Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212383.493ON1701705183e-67
KLTH0F14850g3.493ON1711714081e-50
KLLA0D16280g3.493ON1691703309e-39
SAKL0F02750g3.493ON1701703212e-37
Ecym_12363.493ON1691703039e-35
CAGL0L08448g3.493ON1731732882e-32
Smik_16.4023.493ON1731732855e-32
YPR149W (NCE102)3.493ON1731732855e-32
TDEL0D056103.493ON1751752821e-31
Skud_16.4443.493ON1731732761e-30
Kpol_1017.63.493ON1871872622e-28
AFR312W3.493ON1681212525e-27
CAGL0I10494g3.493ON1721722482e-26
TPHA0D032803.493ON1841842492e-26
Suva_16.4783.493ON1661732472e-26
KAFR0C019703.493ON1791792343e-24
ZYRO0D09966g3.493ON1781782334e-24
NCAS0E008003.493ON1741742282e-23
NDAI0G009303.493ON1761762247e-23
YGR131W (FHN1)3.493ON1741742142e-21
Skud_7.4423.493ON1741742133e-21
KNAG0B008003.493ON1821822091e-20
TBLA0C044903.493ON1861232057e-20
NDAI0B058803.493ON1821822022e-19
KNAG0A079503.493ON1821822012e-19
Suva_7.4193.493ON1741211916e-18
Smik_6.2273.493ON1741211854e-17
KAFR0G037003.493ON1861771803e-16
NCAS0F035603.493ON1831221786e-16
TBLA0D029603.493ON1891231638e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21238
         (170 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   204   3e-67
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   161   1e-50
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   131   9e-39
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   128   2e-37
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   121   9e-35
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   115   2e-32
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   114   5e-32
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   114   5e-32
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   113   1e-31
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   110   1e-30
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   105   2e-28
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   101   5e-27
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   100   2e-26
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   100   2e-26
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   100   2e-26
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...    95   3e-24
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...    94   4e-24
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...    92   2e-23
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...    91   7e-23
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...    87   2e-21
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...    87   3e-21
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...    85   1e-20
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....    84   7e-20
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....    82   2e-19
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....    82   2e-19
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...    78   6e-18
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...    76   4e-17
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...    74   3e-16
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...    73   6e-16
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...    67   8e-14

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  204 bits (518), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 112/170 (65%), Positives = 112/170 (65%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLSILDNSLRAANFVFLLIVLGLTGSLAATRD                   DTLYAIPAN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FISALAWPLLIAVFD                 IRVHSCTNSDYVDNNKVTQGSSDRCRKA
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRKSANVGVPTISQV 170
           Q                      NVFSVGAFSTSSGRKSANVGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  161 bits (408), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 100/171 (58%), Gaps = 1/171 (0%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAAT-RDXXXXXXXXXXXXXXXXXXXDTLYAIPA 59
           MLSILDNSLRA NF FL+I+LGLTGSLAAT +                    D+LYAIPA
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
           NF+SALAWPLLIAVFD                 IR HSCTN DY+D+N VTQGS+DRCRK
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRKSANVGVPTISQV 170
           AQ                      N+ SVGAF   S R++ NVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  131 bits (330), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 88/170 (51%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLSILDNSLR  NFVFL+IVLGL G+L AT+D                   D+LYA+ AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FISALAWP+++   D                 IR  SCTN  +   NK+ +GS DRCRKA
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRKSANVGVPTISQV 170
           Q                      N  + GAF TSS RK+  VGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKT-QVGVPTISQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  128 bits (321), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 91/170 (53%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLSILDNSLR  NF FL+I+LGLTGSL AT+D                   D+ YA+ AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
             SA AWP+L+  +D                 IR HSCTN  Y+ +N +TQGS+DRCRKA
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRKSANVGVPTISQV 170
           Q                      NVFS GAF + SG + ANVGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  121 bits (303), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 88/170 (51%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLSILDNSLRAANF+FL+IVL LTGSL   ++                   D+LY++ AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FISALAWP+L+   D                 I  HSC+NS ++  N +++G   RCRK 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRKSANVGVPTISQV 170
           Q                      N+ S GAFS+ SGRK+   GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-GVPTISQV 169

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  115 bits (288), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 82/173 (47%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML++ DN LR  NFVF++I +GL   L ATRD                   D+LY + AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   LAWPL++   D                 IR HSC N+ Y +NNK+ QGS  RCR++
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRK---SANVGVPTISQV 170
           Q                      N+FS GAF T   R+   +A VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  114 bits (285), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 83/173 (47%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML++ DN LR  NF+FL+I + L  SL  T+D                   D+LY + AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FI  LAWPL++   D                 IR HSC NS YVD+NK+TQGS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAF---STSSGRKSANVGVPTISQV 170
           Q                      N+ S GAF   S S  R++  VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  114 bits (285), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 83/173 (47%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML++ DN LR  NF+FL+I +GL  SL  T+                    D+LY + AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FI  LAWPL++   D                 IR HSC NS YVD+NK+TQGS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAF---STSSGRKSANVGVPTISQV 170
           Q                      N+ S GAF   S S  R++  VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  113 bits (282), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 81/175 (46%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML+I+DN+LR  NF FL+I+LGL G L ++ D                   D+ Y I AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
                AWP+++   D                 IR HSC N DY+D+N +TQGS+ RCR A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFS-----TSSGRKSANVGVPTISQV 170
           Q                       + + G FS     TS  RKSA VGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  110 bits (276), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 81/173 (46%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML+  DN LR  NF+FL+IV+GL  SL  T+D                   D+LY + AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   LAWPL++   D                 IR HSC N  YVD+N +TQGS  RCR+A
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAF---STSSGRKSANVGVPTISQV 170
           Q                      N+ S GAF   S S  R++  VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  105 bits (262), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 82/187 (43%), Gaps = 17/187 (9%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS+ DN +RA NF F +I +GL GSL AT                     D+ Y I AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  -FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
            + +  AWP+++  FD                 IR HSC N +Y+DNNK+ QGS+DRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGA--FSTSS--------------GRKSANVG 163
           AQ                      N+ S GA  FST S              G  S  VG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 164 VPTISQV 170
           VP ISQV
Sbjct: 181 VPNISQV 187

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  101 bits (252), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 65/121 (53%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLSILDNSLRA NFVFL+IVLGLTGSL   +                    D+ Y+I AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           FISA AWP++    D                 I  HSC+N  ++D N +++ S+DRCRK 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  100 bits (248), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 75/172 (43%), Gaps = 2/172 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS+ DN LR  N VFL+I +GL  SL  TR                    D+LY I AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNN-KVTQGSSDRCRK 119
           F   LAWPL++ V D                 IR HSC N  Y++   K+ QGS  RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRK-SANVGVPTISQV 170
           AQ                      +V S GAF     RK    VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  100 bits (249), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 79/184 (42%), Gaps = 14/184 (7%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML + DN LR  NF F +I LGL GSL AT++                   DT Y   AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FISA-LAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
             S  LAWP+++  FD                  R HSCTN  Y+D+N +TQGS+DRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSS-------------GRKSANVGVPT 166
           AQ                      N+F+ GA  + S             G  S  +GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 167 ISQV 170
           ISQV
Sbjct: 181 ISQV 184

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score = 99.8 bits (247), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 80/173 (46%), Gaps = 10/173 (5%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML+ +DN LR  NF+FL+I +GL  SL  T+                    D+LY + AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   LAWPL++   D                 IR HSC N  Y+ +N +TQGS +RCR+A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAF---STSSGRKSANVGVPTISQV 170
           Q                      N+ S GAF   S S  R++  VGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score = 94.7 bits (234), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 78/179 (43%), Gaps = 9/179 (5%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXX-XXXXXXXXXXXXDTLYAIPA 59
           ML + DN LR  N VFL+I + LT +L  T++                    D++Y I A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
           NF   LAWPLL+   D                 IR HSC N  Y+D+NK+ +GS  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGR------KSAN--VGVPTISQV 170
           AQ                      N+F  GAFS+ S R      K A    GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score = 94.4 bits (233), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 83/178 (46%), Gaps = 8/178 (4%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSL-AATRDXXXXXXXXXXXXXXXXXXXDTLYAIPA 59
           ML++ DN LRA NF F +I+LGL G L  + +                    D+ Y I A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
           N     A+P+++ + D                 IR HSCTN  Y+D+NK+TQGS+ RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGR-------KSANVGVPTISQV 170
           AQ                      ++ S GAF +SSG        + ANVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score = 92.4 bits (228), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 76/174 (43%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML + DN LR  N VFL+I +GL  +L  T+                    D++Y I AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   LA P L    D                 IR HSC +  YV++NK+TQG  +RCR++
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGRK----SANVGVPTISQV 170
           Q                      N+   GAF+   GR+    +A +GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score = 90.9 bits (224), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 79/176 (44%), Gaps = 6/176 (3%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS+ DN LR  N +FL+I +GL  +L  T+                    D+ + I AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   L++P ++   D                 IR HSC N  Y+D NK+TQGS +RCR++
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFS---TSSGRK---SANVGVPTISQV 170
           Q                      ++   GAFS   TS  R+   +A VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score = 87.0 bits (214), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 73/174 (41%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS  DN +R  N VFL+I +GL   L  T+                    D+LY   AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F ++L +P ++ V D                 IR HSC N  Y++ NK+ QGSS RC ++
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSG----RKSANVGVPTISQV 170
           Q                       +   G F +++G    R    +G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score = 86.7 bits (213), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 74/174 (42%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS  DN +R  + VFL+I +GL G L  T+                    D+ Y   AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F S+L +P ++ V D                 IR HSC N  Y++ N +TQGSS RC ++
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVG--AFSTSSGRKSA--NVGVPTISQV 170
           Q                       +   G   F+T  GR+ A   +GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score = 85.1 bits (209), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 71/182 (39%), Gaps = 12/182 (6%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML + DN LR  NF FL+I L    +L  T+                    D LY + AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   LAWPL++   D                 IR HSC N  Y + N + QGS +RCR +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTSSGR------------KSANVGVPTIS 168
           Q                      N+ S GAF+T+S +                 GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 169 QV 170
           QV
Sbjct: 181 QV 182

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score = 83.6 bits (205), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 60/123 (48%), Gaps = 2/123 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSL-AATRDXXXXXXXXXXXXXXXXXXXDTLYAIPA 59
           MLS   N LR  NF FL+I+ G+ G L  + +                    D+ YAIPA
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFI-SALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCR 118
           NF  S  AWP+L+  FD                 IR HSC N  Y+ +NK+TQGS++RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 KAQ 121
            AQ
Sbjct: 121 LAQ 123

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 76/182 (41%), Gaps = 12/182 (6%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS +DN LR  N +FL++ +    +L  T+                    D+ + +  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FISALA-WPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
              ALA WP+L+ +FD                 IR HSC N  YV++N +TQGS +RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTS----------SGRKSAN-VGVPTIS 168
           +Q                      N+ S G F +           + R  AN VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 169 QV 170
           QV
Sbjct: 181 QV 182

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score = 82.0 bits (201), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 74/182 (40%), Gaps = 12/182 (6%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           ML++ D  LR  NFVFL+I +GL  +L  T+                    D+ Y + AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F   L+WPLL+   D                 IR HSC N  Y + NK+ QGS +RCR+A
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXXXXNVFSVGAFSTS---------SGRKSAN---VGVPTIS 168
           Q                      N+F+ G F ++         S RK       GVP IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 169 QV 170
            V
Sbjct: 181 TV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score = 78.2 bits (191), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (48%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS+ DN +R  N +FL+I +GL   L +++                    D+ Y   AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
             S+L +P+++ V D                 IR HSC+N  Y+DNNK+TQGS  RC +A
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 Q 121
           +
Sbjct: 121 K 121

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 56/121 (46%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS  DN +R  N VFL+I +GL   L +T+                    D+LY   AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120
           F S+L +P ++   D                 IR HSC N  Y++ NK+TQ SS RC ++
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 70/177 (39%), Gaps = 9/177 (5%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXX-XXXXXXXXXXXXDTLYAIPA 59
           ML+I DNSLR  NF F++I +     L  TR                     D++Y + A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFISALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
           NF   LAWP+++ VFD                 IR H+C N  Y ++NK+ +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AQXXXXXXXXXXXXXXXXXXXXXXNVFSVG--------AFSTSSGRKSANVGVPTIS 168
           AQ                         S G         F +   R+SA  GVPT S
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score = 73.2 bits (178), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXXXXXXDTLYAIPAN 60
           MLS +DN+LR  N +FL++ +    +L +T++                   D+ + + AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FISALA-WPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCRK 119
            I  L+ WP+++ VFD                 IR HSC N  Y+++NK+ QGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AQ 121
           +Q
Sbjct: 121 SQ 122

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score = 67.4 bits (163), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 51/123 (41%), Gaps = 2/123 (1%)

Query: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDXXXXXXXXXXXXXXX-XXXXDTLYAIPA 59
           ML + DN  R  NF F +I  G+ G+L  T                      D+ Y I A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFI-SALAWPLLIAVFDXXXXXXXXXXXXXXXXXIRVHSCTNSDYVDNNKVTQGSSDRCR 118
           N +    A+P ++  FD                 IR HSCTN +Y   N + QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 KAQ 121
           +AQ
Sbjct: 121 EAQ 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,406,541
Number of extensions: 174519
Number of successful extensions: 397
Number of sequences better than 10.0: 30
Number of HSP's gapped: 315
Number of HSP's successfully gapped: 30
Length of query: 170
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 68
Effective length of database: 41,785,467
Effective search space: 2841411756
Effective search space used: 2841411756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)