Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212293.492ON78753021450.0
KLTH0F14828g3.492ON83648613091e-168
SAKL0F02772g3.492ON7734758189e-97
Smik_6.2263.492ON8394725402e-57
YGR130C3.492ON8164725358e-57
Skud_7.4413.492ON8074725322e-56
Suva_7.4183.492ON8314725128e-54
KLLA0D16236g3.492ON8715075084e-53
NCAS0E008103.492ON6924614151e-41
Ecym_12373.492ON7272833964e-39
NDAI0G009403.492ON6564823625e-35
TDEL0D056003.492ON7002553591e-34
ZYRO0D09988g3.492ON9943453532e-33
Kpol_480.143.492ON6993423466e-33
CAGL0I10516g3.492ON8133663388e-32
TPHA0D042503.492ON6293232682e-23
AFR310C3.492ON6232592172e-17
KNAG0B008103.492ON7572051727e-12
TBLA0C044803.492ON802961612e-10
KAFR0C019603.492ON5632411503e-09
KAFR0G036903.492ON3631321242e-06
KNAG0A079403.492ON2751521152e-05
NDAI0B058603.492ON681152890.048
NCAS0F035503.492ON44159890.052
ZYRO0C17094g3.393ON48285743.0
AER045C4.238ON1292185743.1
CAGL0D04994g3.479ON692178743.5
TBLA0G023102.542ON674159725.5
ZYRO0F01672g5.125ON29687715.6
SAKL0H05852g8.704ON86959725.8
Kpol_1016.271.291ON29622716.5
NDAI0B013902.590ON938113726.5
ACL132C5.123ON954105717.6
KNAG0F027205.267ON187283709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21229
         (787 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   830   0.0  
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   508   e-168
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   319   9e-97
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   212   2e-57
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   210   8e-57
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   209   2e-56
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   201   8e-54
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   200   4e-53
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   164   1e-41
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   157   4e-39
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   144   5e-35
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   142   1e-34
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   140   2e-33
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   137   6e-33
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   134   8e-32
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   107   2e-23
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    88   2e-17
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    71   7e-12
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    67   2e-10
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    62   3e-09
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    52   2e-06
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    49   2e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    39   0.048
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    39   0.052
ZYRO0C17094g Chr3 complement(1327234..1328682) [1449 bp, 482 aa]...    33   3.0  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    33   3.1  
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    33   3.5  
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    32   5.5  
ZYRO0F01672g Chr6 complement(136165..137055) [891 bp, 296 aa] {O...    32   5.6  
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    32   5.8  
Kpol_1016.27 s1016 complement(70200..71090) [891 bp, 296 aa] {ON...    32   6.5  
NDAI0B01390 Chr2 (321257..324073) [2817 bp, 938 aa] {ON} Anc_2.590     32   6.5  
ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON} S...    32   7.6  
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    32   9.7  

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/530 (81%), Positives = 431/530 (81%)

Query: 258 ASKPIETTEASQPIESTEASQPTPTTKASPDDEGIVGESLVXXXXXXXXXXXXXXXXXXL 317
           ASKPIETTEASQPIESTEASQPTPTTKASPDDEGIVGESLV                  L
Sbjct: 258 ASKPIETTEASQPIESTEASQPTPTTKASPDDEGIVGESLVADASAAAETPAAAETSATL 317

Query: 318 QKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYE 377
           QKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYE
Sbjct: 318 QKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYE 377

Query: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437
           EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA
Sbjct: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437

Query: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497
           ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD
Sbjct: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497

Query: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHN 557
           ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHN
Sbjct: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHN 557

Query: 558 SNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXX 617
           SNIAILEGISNKDYLPKIN               VKQETANQHTEFAAVS          
Sbjct: 558 SNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEER 617

Query: 618 XXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTXXXXXXXXX 677
                             FQKQRDEHDQHVLTLQQEHERQLAEASQKAADT         
Sbjct: 618 KEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTELLLQQERE 677

Query: 678 XXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXXXXXXXXXXXXKSI 737
                        GEKAIQEQEQAKLADKALEDEVKERNHN                KSI
Sbjct: 678 KRELVERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAIDAAEAARARNAKSI 737

Query: 738 SNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYVNSNSSLLPQN 787
           SNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYVNSNSSLLPQN
Sbjct: 738 SNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYVNSNSSLLPQN 787

 Score =  310 bits (795), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 163/182 (89%), Positives = 163/182 (89%)

Query: 1   MFKKKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQR 60
           MFKKKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQR
Sbjct: 1   MFKKKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQR 60

Query: 61  FPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQY 120
           FPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQY
Sbjct: 61  FPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQY 120

Query: 121 KKDSQKIVKVKGEVGKSSTVETEPEAVESXXXXXXXXXXXXXXXXXXXDEPVKPIETGEP 180
           KKDSQKIVKVKGEVGKSSTVETEPEAVES                   DEPVKPIETGEP
Sbjct: 121 KKDSQKIVKVKGEVGKSSTVETEPEAVESTKPVETEPEEAETTKPVETDEPVKPIETGEP 180

Query: 181 VK 182
           VK
Sbjct: 181 VK 182

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  508 bits (1309), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 279/486 (57%), Positives = 327/486 (67%), Gaps = 21/486 (4%)

Query: 318 QKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYE 377
           +KPK+IK+TPRVPFATGIFALWTRSDKRGQPVASP+DPEFIVKFDKGYMSKALYDTLEYE
Sbjct: 346 EKPKDIKETPRVPFATGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYE 405

Query: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437
           EA+HK+EMD YTKE+  KY+AKA EYED LTSLKSQIAELEATME LQ DTT+KI IS A
Sbjct: 406 EAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEA 465

Query: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497
           +LSA+MI+ NA+HS++KNVIFKETEN KAAK++EK  V AKQ++VK E EELE  RAE D
Sbjct: 466 KLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEID 525

Query: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHN 557
           A N+E   R+DELT +LD+K +AIQELN QQAE+QASID L+QQKD L+++A AADE H 
Sbjct: 526 AENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHG 585

Query: 558 SNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXX 617
           SN+A+LE I NK+YLPK+N               VKQETAN  TEFAAVS          
Sbjct: 586 SNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSKRLEEEDEER 645

Query: 618 XXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTXXXXXXXXX 677
                              QKQR+EHDQ +L LQQEHERQLAEASQKAA+          
Sbjct: 646 KEKLRQEEENRKRLEAERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKERE 705

Query: 678 XXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXXXXXXXXXXXXKSI 737
                        GEKAI+EQE+AK ADKALE+E+K+RNH+                K I
Sbjct: 706 QRELVERERVKLQGEKAIREQEEAKAADKALEEEIKQRNHSRALALDGAEAAVQKSQKEI 765

Query: 738 S------------NNNAPALSTPKEDEKLNI--------KDATTDN-SLYEYFTEKEVRY 776
           +                P L  P + E   +        K  T DN SLYEYFTEKE+R 
Sbjct: 766 TEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRT 825

Query: 777 VNSNSS 782
           VNS++S
Sbjct: 826 VNSSTS 831

 Score =  199 bits (506), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 98/133 (73%), Positives = 116/133 (87%), Gaps = 1/133 (0%)

Query: 1   MFKKKHDPFEHLFQQDQPK-KETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQ 59
           MFKK+ DP EHLFQQ +P+  +  KGFL KVV+KEQE + Y+SPFRTSQS   AQKRK+Q
Sbjct: 1   MFKKRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQ 60

Query: 60  RFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQ 119
           +FPTVSAS   +SS++MG+KVIDAAR+RAKDIAVPRYLQGNDERQRRRLDKLERKED+L+
Sbjct: 61  KFPTVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALK 120

Query: 120 YKKDSQKIVKVKG 132
           YKKDSQ+IV V+G
Sbjct: 121 YKKDSQRIVDVRG 133

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  319 bits (818), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 197/475 (41%), Positives = 266/475 (56%), Gaps = 32/475 (6%)

Query: 317 LQKPKNIKDTPRVPFA--TGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTL 374
           L +P +    PRVPF   TG+FALWTRSDK+ QP+A+P DPE+IV+ DKGYMSKA+YD L
Sbjct: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYIVRTDKGYMSKAIYDKL 376

Query: 375 EYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINI 434
           EY+E VH+ E+  + KE  DKYDA  +EY D LT L+SQI EL+ATMEQL+LDT +KI +
Sbjct: 377 EYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKV 436

Query: 435 SAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRA 494
           S +ELS +M++ NA H ++KNVIFKETEN K  KI E+  + AK +EVKAE EEL   + 
Sbjct: 437 SESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKK 496

Query: 495 EADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADE 554
           + DA   E  +++D+LT QLDSK   IQELND+Q EI   I  L Q+K  +  +   A+E
Sbjct: 497 QVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEE 556

Query: 555 LHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXX 614
           LH  +  ILE I NK+YLPKIN               +KQE ANQ TEFAA++       
Sbjct: 557 LHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITKRLEEER 616

Query: 615 XXXXXXXXXXXXXXXXXXXXXFQKQRDE-----------HDQHVLTLQQEHERQLAEASQ 663
                                 QKQR+E           H++ +  +++EHE+ L +A+ 
Sbjct: 617 KAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEKALNDANV 676

Query: 664 KAADTXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXX 723
           + A                        GEKAIQEQE+A+ AD AL+ E+ E+        
Sbjct: 677 QLAKE-------KEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRRK----- 724

Query: 724 XXXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYVN 778
                      + IS      LS P +       + T ++SLY+Y T +E+  V+
Sbjct: 725 QAEAVDAAEQARKISTQKKSVLSNPSQ-------NLTRESSLYDYETVEEIITVD 772

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/136 (55%), Positives = 106/136 (77%), Gaps = 7/136 (5%)

Query: 1   MFKKKH--DPFEHLFQQDQPKKETSKGFLRKVVTKEQEDAT---YSSPFRTSQSQVEAQK 55
           +FKKK   DPF HL Q +QP+++ +  FLRKVVT ++++     YSSPFR+ Q  + A+ 
Sbjct: 3   IFKKKQQVDPFAHLLQPEQPQEQPN--FLRKVVTNKKKEEEEKDYSSPFRSQQELIAAKN 60

Query: 56  RKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKE 115
            K ++FPTVSA+SG  S+A++G+KVID+A++RAKDI+VPRYL+  DE+QR++LDKLE KE
Sbjct: 61  VKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE 120

Query: 116 DSLQYKKDSQKIVKVK 131
           + LQY KDSQKIV V+
Sbjct: 121 NHLQYLKDSQKIVDVR 136

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  212 bits (540), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 143/472 (30%), Positives = 231/472 (48%), Gaps = 38/472 (8%)

Query: 327 PRVPF-------ATGIFALW----------TRSDKRGQPVASPDDPEFIVKF-DKGYMSK 368
           P+VPF        TGIFALW          + +     PVA+P+ PE IVK  + GY+SK
Sbjct: 383 PKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEHGYLSK 442

Query: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428
           A+YD + Y+E VH+  +         KYDAK +EYE+ L  L++QI E+E +M+ ++ +T
Sbjct: 443 AVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKET 502

Query: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488
           ++KI +S   L  ++I+ NA H+N K +IFK+TEN K  K++EK  V+ KQ  VK++ +E
Sbjct: 503 SEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDE 562

Query: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548
           L +++        +  + +  L+ QLD++   I ++N +Q+++Q  ID+LEQ+K+ LV  
Sbjct: 563 LNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQ 622

Query: 549 ATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSX 608
               ++LH  N+ +LE + N++YLP+IN               +KQE AN+ T+ +A++ 
Sbjct: 623 TQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITK 682

Query: 609 XXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAAD- 667
                                       +KQR E ++     Q +HE Q+ +  +   D 
Sbjct: 683 RLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQ 742

Query: 668 ---TXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXX 724
                                     GEKAI+EQ + + AD+AL+ E+  + H       
Sbjct: 743 LTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLH 802

Query: 725 XXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776
                            A     P +  + N      D+SLYEY TE++V Y
Sbjct: 803 A----------------AERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMY 838

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 73/140 (52%), Gaps = 18/140 (12%)

Query: 7   DPFEHLFQQDQP--------KKETSKGFLRKVVTKEQEDAT-YSSPFRT-------SQSQ 50
           DPF  L  Q           +KE    FL+KVV+ E +    + SPFR        + ++
Sbjct: 11  DPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQDALASKQNNNR 70

Query: 51  VEAQKRKVQRFPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRL 108
           +  +  K ++FPTVSA+S  +     ++G+K I    KRAKDI  P YL  N+ERQ + L
Sbjct: 71  LYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLL 130

Query: 109 DKLERKEDSLQYKKDSQKIV 128
            +LE KE  LQY K  QKI 
Sbjct: 131 TELELKEKHLQYLKKCQKIT 150

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  210 bits (535), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 144/472 (30%), Positives = 231/472 (48%), Gaps = 38/472 (8%)

Query: 327 PRVPFA-------TGIFALW----------TRSDKRGQPVASPDDPEFIVKF-DKGYMSK 368
           P+VPF        TGIFALW          +++     PVA+P++PE IVK  + GY+SK
Sbjct: 360 PKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSK 419

Query: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428
           A+YD + Y+E +H+  +     +  DKYDAK +EY++ L  L++QI E+E +M+ ++ +T
Sbjct: 420 AVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREET 479

Query: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488
           ++KI +S   L  ++I+ NA+H+N K +I K+TEN K  K+ EK  V+ KQ  VK+E ++
Sbjct: 480 SEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDD 539

Query: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548
           L  ++        +  + +  L+ QLD++   I ++N +Q ++Q  ID LE++K+ LV  
Sbjct: 540 LNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQ 599

Query: 549 ATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSX 608
                +LH  N+ +LE + NK+YLP+IN               +KQE AN+ T+ +A++ 
Sbjct: 600 TEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITK 659

Query: 609 XXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAAD- 667
                                       +KQR E ++     Q +HE+Q+ +  Q   D 
Sbjct: 660 RLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQ 719

Query: 668 ---TXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXX 724
                                      EKAI+EQ + K AD+AL+ E+  R H       
Sbjct: 720 LTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIH 779

Query: 725 XXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776
                     +S  N +      PK+D            SLYEY TE++V Y
Sbjct: 780 AAENHKIPNDRSQKNTSV----LPKDD------------SLYEYHTEEDVMY 815

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 72/139 (51%), Gaps = 17/139 (12%)

Query: 7   DPFEHLFQQDQP--------KKETSKGFLRKVVTKEQEDAT-YSSPFR------TSQSQV 51
           DPF  L  Q           ++E+   FL+KVV+ E +    + SPFR         ++ 
Sbjct: 11  DPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQDALANRQNNRA 70

Query: 52  EAQKRKVQRFPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLD 109
             +  K ++FPTVSA+S  +     ++G+K I    KRAKDI  P YL  N+ERQ + L 
Sbjct: 71  YGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLT 130

Query: 110 KLERKEDSLQYKKDSQKIV 128
           +LE KE  L+Y K  QKI 
Sbjct: 131 ELELKEKHLKYLKKCQKIT 149

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  209 bits (532), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 147/472 (31%), Positives = 236/472 (50%), Gaps = 38/472 (8%)

Query: 327 PRVPFA-------TGIFALW----TRSDKRG------QPVASPDDPEFIVKF-DKGYMSK 368
           P+VPF        TGIFALW    + S ++G       PVA+P++PE IVK  + GY+SK
Sbjct: 351 PKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSK 410

Query: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428
           A+YD + Y+E VH+  +     +   KYDA +  Y + L  L++QI E+E +M+ ++ +T
Sbjct: 411 AVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKET 470

Query: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488
           ++KI +S   L  ++I+ N  H+N K +IFK+TEN K  K+ EK  V+ KQ  VK+E +E
Sbjct: 471 SEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDE 530

Query: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548
           L + +        +  + +  L+ QLD++   I ++N +Q+++Q  IDAL+++K+ L+A 
Sbjct: 531 LNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQ 590

Query: 549 ATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSX 608
                +LH  N+  LE + NK+YLP+IN               ++QE AN+ TE +A++ 
Sbjct: 591 TEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITK 650

Query: 609 XXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAAD- 667
                                       +KQR E ++     Q +HE+Q+ +  Q   D 
Sbjct: 651 RLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQ 710

Query: 668 ---TXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXX 724
                                     GEKAI+EQ + K +D+AL+ E+  + H       
Sbjct: 711 LTELQDKLAAEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEILGKQH------- 763

Query: 725 XXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776
                      +   +N P   +PK +E L  K    D+SLYEY TE++V Y
Sbjct: 764 ----KQAEGLHAAEKHNIPNSHSPK-NEILVPK----DDSLYEYHTEEDVMY 806

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 17/139 (12%)

Query: 7   DPFEHLFQQD--------QPKKETSKGFLRKVVTKEQEDAT-YSSPFR------TSQSQV 51
           DPF  L  Q         + ++E    FL+KVV+ E +    + SPFR         +++
Sbjct: 11  DPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRL 70

Query: 52  EAQKRKVQRFPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLD 109
                K ++FPTVSA+S  +     ++G+K I    KRAKDI  P YL  N+ERQ + L 
Sbjct: 71  YVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQLLT 130

Query: 110 KLERKEDSLQYKKDSQKIV 128
           +LE KE  L+Y K+ QKI 
Sbjct: 131 ELELKEKHLKYLKECQKIT 149

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  201 bits (512), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 140/472 (29%), Positives = 231/472 (48%), Gaps = 37/472 (7%)

Query: 327 PRVPFA-------TGIFALW----TRSDKRG------QPVASPDDPEFIVKF-DKGYMSK 368
           P+VPF        TG FALW    + S K+G       PVA+P++PE IVK  + GY+SK
Sbjct: 374 PKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTKEHGYLSK 433

Query: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428
           A+YD + Y+E +H+  +         KYDAK  EY++ L  L++QI E+E +M+QL+ +T
Sbjct: 434 AVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREET 493

Query: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488
           + KI ++   L  ++I+ N +H+N K +IFK+TEN K  K++EK  V+ KQ  VK+E +E
Sbjct: 494 SQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDE 553

Query: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548
           L ++++       +  + +  L+ QLD++   I ++N +Q++ Q  ID LE+QK  L+  
Sbjct: 554 LNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQ 613

Query: 549 ATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSX 608
                +LH  N+ +LE + NK+YLP+IN               ++QE AN+ T  +A++ 
Sbjct: 614 TEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITK 673

Query: 609 XXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQKAAD- 667
                                       +KQR E ++     + EHE Q+ +  +   D 
Sbjct: 674 KLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQ 733

Query: 668 ---TXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXX 724
                                     GEKAI+EQ + K AD+ L+  + ++ H       
Sbjct: 734 LTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLH 793

Query: 725 XXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776
                               ++TP  + + + +    ++SLYEY TE++V Y
Sbjct: 794 AAENR---------------VNTPSSNLQESKRAVPKNDSLYEYHTEEDVMY 830

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 67/121 (55%), Gaps = 13/121 (10%)

Query: 26  FLRKVVTKE---QEDATYSSPFR------TSQSQVEAQKRKVQRFPTVSASS--GGNSSA 74
           FL+KVV+ E   +ED  + SPFR         +++     K ++FPTVSA+S        
Sbjct: 36  FLQKVVSNEPKGKED--WVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQ 93

Query: 75  EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKGEV 134
           ++G+K I    KRAKDI  P YL  N+ERQ + L +LE KE  L+Y K  QKI  + G+ 
Sbjct: 94  DLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTGDA 153

Query: 135 G 135
            
Sbjct: 154 N 154

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  200 bits (508), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 235/507 (46%), Gaps = 62/507 (12%)

Query: 320 PKNIKDTPRVPF------------------ATGIFALWTRSDKR---------------- 345
           P +I   PRVPF                  A+G+FAL+ RS K                 
Sbjct: 379 PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 346 ---GQPVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQE 402
                PVA+P+DPE IV+  +GY+SK++YD L+Y+E  H+ ++  Y+KE  ++Y+ KAQE
Sbjct: 439 PGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQE 498

Query: 403 YEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETE 462
           YE+ + S++++IAEL+A MEQ++L+  +K+ +   E S  ++E+N KH N K  ++K+TE
Sbjct: 499 YEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTE 558

Query: 463 NSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQ 522
             K   I +K         V++E +EL   + E    NQE  S+++ELT +LD+K SA+ 
Sbjct: 559 EIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALN 618

Query: 523 ELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINXXXXXX 582
           E   ++ E  A I ALE++K  L  +   A ELH  N++ +E I NK+YLPK+N      
Sbjct: 619 ESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEI 678

Query: 583 XXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDE 642
                    ++QE ANQ  EF++V+                             +KQR E
Sbjct: 679 SSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRTE 738

Query: 643 -----------HDQHVLTLQQEHERQLAEASQKAADTXXXXXXXXXXXXXXXXXXXXXXG 691
                      H++ +  L+Q H+  L EA  +                          G
Sbjct: 739 YEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQG 798

Query: 692 EKAIQEQEQAKLADKALEDEVKERNHNXXXXXXXXXXXXXXXXKSISNNNAPALSTPKED 751
           EKAI+ Q++    DK LE E +E+                   K       PA       
Sbjct: 799 EKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKKTKAAVPPA------- 851

Query: 752 EKLNIKDATTDNSLYEYFTEKEVRYVN 778
                   TT++SLY+Y T +EV  V+
Sbjct: 852 -------NTTNSSLYDYETVEEVITVD 871

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 81/145 (55%), Gaps = 17/145 (11%)

Query: 1   MFKKKH--DPFEHLF--------QQDQPKKETSKGFLRKVVTKEQE------DATYSSPF 44
           +F+K++  DPF  L         QQ Q     S   L++V TK+Q+      D  Y SPF
Sbjct: 6   LFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSPF 65

Query: 45  RTSQSQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVI-DAARKRAKDIAVPRYLQGNDER 103
           RT++    A++ + ++FPT+S  +      +MG+ V+ D + K+AKDI +P  L+  +  
Sbjct: 66  RTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAE 125

Query: 104 QRRRLDKLERKEDSLQYKKDSQKIV 128
           Q+ RL  LE+KE  L+Y + SQKIV
Sbjct: 126 QKVRLTALEKKEKQLRYWRKSQKIV 150

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 128/461 (27%), Positives = 213/461 (46%), Gaps = 20/461 (4%)

Query: 327 PRVPFATGIFALWTRSD-----KRGQPVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAV 380
           P VPF+       ++ +     K   PVASP + E IVK  + GY+SKA+YD ++Y+E  
Sbjct: 242 PMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQ 301

Query: 381 HKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELS 440
           HK+ +  Y  +  +KY+AK QEY+  L  + +Q++EL   +E+ +LDT +KI++   +L 
Sbjct: 302 HKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLV 361

Query: 441 ARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATN 500
            ++ +      N K  IF ET+  K  K+ EK  V+    EVK   +EL  ++ +  +  
Sbjct: 362 KKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEY 421

Query: 501 QELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNI 560
               + +  + ++LD+K   I ++N  Q  +Q  IDAL  QK+ L  +      +H+SN+
Sbjct: 422 DNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNV 481

Query: 561 AILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXXXXX 620
            ++E + NK+YLPK+N               VKQE AN+  + A ++             
Sbjct: 482 KLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQ 541

Query: 621 XXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQL----AEASQKAADTXXXXXXXX 676
                            KQRDE +    T+Q  H++++     +   K  +         
Sbjct: 542 LQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQ 601

Query: 677 XXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNHNXXXXXXXXXXXXXXXXKS 736
                         GEKA+ EQ++ K AD  L++E+ E+ H                   
Sbjct: 602 DQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAA---------Q 652

Query: 737 ISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYV 777
           +     P  +  +E      K ++ DNSLY+Y TE++V YV
Sbjct: 653 LKGRKHPLAALAREITG-EAKPSSKDNSLYDYETEEDVMYV 692

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 82/156 (52%), Gaps = 29/156 (18%)

Query: 2   FKKKHDPFEHLFQQDQPKK----------ETSKGFLRKVV------TKEQED-------- 37
           FK++ DPF+HLF++ +  +           T+  FL++VV      T++Q          
Sbjct: 8   FKRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSSFLQRVVSTTSSTTQKQPKKKIAASEA 67

Query: 38  ---ATYSSPFRTSQSQVEAQKRKVQRFPTVSASSGGN--SSAEMGFKVIDAARKRAKDIA 92
              + Y+SPFR   S V  Q  K +RFPTVSA+S     +  + GF  I   +  AKDI 
Sbjct: 68  KAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127

Query: 93  VPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128
            P YL  N++RQ+  L  LE+KE  L+Y +DSQ I+
Sbjct: 128 FPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNII 163

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  157 bits (396), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 157/283 (55%), Gaps = 6/283 (2%)

Query: 328 RVPFA---TGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQE 384
           R PF     GIFALW RS+K  +  A+P+DPEFIV  +KGYMSK +YD LEYEE +H+++
Sbjct: 298 RGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEK 357

Query: 385 MDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMI 444
           +    + +  KY+  A+ YE+ L SL ++IAE+ A M+QL+  T +++    A LS  ++
Sbjct: 358 LASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLM 417

Query: 445 ESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELL 504
           +  AKH   K  + KE EN K AKI EK  +  K  +V+ E E L+    E     Q+  
Sbjct: 418 DIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVELQQYQ 477

Query: 505 SRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILE 564
           S +  LT +LD++   +Q ++D+Q E+  S+ ALE+++  +  D + ++ +  +N  +L+
Sbjct: 478 SEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQ 537

Query: 565 GISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVS 607
            + N    P I                V+QE A Q  E   +S
Sbjct: 538 NLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 88/155 (56%), Gaps = 23/155 (14%)

Query: 1   MFKKKH--DPFEHLFQQDQPKKETSKGFLRKVVTKE---QEDAT---------YSSPFRT 46
           +FKK    DPF+ L   ++ K  T++ F++KV       ++D T         Y SPFR 
Sbjct: 4   IFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPFRD 63

Query: 47  SQSQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRR 106
            ++  EA++ +  +FPT    +G +S+     +V D  +++A+DIA PR     D +Q++
Sbjct: 64  DKAVAEAERIRDLKFPT----TGHHST----VRVKDNVKRKAQDIAEPRSFGTTDLKQQK 115

Query: 107 RLDKLERKEDSLQYKKDSQKIVKV-KGEVGKSSTV 140
           +LD+L  KE+ L+Y ++SQKIV V K  VGK S V
Sbjct: 116 QLDELGMKENQLEYLRNSQKIVDVRKSSVGKGSEV 150

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  144 bits (362), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 135/482 (28%), Positives = 210/482 (43%), Gaps = 33/482 (6%)

Query: 317 LQKPKNIKDTPRVPFATGIFALWTRS----------DKRGQPVASPDDPEFIVKFDK-GY 365
           L+KP + K TP V F      +  ++          +K   P A+P+  E IVK  K G 
Sbjct: 187 LEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGI 246

Query: 366 MSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQ 425
           +SK++YD L+Y++  H+Q +  Y  E  +KYD K QEYE+ L SL  +I      +EQ +
Sbjct: 247 LSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCK 306

Query: 426 LDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAE 485
            DT  K++I  AEL  RM +  +  ++ K  IF ET+  K  KIDEK  V    D+V  E
Sbjct: 307 KDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGE 366

Query: 486 NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTL 545
            ++L  ++ +      E    +  +  QLD+K   I+++N  Q  +Q  ID L  +K  L
Sbjct: 367 IDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGL 426

Query: 546 VADATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAA 605
             +  A    H +N+  +E + NK YLPK+N               +KQE AN+  + + 
Sbjct: 427 TKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSE 486

Query: 606 VSXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEAS--- 662
           ++                              KQR+E +Q    LQ  HE ++       
Sbjct: 487 LTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSY 546

Query: 663 -QKAADTXXXXXXXXXXXXXXXXXXXXXXGEKAIQEQEQAKLADKALEDEVKERNH---- 717
            Q+ AD                       G KAI++Q++ K +D  L++E+  + H    
Sbjct: 547 EQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAE 606

Query: 718 --NXXXXXXXXXXXXXXXXKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVR 775
             N                  +  ++ PALS  K+D            SL+EY TE+E+ 
Sbjct: 607 AYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDD------------SLFEYETEEEIM 654

Query: 776 YV 777
           YV
Sbjct: 655 YV 656

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 81/155 (52%), Gaps = 31/155 (20%)

Query: 4   KKHDPFEHLFQQDQPK---------KETSKGFLRKVVT----------------KEQEDA 38
           KK+DPFEHL    QPK           +S  FL++V++                K+    
Sbjct: 8   KKNDPFEHLLN-PQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSKKKVSTE 66

Query: 39  TYSSPFRT---SQSQVEAQKRKVQRFPTVSASSG--GNSSAEMGFKVIDAARKRAKDIAV 93
            Y SPFR+   + ++   Q  K +RFPTVSA+S     +S EMGFK I   +  AKDI  
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126

Query: 94  PRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128
           P YL  N++RQ+  L KL + E  LQYKKDSQ I+
Sbjct: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNII 161

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  142 bits (359), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 143/255 (56%)

Query: 353 DDPEFIVKFDKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKS 412
           ++PE +VK   GY++K +YD +  ++  H + + +Y K+   K+D K  E    + SL++
Sbjct: 346 ENPEHVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRA 405

Query: 413 QIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEK 472
           QI E++  M QL+ DT  KI +S  EL+ +  E    H   KN +FK+TE  K+ K+ EK
Sbjct: 406 QIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEK 465

Query: 473 AAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQ 532
            +V+ KQ EV+ E +EL  ++ + +   Q+    I+EL+ ++D+K + ++E+N +Q   Q
Sbjct: 466 DSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQ 525

Query: 533 ASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXV 592
             I+ L+QQK  ++      +  H  N  ++EG  NK YLPK+N               +
Sbjct: 526 EEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTI 585

Query: 593 KQETANQHTEFAAVS 607
           +Q  AN+ TE +A++
Sbjct: 586 RQHCANERTELSAIT 600

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 4/128 (3%)

Query: 1   MFK-KKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVEAQKRKVQ 59
           MFK K+ DPF   +  DQ  K+  +   +K   ++  +  Y SPFR  Q  + AQ+R+ Q
Sbjct: 1   MFKQKRSDPFAQYWAGDQ-AKDVEEQQKKKKEEEDVGERDYVSPFRDEQEVLSAQRRRTQ 59

Query: 60  RFPTVSASSGGNSSA--EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDS 117
           RFPT SA+S   ++   E+G+K I A  KRAKDI+ P YL+  +++Q   L +LE KE  
Sbjct: 60  RFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYLEEIEKKQLELLRELEVKEAH 119

Query: 118 LQYKKDSQ 125
           L+Y KD Q
Sbjct: 120 LRYLKDCQ 127

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 170/345 (49%), Gaps = 11/345 (3%)

Query: 327 PRVPFATGIFALWTRSDKR----GQPVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVH 381
           P V     IF+++ R  K       P+A+P++PE +VK D+ G++SKA+YD ++YE   H
Sbjct: 463 PEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKH 522

Query: 382 KQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSA 441
            + + ++      +Y+ K  +Y++ L  LK ++ +LE +M++++ D  + I I    LS 
Sbjct: 523 SEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSK 582

Query: 442 RMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQ 501
           + +ES  ++   KN IF ET+  +  K  E   +  +Q+EV+   +E+ A  AE D  ++
Sbjct: 583 KFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQ---KEIAALNAEKDNIHR 639

Query: 502 ELLS---RIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNS 558
           E +    R+ + +  LD+K  ++  L  +  + QA ID L  +K  L  +  A  E H  
Sbjct: 640 EFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAK 699

Query: 559 NIAILEGISNKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXXX 618
           N   +E  +NK+YLPK++               +KQE+AN+  +  +++           
Sbjct: 700 NTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHE 759

Query: 619 XXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQEHERQLAEASQ 663
                              KQR+EH+     L+++HE +L +  Q
Sbjct: 760 EQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQ 804

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 82/158 (51%), Gaps = 31/158 (19%)

Query: 1   MFK-KKHDPFEHLFQQDQPKKETSKG-FLRKVVTKEQED--------------------- 37
           MF+ K+ DPF  L+++   +++  KG FL +VV  +  +                     
Sbjct: 1   MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRAS 60

Query: 38  ------ATYSSPFRTSQSQVEAQKRKVQRFPTVSASS--GGNSSAEMGFKVIDAARKRAK 89
                   ++SPFR   ++ +A+KR++QRFPTVS +S        E+G++ +    +RAK
Sbjct: 61  ARKSHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120

Query: 90  DIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKI 127
           DI  P YL+ N+ RQ + L ++E +E  L Y K+SQ +
Sbjct: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIV 158

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  137 bits (346), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 180/342 (52%), Gaps = 14/342 (4%)

Query: 332 ATGIFALW-TRSDKRGQPVA-----SPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQE 384
           +TGI A++   S    QPV+     SP++PE+++K  + GY+SKA+YD ++Y+++VH++ 
Sbjct: 334 STGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRW 393

Query: 385 MDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMI 444
           +D       +KY  K  EYED+L  ++S+I  +   M++L+L T+ KI +   +L   ++
Sbjct: 394 LDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNIL 453

Query: 445 ESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEEL-EAQRAEADATNQEL 503
           +    H+++KN IFKETE  K  K++ K   ++KQ E++ E E L E Q    D  N E 
Sbjct: 454 DMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFN-EW 512

Query: 504 LSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAIL 563
            S+++E+T QLD+K   I+  N Q+ +I+  +  L   K  L  +    +E+H +N  +L
Sbjct: 513 NSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELL 572

Query: 564 EGIS-NKDYLPKINXXXXXXXXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXXXXXXX 622
             ++  K+YLP+IN               +K+ET  ++     ++               
Sbjct: 573 TDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIR 632

Query: 623 XXXXXXXXXXXXXFQKQRDE----HDQHVLTLQQEHERQLAE 660
                         QKQ  E    H++ +L +Q+++E+++A+
Sbjct: 633 LKNEKLKREQEQKLQKQLAELKAKHNEELLEIQKKYEKKMAQ 674

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 71/115 (61%), Gaps = 6/115 (5%)

Query: 23  SKGFLRKVVTKEQEDATYSSPFR---TSQSQVEAQKRKVQRFPTVSASSGGN--SSAEMG 77
           S   L+KVV+++  +  Y SPFR     Q+   A+ +K++RFPTVSASS  +  S  E+G
Sbjct: 22  SHSMLKKVVSRDH-NVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELG 80

Query: 78  FKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKG 132
           +K I  + KRAKDI+ P +L  N+ RQ   +  LE KE +L+Y ++SQ ++   G
Sbjct: 81  YKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENG 135

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  134 bits (338), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 169/366 (46%), Gaps = 24/366 (6%)

Query: 317 LQKPKNIKDTPRVPF------ATGIFALWTRSDKRGQPV-----------------ASPD 353
           ++ P+     PR+P+           + + R+D  G PV                 A+P+
Sbjct: 364 VETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPE 423

Query: 354 DPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKS 412
           +PE I K ++ GYMSK +YD + Y+E  H++ +  + K    KYD K +EY + L  L+ 
Sbjct: 424 NPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQK 483

Query: 413 QIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEK 472
           +I  +  +ME L+ +T DKI +S   L  ++ E N  H+  KN IFKETEN K  KI +K
Sbjct: 484 EIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQK 543

Query: 473 AAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQ 532
             ++ K   V+ E  +L  ++ E      +  + +  L  QLD+K   + ++  +Q E Q
Sbjct: 544 KEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQ 603

Query: 533 ASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXXXXXXV 592
             I+ LE QK    A   AA + H     ++E   NK+YLPKI+               +
Sbjct: 604 KEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAII 663

Query: 593 KQETANQHTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDEHDQHVLTLQQ 652
           KQE AN+ TE + ++                             +KQR E ++     ++
Sbjct: 664 KQENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKR 723

Query: 653 EHERQL 658
           EHE Q+
Sbjct: 724 EHEEQV 729

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 57  KVQRFPTVSASSG--GNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERK 114
           K  +FPTVSA+S        E+GFK +D + KRAKDI  P YL  N+ RQ+  L +LE K
Sbjct: 119 KQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELK 178

Query: 115 EDSLQYKKDSQKIV 128
           E  LQY KDSQKI+
Sbjct: 179 EGKLQYLKDSQKII 192

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 160/323 (49%), Gaps = 19/323 (5%)

Query: 349 VASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407
           VASP++PE++V+ ++   +SKA+YD + YE+ +H + +  +     +KY+ K QEYED L
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 408 TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467
             L+ Q+ ++E   +   +    KI I   +L   +++  +K++  K  + KETE  K  
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 468 KIDEKAAVVAKQDEVKAE----NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQE 523
           KI+ K  ++AKQ +VK E    N E EA   E +  N      ++ LTT LD K + I+ 
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWN----GNLENLTTLLDEKIAKIEA 490

Query: 524 LNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGIS-NKDYLPKINXXXXXX 582
           +N+    IQ  I+ L+ +K  L  +    +E    N  +L+ ++  KDYLP++N      
Sbjct: 491 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQI 550

Query: 583 XXXXXXXXXVKQETANQHTEFAAVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQKQRDE 642
                    +K ET +++ + + ++                             ++++DE
Sbjct: 551 AAKFDKLAIIKNETISENNQLSILT--------KKLEEERIAHENEIKMKNEKMKREQDE 602

Query: 643 HDQHVLT-LQQEHERQLAEASQK 664
             Q  LT LQ++H  ++AE  +K
Sbjct: 603 LLQKKLTELQEKHNEEMAEIQKK 625

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 7/130 (5%)

Query: 4   KKHDPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTSQSQVE---AQKRKVQR 60
           K+ D F  L  +D P +E  + FL + ++++ E+  Y SPFR  Q  V    A+  K ++
Sbjct: 3   KRKDTFTVL--EDHPGQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKK 60

Query: 61  FPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSL 118
           FPT SA+S  N     EMG+  +    KRAKDI  P+YL  N++RQ + L +L+ KE  L
Sbjct: 61  FPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKL 120

Query: 119 QYKKDSQKIV 128
              + S +++
Sbjct: 121 HELQKSSRVL 130

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 130/259 (50%)

Query: 348 PVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407
           P  +P++PE ++  ++GYMSKA+YD L  EE  H   +    ++    Y   +Q YE  +
Sbjct: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338

Query: 408 TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467
             L ++I++L A +  LQ +T  +I+   A LS  + +  A++++ ++V+ ++ E  +A 
Sbjct: 339 ADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRAE 398

Query: 468 KIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQ 527
           ++ +K  +V +  E++ E + L   +        E  +RID+L  QLD++   ++ + DQ
Sbjct: 399 QLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458

Query: 528 QAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINXXXXXXXXXXX 587
           QAE+   +  L++QK  L  +   ++E    N   LE ++  DY   +            
Sbjct: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILT 518

Query: 588 XXXXVKQETANQHTEFAAV 606
               ++QE   Q  E  A+
Sbjct: 519 EIAKIRQEIEFQRKELVAL 537

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 71/144 (49%), Gaps = 24/144 (16%)

Query: 1   MFKKK---HDPFEHLFQQDQPKKETSKGFLRK---------VVTKEQEDATYSSPFRTSQ 48
           +FKKK    DPFE L    + KK+    FLR+          VT +     Y SPFR + 
Sbjct: 5   LFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHDEYYSPFRDAI 64

Query: 49  SQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRL 108
           +  EA      +FPT             G  V + AR+R  DI  P+ L   DERQR++L
Sbjct: 65  AVEEAHGSGTLKFPTT------------GTHVTEEARRRVPDIDEPKRLSTVDERQRQQL 112

Query: 109 DKLERKEDSLQYKKDSQKIVKVKG 132
            +LE KE  L+  K+SQKIV V+G
Sbjct: 113 QELELKEGQLRLYKESQKIVDVRG 136

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 104/205 (50%), Gaps = 1/205 (0%)

Query: 348 PVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDH 406
           P A+ D PE ++K  K G++S A+++ + Y++ VHK EM  Y +E   K+  K QEYE  
Sbjct: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357

Query: 407 LTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKA 466
           L  +  +   + A M   +LD   K  +   +   ++ +SNA  +++K  +  E +  K 
Sbjct: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKL 417

Query: 467 AKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELND 526
            K+ +   +  K+  ++ E  +L  +++ A+       + +  +T +LD++   + + N 
Sbjct: 418 QKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477

Query: 527 QQAEIQASIDALEQQKDTLVADATA 551
           +Q +I   I  L Q+K  L A+  A
Sbjct: 478 KQDKITRQIRDLTQRKTELEAEIDA 502

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 68/114 (59%), Gaps = 9/114 (7%)

Query: 22  TSKG-FLRKVVTKEQEDATYSSPFRTSQ----SQVEAQKRKVQRFPTVSASSGGNS--SA 74
            S+G F R + T   E+  Y SPFR  Q    S+ + Q ++ ++FPTVSA+S  NS  + 
Sbjct: 31  VSRGSFRRAIGTAATEE--YVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTR 88

Query: 75  EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128
           E+GF  +   ++RA+DI  P YL  N++RQR  L  LE++E +L + +  Q ++
Sbjct: 89  ELGFSKVTDDQRRARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 56/96 (58%), Gaps = 5/96 (5%)

Query: 40  YSSPFRTSQSQVE---AQKRKVQRFPTVSASS--GGNSSAEMGFKVIDAARKRAKDIAVP 94
           Y SPFR +Q+      A K+K  R+PT+SA+S     +  ++G+K I  + KRAKDI  P
Sbjct: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115

Query: 95  RYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKV 130
             L  N+ RQ +   +L  KE  L Y + SQK++KV
Sbjct: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (46%), Gaps = 29/207 (14%)

Query: 348 PVASPDDPEFIVKF----DKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEY 403
           P A+P +PE +VK     +   +SK++YD + Y   VH + +  Y  ++  KY  K +E+
Sbjct: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436

Query: 404 EDHLTSLKSQIAELE-------ATMEQLQLDTTDKINISAAELSARM-IESN--AKHSNT 453
            + +  L  +I  +E       A ++ L  D  +K +I       +M I+ N   K ++ 
Sbjct: 437 NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDE 496

Query: 454 KNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQ 513
              I + +  + A  +D K A V KQ +     ++ +++++              +L  Q
Sbjct: 497 ITYILQSSPPTAAISLDTKDA-VTKQSDCTPLIKDWKSEQS--------------KLNEQ 541

Query: 514 LDSKQSAIQELNDQQAEIQASIDALEQ 540
           +DSK + I++LN   A+++  I  L +
Sbjct: 542 IDSKVNVIKQLNKNLADVKQKITELSE 568

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 118/241 (48%), Gaps = 13/241 (5%)

Query: 319 KPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKGY-MSKALYDTLEYE 377
           KP + KD P+V   T          +   PVASP++ E +VK   G  +SK +YD +E++
Sbjct: 228 KPIHRKDYPKVQSTT----------ESKFPVASPENKETVVKLTSGKKISKYVYDKIEHD 277

Query: 378 EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAA 437
             V+ Q + +Y  +  +K +    EY + + S++ +  +    +E L L++ +   +   
Sbjct: 278 TKVNDQYIVKYQNDQLNKLNKLKSEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQN 337

Query: 438 ELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497
           +L   +++S A  S+ K  I ++T   K  K++E   +  K++ ++ E   +  ++    
Sbjct: 338 KLVKNLMDSTATFSDNKVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYK 397

Query: 498 ATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLV--ADATAADEL 555
                +   ++E+  +LD+K   + + N +   ++  I+ L+ +K TL+   D+    +L
Sbjct: 398 TNFNYINCSLNEILQELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKL 457

Query: 556 H 556
           H
Sbjct: 458 H 458

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 26  FLRKVVT---KEQEDAT-YSSPFRTSQSQVEAQKR----KVQRFPTVSASSGGNSSAEMG 77
           FL KV T   KE +D   Y+SPFR +    E +K+    K  +FP VSA+S  N+  +  
Sbjct: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDV 92

Query: 78  FKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKV 130
           +K +D  +  A+DI  P  L  N+ RQ + L  L+ K+D+L   KDS +++ V
Sbjct: 93  YKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 7   DPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTS---QSQVEAQKRKVQRFPT 63
           D F  + ++ +  K   + FL+  +     DA Y SPFR +         ++ K  ++  
Sbjct: 9   DRFIEVLKEQERAKNPHRNFLKDTIA---HDAKYQSPFRRNINPNYLNYIREHKNAKYTI 65

Query: 64  VSASSGGN--SSAEMGFKVIDA---ARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSL 118
            + +S  N  +   +G+K I     +RK AKDI  PR L+ N+E Q   L++L+ KE++L
Sbjct: 66  TNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNL 125

Query: 119 QYKKDSQKIVKV 130
           ++ KDSQ +V +
Sbjct: 126 KFLKDSQNLVYI 137

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/151 (19%), Positives = 71/151 (47%), Gaps = 5/151 (3%)

Query: 317 LQKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKG-----YMSKALY 371
           ++KP NI   P++P          +  +    +A+P + E ++   K      Y SK ++
Sbjct: 153 IEKPINIYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVF 212

Query: 372 DTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDK 431
           D ++YE  +H  ++ +   +  +++ +K  EY+  +++L ++I      + +L    +  
Sbjct: 213 DNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHF 272

Query: 432 INISAAELSARMIESNAKHSNTKNVIFKETE 462
            + S  + +   +    +++NTK  ++ E E
Sbjct: 273 KDFSDFKSTKNYLFKMTEYNNTKTRLYGEIE 303

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 74/152 (48%), Gaps = 10/152 (6%)

Query: 317 LQKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKF------DKGYMSKAL 370
           +++P +I+  P++P++   +     ++ R  PVA+P+ PE +V +      +K Y SK +
Sbjct: 93  VREPVDIQKVPKIPYSE--YGQCNEAEFRN-PVATPETPEEVVIYKHLNGTNKAY-SKEI 148

Query: 371 YDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTD 430
           +D ++ +   H   +     +  D+   K +EY   L  L  QI   +A M  L+     
Sbjct: 149 FDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQR 208

Query: 431 KINISAAELSARMIESNAKHSNTKNVIFKETE 462
            I+++   L+   +    + +  KN I+KETE
Sbjct: 209 AIDLNENRLTKTFLLQTQQFTAEKNKIYKETE 240

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

Query: 49  SQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRL 108
           S +  +KRK        +S       E+G+K     +K A++I  P  L  N+ RQR  L
Sbjct: 3   SMLLGKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAIL 61

Query: 109 DKLERKEDSLQYKKDSQKIVKVKGEVGKSSTV 140
             L+ KE  L + K SQ++V +   V K   V
Sbjct: 62  QDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVV 93

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 68/152 (44%), Gaps = 6/152 (3%)

Query: 348 PVASPDDPEFIVKF--DKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYED 405
           P+A+  +PE ++K   DK  ++K  YD L      H   M     E+++ Y+ K + Y++
Sbjct: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443

Query: 406 HLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSK 465
            L  L  QI      +  ++ DT     ++ A L+ +  +  +  ++ K V+     N+K
Sbjct: 444 KLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL----NNNK 499

Query: 466 AAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497
            A  D+       Q  +K   + L+ +  + D
Sbjct: 500 LALCDQLDNTELLQRHIKDPKDSLQQKLKDND 531

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 87  RAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKGEVGKSSTVETEPE 145
           R  +I  P +L+G +E+Q+  L  L+ KE +LQ  K+SQ+I+        SST  T P+
Sbjct: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII-------TSSTARTYPQ 143

>ZYRO0C17094g Chr3 complement(1327234..1328682) [1449 bp, 482 aa]
           {ON} weakly similar to uniprot|P38272 Saccharomyces
           cerevisiae YBR130C SHE3 Protein that acts as an adaptor
           between Myo4p and the She2p-mRNA complex part of the
           mRNA localization machinery that restricts accumulation
           of certain proteins to the bud also required for
           cortical ER inheritance
          Length = 482

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 371 YDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQL---D 427
           +++   EEA  +Q+M+    +    YDA    ++ + +   SQI+ L   +E L+L   +
Sbjct: 187 WESSSSEEATLRQQMEMVQAQ----YDALVDSHQYYKSHYSSQISTLSEQLENLKLEQRN 242

Query: 428 TTDKINISAAELSARMIESNAKHSN 452
            T +++  A   +A+++E ++KH+N
Sbjct: 243 YTQRVSDEANTFNAKLLEFDSKHAN 267

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 85/185 (45%), Gaps = 24/185 (12%)

Query: 378  EAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQ---LDTTDKINI 434
            E + KQ   Q +K++  K D  ++E + +   +    AELE+TM QLQ   ++ TD+   
Sbjct: 1090 EKLKKQNQQQSSKKDIHKLDELSKEADSYKAQVSKLSAELESTMGQLQKSSVEQTDR--- 1146

Query: 435  SAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEEL--EAQ 492
                     IE+  K +   N      E  K A++     V A Q+  +A N+ +    Q
Sbjct: 1147 ---------IENLIKENKDLNTTIATLEKEKKAQV----VVNAHQENARANNKAVVDNKQ 1193

Query: 493  RAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEI---QASIDALEQQKDTLVADA 549
            +A++      + S++ EL  QL++ Q    E+   Q E+   + +   LE ++D L+   
Sbjct: 1194 KAKSQPATPLVNSKVQELEEQLEALQRKCSEMETLQKEVKELKENATQLESERDDLMLLV 1253

Query: 550  TAADE 554
            +  DE
Sbjct: 1254 SDLDE 1258

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 83/178 (46%), Gaps = 12/178 (6%)

Query: 376 YEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQ-IAELEA----TMEQLQLDTTD 430
           + E  HK +++Q T     + +    EY   L +LK + I + E      +E+++ +  +
Sbjct: 138 FLEESHKLKLEQLTANKNAELNKMNDEYRSKLEALKYEKIKKFENEKNELIEKIE-EIRN 196

Query: 431 KINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELE 490
           K+  +   L  RM +  A H   K    K+ +       ++    + K  E+K+E E + 
Sbjct: 197 KMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQESIRKTKELKSEIETVL 256

Query: 491 AQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548
             R   D  N+    R++EL +++      +Q  N+Q  EI+ +ID   ++KD L+A+
Sbjct: 257 TPRI--DTQNK----RLEELKSEIKKLDDTLQNKNEQVGEIRKNIDLEREKKDKLLAE 308

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 81/159 (50%), Gaps = 34/159 (21%)

Query: 389 TKENTDKYD-AKAQEY----------EDHLTSLKSQIAELEATME--QLQLDTTD----K 431
           T +N D++D + +++Y          E HL  ++  I++LE+  E  +L+L+T +    K
Sbjct: 480 TDDNNDEFDKSSSKDYNMIHNFMRNREYHLEYVQVLISQLESQREYYELKLETQNLEIKK 539

Query: 432 IN--------ISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVV-AKQDEV 482
           +N        I   +L++++ + N K SNT N+I K+  +     IDEK  ++   Q+ +
Sbjct: 540 MNENNQNKNQIEIEKLNSKLNDLNTKLSNTSNIIEKQNHD-----IDEKNLMIKGLQENL 594

Query: 483 KAE---NEELEAQRAEADATNQELLSRIDELTTQLDSKQ 518
            ++   N  LE    +  A N++L  +  +L   LDS+Q
Sbjct: 595 DSQTKKNTNLEKLVNQLQAENRDLTEQTKDLMFFLDSQQ 633

>ZYRO0F01672g Chr6 complement(136165..137055) [891 bp, 296 aa] {ON}
           similar to uniprot|P42941 Saccharomyces cerevisiae
           YGR208W SER2 phosphoserine phosphatase
          Length = 296

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 458 FKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSK 517
           F  T  S +A++DE         +VK  N ELE+  ++++ + + L   + ++T  +DS 
Sbjct: 4   FVVTYISHSAQLDEA--------QVKHLNHELESVFSKSELSTKRLAPHVVDVTFTVDSD 55

Query: 518 QSAIQELNDQQAEIQASIDALEQQKDT 544
            S+++   D   + Q  ID + Q+ D+
Sbjct: 56  WSSVKRALDPLIDSQNQIDIIVQRNDS 82

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
           similar to uniprot|P33420 Saccharomyces cerevisiae
           YPL174C NIP100 Large subunit of the dynactin complex
           which is involved in partitioning the mitotic spindle
           between mother and daughter cells putative ortholog of
           mammalian p150(glued)
          Length = 869

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 474 AVVAKQDEVKAE---NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQA 529
           A+V  Q  ++A    N+ LE ++ E +  N++L S I ELT QLD  +  I +L  Q A
Sbjct: 213 ALVKLQSSLEASRKVNKSLEGEKHEVEVENKKLKSEIFELTNQLDDAKKIITDLTSQLA 271

>Kpol_1016.27 s1016 complement(70200..71090) [891 bp, 296 aa] {ON}
           complement(70200..71090) [891 nt, 297 aa]
          Length = 296

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 19/22 (86%)

Query: 258 ASKPIETTEASQPIESTEASQP 279
           A+ P++TTEA+ P+++TEA+ P
Sbjct: 109 AAAPVQTTEAAAPVQTTEAAAP 130

>NDAI0B01390 Chr2 (321257..324073) [2817 bp, 938 aa] {ON} Anc_2.590
          Length = 938

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 20/113 (17%)

Query: 477 AKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQEL------NDQQAE 530
           AK D++  + EELE    E   T   L ++  E   +L SKQ+ +++L      N++++E
Sbjct: 610 AKLDDLDQKKEELETDLNEHIIT---LANKTKE-EAELSSKQARLKQLEVDALVNERKSE 665

Query: 531 IQAS--------IDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKI 575
           +  +        +D LE  K+  +A A   DEL+   +  L G+++K+YL KI
Sbjct: 666 LNNTEIMLKKEKLDLLESMKN--LASARGDDELNEEKVKALVGMTSKEYLEKI 716

>ACL132C Chr3 complement(120950..123814) [2865 bp, 954 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR045C
           (STU2)
          Length = 954

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 432 INISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEA 491
           +N        R++  +  HS  +   F    +   +  +  A  V     V AE +EL+ 
Sbjct: 660 LNNGGLNTKPRLVNRSQTHSTVRASHFNPMSSLPPSSNNSLAPAVVP-PAVLAELDELKG 718

Query: 492 QRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASID 536
            +A+ +   QEL++++    TQ     S  Q L DQ  ++Q +++
Sbjct: 719 AKAKWNKERQELMTKLTSFQTQTSQLNSENQMLQDQLNDVQLALN 763

>KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1872

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 461  TENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSA 520
            T NS+A  +D    ++ + +      E L  +R  ADA  +EL    D+LT + +S  S 
Sbjct: 1566 TNNSEAKIVD----LIKQLEHYSHLAEVLSNERDVADAAEKELRKEYDDLTMKSNSLTSK 1621

Query: 521  IQELNDQQAEIQASIDALEQQKD 543
            ++ L D+++++ + ID L ++ D
Sbjct: 1622 VESLADERSQLLSDIDQLRKKLD 1644

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.121    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,845,075
Number of extensions: 2311064
Number of successful extensions: 13594
Number of sequences better than 10.0: 944
Number of HSP's gapped: 13699
Number of HSP's successfully gapped: 1459
Length of query: 787
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 669
Effective length of database: 39,950,811
Effective search space: 26727092559
Effective search space used: 26727092559
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 70 (31.6 bits)