSKSPN 287

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  275 bits (703), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 179/235 (76%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ RL+GV  ++  EGTHF+ PW+   +++DVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS F+I L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  V++A+GEA+SAE I             ++R++ +++IAK LANS N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTARDIAKILANSPNRVVL 290

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  275 bits (702), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 180/238 (75%), Gaps = 1/238 (0%)

Query: 18  AASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIAT 77
           +A  L  ++++V GG RA+++ R+SGV  ++  EGTHF IPW++  +++DVR KP+N+A+
Sbjct: 55  SAMLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVAS 114

Query: 78  NTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAE 137
            TGTKDLQMV++T RVL RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++
Sbjct: 115 LTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQ 174

Query: 138 LITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARF 197
           LITQRE VS+ IR+ L  RA+ FNI L+DVSIT MTF  +FT AVE KQIAQQDA+RA F
Sbjct: 175 LITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAF 234

Query: 198 VVELAEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           VV+ A QE+Q  V+RA+GEA+SAE I             ++R++ ++EIA+ LA S N
Sbjct: 235 VVDKARQEKQGMVVRAQGEAKSAELIG-DAIKKSKDYVELKRLDTAREIARILAKSPN 291

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  274 bits (701), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+IPW++  V++DVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RP+V +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR  L LRA +FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ +K+IA  LA S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAKDIADILAKSPN 287

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  273 bits (699), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  V++DVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RA  FN+ L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+GEA+SAE I             ++R++ ++EIA  LA S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIADILAKSPN 289

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  272 bits (695), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 176/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  +++DVR KP+N+A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP +Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA F+V+ A Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A GEA+SAE I             ++R++ +KEIA  LA S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIG-EAIKKSKDYVELKRLDTAKEIATILAASPN 264

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  270 bits (691), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTH L+PW +  V++DVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RPDV +LP IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RAS FNI L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           E+Q  V++A+G+A+SAE I             ++R++ ++EIA+ L+ S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIG-EAIRKSKDYVELKRLDTAREIAQILSRSPN 289

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  270 bits (689), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 179/235 (76%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R++GVQ ++  EGTHF+IPW++  V++DVR KP+N+++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQRET 144
           QMV++T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVELAEQ 204
           VS+ IR+ L  RA  FNI L+DVSIT+MTF  +FT +VE KQIAQQDA++A FVV+ A Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 ERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSNVTYL 259
           E+Q  +++A+GEA+SAE I             ++R++ ++EIA  L+ S N   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIASILSRSPNKVIL 291

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  268 bits (685), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 130/234 (55%), Positives = 177/234 (75%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPKNIATNTGT 81
           L  ++++V GG RA+++ R+ GV  ++  EGTH +IPWL+  V++DVR KP+N+A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 82  KDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V +LP IY+ LG DY ERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 142 RETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAERARFVVEL 201
           RE VS+ IR+ L  RAS F+I L+DVSIT+MTF  +FT AVE KQIAQQDA+RA FVV+ 
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 202 AEQERQASVIRAEGEAESAEYISXXXXXXXXXXXXIRRIEASKEIAKTLANSSN 255
           A QE+Q  V++A+GEA+SAE I             ++R++ ++EIA+ LA S N
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAQILARSPN 288

>ZYRO0G20042g Chr7 complement(1662136..1662483) [348 bp, 115 aa]
           {ON} similar to uniprot|Q99278 Saccharomyces cerevisiae
           YMR112C MED11 14 Kd mediator subunit of RNA polymerase
           II holoenzyme
          Length = 115

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181
           GN  LK    Q    E  T  E+ + +++QE+ L       RL  +++     G+D  K 
Sbjct: 40  GNHDLKPQFEQH-TREFYTTLESSTNQLKQEIKLLDENVGTRLLPINVNKKALGQDDDKL 98

Query: 182 VEQKQIAQQ 190
            EQ ++ +Q
Sbjct: 99  KEQTELLKQ 107

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 80  GTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSI 129
           G +   +  +  + L R D+   P +Y++L L+    VLP  GN +LK +
Sbjct: 274 GCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

>ADL067C Chr4 complement(560732..562651) [1920 bp, 639 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER064C and
           YIL056W
          Length = 639

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 99  VMKLPGIYQNLGLDYDERVLPSIGNEV-LKSIVAQFDAAELITQRETVSQRIRQELSLRA 157
           + ++P  Y NL L ++  +   I +++ L SI+ QF A E I + +  S    Q +S   
Sbjct: 473 LFQIPNTYSNLALFHNNTI---IKDDMELASILNQFSAGETIIEIKEPSSASGQSVSAVE 529

Query: 158 SEFN--IRLEDVSIT 170
           S FN    L +VS T
Sbjct: 530 SSFNGLTILSNVSTT 544

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,469,057
Number of extensions: 753029
Number of successful extensions: 2276
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2347
Number of HSP's successfully gapped: 49
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)