Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212273.491ON37637617820.0
KLTH0F14806g3.491ON35837613270.0
SAKL0F02794g3.491ON39739911291e-153
Skud_16.4433.491ON4204229521e-126
TDEL0D055903.491ON3443759371e-125
ZYRO0D10010g3.491ON3823929111e-120
Suva_16.4773.491ON4234309101e-120
YPR148C3.491ON4354368881e-116
Smik_16.4013.491ON4274298781e-115
KLLA0E04621g3.491ON3893978741e-115
Ecym_12383.491ON3933968531e-112
AFR309C3.491ON3643818161e-106
Kpol_1017.73.491ON3783847684e-99
TBLA0D029803.491ON4434187406e-94
TPHA0D032703.491ON3884057182e-91
CAGL0L08492g3.491ON3853706903e-87
KAFR0G036803.491ON4154326306e-78
NCAS0F035403.491ON4442605666e-68
NDAI0B058503.491ON4732925633e-67
KNAG0A079303.491ON4522834375e-49
Kwal_47.181487.221ON3233422115e-18
TDEL0H022407.221ON3383482106e-18
Kpol_1070.197.221ON3112722096e-18
SAKL0F08162g7.221ON3303652053e-17
KLTH0A03894g7.221ON3233672043e-17
KLLA0E04511g7.221ON3022502008e-17
Suva_9.1597.221ON3252422001e-16
KNAG0D017607.221ON3423571983e-16
NDAI0A026607.221ON3642521966e-16
ZYRO0D16522g7.221ON3583591922e-15
TPHA0C012307.221ON3052471883e-15
KAFR0I019507.221ON3302461877e-15
Smik_9.1507.221ON3262431851e-14
ADL115W7.221ON3333641851e-14
YIL041W (GVP36)7.221ON3262431832e-14
Skud_9.1287.221ON3292101805e-14
Ecym_43777.221ON3332411797e-14
CAGL0L00891g7.221ON3413581781e-13
NCAS0A133807.221ON3292511663e-12
TBLA0B015807.221ON3862411584e-11
Kpol_478.227.221ON3503091523e-10
TPHA0B027507.221ON3633681479e-10
TBLA0D042007.221ON3311131452e-09
Kwal_33.141101.232ON45457722.1
NDAI0D031304.340ON149563713.1
KLTH0G19448gsingletonON148679686.4
NDAI0E050405.702ON197386687.3
Skud_12.3436.52ON84064679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21227
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   691   0.0  
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   515   0.0  
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   439   e-153
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   371   e-126
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   365   e-125
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   355   e-120
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   355   e-120
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   346   e-116
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   342   e-115
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   341   e-115
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   333   e-112
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   318   e-106
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   300   4e-99
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   289   6e-94
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   281   2e-91
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   270   3e-87
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   247   6e-78
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   222   6e-68
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   221   3e-67
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   172   5e-49
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    86   5e-18
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    86   6e-18
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    85   6e-18
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    84   3e-17
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    83   3e-17
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    82   8e-17
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    82   1e-16
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    81   3e-16
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     80   6e-16
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    79   2e-15
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    77   3e-15
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    77   7e-15
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    76   1e-14
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    76   1e-14
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    75   2e-14
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    74   5e-14
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    74   7e-14
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    73   1e-13
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    69   3e-12
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    65   4e-11
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    63   3e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    61   9e-10
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    60   2e-09
Kwal_33.14110 s33 complement(531600..532964) [1365 bp, 454 aa] {...    32   2.1  
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    32   3.1  
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    31   6.4  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    31   7.3  
Skud_12.343 Chr12 (611224..613746) [2523 bp, 840 aa] {ON} YLR263...    30   9.7  

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/376 (90%), Positives = 342/376 (90%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60
           MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120
           EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL
Sbjct: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXX 180
           FGLM                  LMPRSFAQAIAKAAKDSGDVLAALK             
Sbjct: 121 FGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDE 180

Query: 181 XXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240
              ITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED
Sbjct: 181 DEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240

Query: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300
           SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE
Sbjct: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300

Query: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360
           EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD
Sbjct: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360

Query: 361 LEASLSTLNELEGEDA 376
           LEASLSTLNELEGEDA
Sbjct: 361 LEASLSTLNELEGEDA 376

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/376 (68%), Positives = 292/376 (77%), Gaps = 18/376 (4%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60
           MS+YFGGFS NKLT+++TN AHKTQDTLSTAIANIQLDDPQA LSLKARKHYLQETLGTI
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120
           EDISKLPPQYQ LEKKCDSLEK CRRMLVVTKT+EVEGYDYPPNLSESLSDWWSSNKEGL
Sbjct: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXX 180
           FG +                  LMPRSFAQAI+KAAKDSG+V+ ALK             
Sbjct: 121 FGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDEE 180

Query: 181 XXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240
              IT LIKMF AWS CQ+ +DQ KAEMDALM KEFN KL A +EEKFKNA  LR+KVED
Sbjct: 181 DEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVED 240

Query: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300
           SRLKFDTMRYE+K+ E+Q K     E AQ  ES    +E+ A+A++ S+           
Sbjct: 241 SRLKFDTMRYELKMAEEQGKT---EEAAQQTESQ-KPQEDEAEASKDSD----------- 285

Query: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360
              ++D AQ+LLEKLEDEFVSNTTEAVETMGEITDSAE++NLVKLFHNFQL+Y++QCVQ+
Sbjct: 286 ---SSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQN 342

Query: 361 LEASLSTLNELEGEDA 376
           LE S+++LNELEG++A
Sbjct: 343 LETSINSLNELEGDEA 358

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  439 bits (1129), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 276/399 (69%), Gaps = 27/399 (6%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60
           MS YF  FS +KLT+++++AAHKTQD LSTAIANIQLDDPQA LSLK RKHYLQETLG I
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120
           +DISKLPPQYQ LEKKCDSLEK CRRMLVVTKTFEVEGYDYPPNLSES+SDWW +N+ GL
Sbjct: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 121 FGLM--XXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALK-XXXXXXXXXX 177
              M                     +PRSFAQA++KAAKDSGDVL  LK           
Sbjct: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDED 180

Query: 178 XXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRK 237
                 I  LI MF AWS+C+ KIDQ KAEMD+LMAKEFN+KL+ LI E FK    LR+K
Sbjct: 181 EDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240

Query: 238 VEDSRLKFDTMRYEVKLTEQQSKQAM----ENEKAQFKESDLS---SKEEGADANE---- 286
           VE+SRLKFDT+RYE+ L E++ ++A     ENEK    E +     +K EG + +E    
Sbjct: 241 VEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEKAKTEGQETSEGKEH 300

Query: 287 -----------TSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITD 335
                      T++++ +SV    EE    D   +LLEKLEDEFVS+TTEAVE MGEITD
Sbjct: 301 DLKADEKLSEDTASKIPESV--ENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGEITD 358

Query: 336 SAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374
           S+E+L+LVKLFH FQL+YHRQCVQ+LEAS   L+ L+ E
Sbjct: 359 SSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  371 bits (952), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/422 (49%), Positives = 251/422 (59%), Gaps = 51/422 (12%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIA--NIQLDDPQAILSLKARKHYLQETLG 58
           MS YF GFS NK+TD++  AAHKTQDTL+ A+A  N+ L+DP+  LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQ LEKK DSLEK CRR+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 119 GLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDS--------GDVLAALKXXX 170
           G FG                     +PRSFAQAI+KAA D          D  A LK   
Sbjct: 121 GWFG--SRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKS 178

Query: 171 XXXXX----------XXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKL 220
                                  ++ LIK+F +WS C   ID+GKAEMD+ M KEFN+KL
Sbjct: 179 ESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKL 238

Query: 221 NALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSK-QAMENEK------------ 267
             LI + FK    LR+KVEDSRLKFDTMRYEVK  E + K Q  E  K            
Sbjct: 239 EKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAP 298

Query: 268 -------AQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQ---------EL 311
                      ES +S   EG    ETS          KE+   N   +         +L
Sbjct: 299 ISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENKL 358

Query: 312 LEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNEL 371
           LEKLEDEFVSNTT AVE M EITDS+++L LVKLF NFQLVY RQCVQ++EA+L  LN L
Sbjct: 359 LEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSL 418

Query: 372 EG 373
           E 
Sbjct: 419 EN 420

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  365 bits (937), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 204/375 (54%), Positives = 247/375 (65%), Gaps = 32/375 (8%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60
           MS Y   FS NK+TDTL NAAHKTQDTL++AIAN+   DPQA LSLKAR  YLQETLGTI
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58

Query: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120
           +D SKLPPQYQ LEKK D+LEK C+R+L+VT+TFEVEGYDYPPNL+ES+SDWWS NK+G 
Sbjct: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118

Query: 121 FGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXX 180
           FG                     +PRSF+QAI+KAA D   V   L+             
Sbjct: 119 FG---TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQ-----EHGDEDEE 170

Query: 181 XXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVED 240
              ++ + KMF +WS+C   ID+GK EMD+++ KEFN KL  +I E FK     R+KVE+
Sbjct: 171 DEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEE 230

Query: 241 SRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE 300
           SRLKFDT+RYE+KL E       EN K    E+D +SK+E               TKT+E
Sbjct: 231 SRLKFDTVRYEIKLKE------TENAKKS-TETDEASKDE---------------TKTEE 268

Query: 301 EQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360
           E        +LLE+LEDEFVSNTT AVE MGE+T+SAE+L L KLF NFQLVY RQCVQ+
Sbjct: 269 EPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQE 328

Query: 361 LEASLSTLNELEGED 375
           +EASL  L  LE +D
Sbjct: 329 VEASLKILGALESDD 343

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 193/392 (49%), Positives = 244/392 (62%), Gaps = 29/392 (7%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60
           MS YF  FSF  L D++ NAAH+TQD LS A+AN+ L+DPQ  LS+K R  YL+ETLG +
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120
           ++ISKLPPQY LLE+K D+LEKAC+RML+VT+TFEVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 121 FG-LMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXX 179
           FG                     LMPRSFAQAIAKA+ + G+   A +            
Sbjct: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGE---AYQNSQKSEKKQIDE 177

Query: 180 XXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVE 239
               +  L++MF+  S C   ID+GK EMD  +A+EFN KL  L+   FK   VLR KVE
Sbjct: 178 DEDDVN-LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 236

Query: 240 DSRLKFDTMRYEVKL------------------TEQQSKQAMENEKAQFKESDLSSKEEG 281
           +SRLKFDTMRYE++L                     +++Q   NE A  KE +  +  E 
Sbjct: 237 NSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPA--KEEEKPTPAEP 294

Query: 282 ADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLN 341
           A+A  T+    K+    KE         +LLE+LEDEFVSNT+EAVETM  I + +E+L 
Sbjct: 295 AEAQHTT----KTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILR 350

Query: 342 LVKLFHNFQLVYHRQCVQDLEASLSTLNELEG 373
           L+KLF N QLVY+RQCVQ++EASL  LN+LE 
Sbjct: 351 LMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  355 bits (910), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/430 (47%), Positives = 252/430 (58%), Gaps = 64/430 (14%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIAN--IQLDDPQAILSLKARKHYLQETLG 58
           MS Y+     NK+TD++  AAHKTQDTL++A+AN  + L+DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 119 GLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXX 178
           G FG                     +PRSFAQAI+KAA D       L+           
Sbjct: 116 GWFG--SKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKK 173

Query: 179 XXXXX----------------------ITPLIKMFSAWSECQYKIDQGKAEMDALMAKEF 216
                                      ++ LIK+F +WS C   ID+GKAEMD++M KEF
Sbjct: 174 EAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEF 233

Query: 217 NQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQ--------SKQAMEN--- 265
           N+KL  LI E FK    LRRKVE+SRLKFDTMRYE K  E+Q        SK+A  N   
Sbjct: 234 NKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNS 293

Query: 266 ------------EKAQFKESDLSSKEEGADANETSNEVGKSVTKTKE---EQATNDAA-- 308
                       EK   KE D    EE     ET          T E   +Q TN+    
Sbjct: 294 ANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPPV 353

Query: 309 -----QELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEA 363
                 +LLEKLEDEFVSNTT AVETM EITDS+E+L+LVKLF NFQLVY RQC Q++EA
Sbjct: 354 EDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEA 413

Query: 364 SLSTLNELEG 373
           +L  LN +E 
Sbjct: 414 NLKVLNGMEN 423

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  346 bits (888), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 253/436 (58%), Gaps = 66/436 (15%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58
           MS YF GFS NK+TD++  AAHKTQDTL+ A+AN  ++  DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
           T+ DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKD-------------------- 158
           G FG                     +PRSFAQAI+KAA D                    
Sbjct: 121 GWFGSK--KSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKK 178

Query: 159 -------SGDVLAALKXXXXXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDAL 211
                  + +   A                  ++ LIK+F +WS C   ID+GKAEMD++
Sbjct: 179 ESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSM 238

Query: 212 MAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQ------------- 258
           M KEFN+KL  LI + FK    LR+KVE+SRLKFDTMRYEVK  E +             
Sbjct: 239 MVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAH 298

Query: 259 -----SKQAMENEKAQFKES----DLSSKEEGAD---ANETSNEVGKSVTKTKEEQATND 306
                +K    N    F E+    D   K EGA+     E +      V   KE+  +N 
Sbjct: 299 SKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSNK 358

Query: 307 AAQE----------LLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQ 356
              E          LLEKLEDEFVSNTT AVETM EITDS+E+L L+KLF NFQLVY RQ
Sbjct: 359 VNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQ 418

Query: 357 CVQDLEASLSTLNELE 372
           CVQ++EA+L  LN LE
Sbjct: 419 CVQEVEANLKVLNGLE 434

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  342 bits (878), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 252/429 (58%), Gaps = 58/429 (13%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58
           MS YF  FS NK+TD++  AAHKT DTL+ A+AN  ++  DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
           TI DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDS--------GDVLAALKXXX 170
           G FG                     +PRSFAQAI+KAA D          D  A LK   
Sbjct: 121 GWFG--SKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKR 178

Query: 171 XXXXXXXXXXXX----------------XITPLIKMFSAWSECQYKIDQGKAEMDALMAK 214
                                        ++ LIK+F +WS C   ID+GK EMD++M K
Sbjct: 179 ESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238

Query: 215 EFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQ--SKQAMENEKAQFKE 272
           EFN+KL  LI + FK    LR+KVE SRLKFDTMRYEVK  E Q  +++    E+A  K+
Sbjct: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKD 298

Query: 273 SDLSSKEEGADANETSNEVGKSVTKTK-------EEQATNDAA----------------- 308
              ++     +   T +E  KS   T+        EQ  +DA                  
Sbjct: 299 VSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTPLE 358

Query: 309 ----QELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEAS 364
                +LLEKLEDEFVSNTT AVETM EI DS+E+L L+KLF NFQLVY RQCVQ++EA+
Sbjct: 359 ESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEAN 418

Query: 365 LSTLNELEG 373
           L  LN LE 
Sbjct: 419 LKVLNGLEN 427

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 242/397 (60%), Gaps = 36/397 (9%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64
           F   S N +TD+++NAA +TQ+  S+AI  I LDDP+  LS+  R+H LQETLGT+ DIS
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLM 124
           +LP QY+ LE+K D+LEK C+R+L+VTKTFEVEGYDYPPNL+ES +DWWS NK+ +F   
Sbjct: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120

Query: 125 XXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXI 184
                             L+PRSFAQA++KAA DS  +L  LK                 
Sbjct: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180

Query: 185 TP--------------------------LIKMFSAWSECQYKIDQGKAEMDALMAKEFNQ 218
            P                          LIK F +W++CQ  IDQ KAEMD+LM KEFN 
Sbjct: 181 KPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240

Query: 219 KLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSK 278
           KL+ LIE  FK    LR KV+D+RL FDT+R+E+KL  Q+ +    +E+A+ K     + 
Sbjct: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKK----VAT 296

Query: 279 EEGADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAE 338
           E      + +NE    + KT+E     D   +L E+LED+FVS T+E VE +GE+TDS+E
Sbjct: 297 ETPETPEKKTNEEPVDMAKTEE-----DPDSKLFERLEDQFVSATSETVEFLGELTDSSE 351

Query: 339 LLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGED 375
           +++LVKLFHNFQL++++QCV+ LE  L  LN L+ ED
Sbjct: 352 IISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  333 bits (853), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/396 (46%), Positives = 242/396 (61%), Gaps = 28/396 (7%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQ-------DTLSTAIANIQLDDPQAILSLKARKHYL 53
           MSSYF  FS +K+  T+  AAHKTQ       + L+ AI +I LDDPQ +LSL+ RKH L
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 54  QETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWW 113
           QETLGTI+DISKLPP+YQ LE+KCD+ EK C R+LVV+KTFEV+GYDYPPNL+ES+SDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 114 --SSNKEGLF-GLMXXXXXXXXXXXXXXXXXX-----LMPRSFAQAIAKAAKDSGDVLAA 165
             SS K+G+F G                          +P SFAQAI+KAA DS  +L  
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 166 LKXXX-XXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALI 224
           L                  +  L+ +  AW+E Q  ID+ K +MD  M  EFN+KL++L+
Sbjct: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240

Query: 225 EEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMEN----EKAQFKESDLSSKEE 280
              F     LR+KVE+SRLKFDT+RYE+++ +  + Q  E     E  Q  + D   KE 
Sbjct: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKD---KEN 297

Query: 281 GADANET-SNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAEL 339
             +   T  N  G   +  +E+Q      + LLEK EDEFVSNTT+AV  M +ITDS  L
Sbjct: 298 EDNLKPTIHNNTGIGSSSDEEDQK----FRLLLEKAEDEFVSNTTDAVAYMTQITDSVNL 353

Query: 340 LNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGED 375
             LVKLFHNFQL+YH++CVQ+L+ASL+ +N L  E+
Sbjct: 354 STLVKLFHNFQLIYHKKCVQELQASLNVINTLTVEE 389

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  318 bits (816), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/381 (47%), Positives = 229/381 (60%), Gaps = 29/381 (7%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLS-------TAIANIQLDDPQAILSLKARKHYL 53
           MS+YFG  S +KL +TL NAA KTQ  LS        AI NI++DDP+ ILSLK RK  L
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 54  QETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWW 113
           QETLG+ +DIS+LPPQY  LE+KCD++E+ C+++LVV+KTFEVEGYDYPPN +ES+SDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 114 -SSNKEGLF-GLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXX 171
            +S KE  F                        P SFA A+ +AAK S  ++  LK    
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAE 180

Query: 172 XXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNA 231
                       +  LIKMF  W++ QY +D  K EMD  M KEFN+KL  L+E +FK  
Sbjct: 181 EEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240

Query: 232 SVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEV 291
             LRRKVE+SRL FDT++YE            E + A  K+ D + + EGA     S  V
Sbjct: 241 HTLRRKVEESRLTFDTLKYE----------QHERDAALAKKQDEAKQAEGATP---STGV 287

Query: 292 GKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQL 351
            +S T        + A    LE  EDEFVSNT EAVE M  I D+ +L++LVKLF NFQL
Sbjct: 288 TQSST-------ADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQL 340

Query: 352 VYHRQCVQDLEASLSTLNELE 372
           VYHR+CVQ+LE SL++L  LE
Sbjct: 341 VYHRKCVQELEVSLNSLTSLE 361

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  300 bits (768), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 168/384 (43%), Positives = 230/384 (59%), Gaps = 24/384 (6%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQ------LDDPQAILSLKARKHYLQETLG 58
           F GFS +KLTD+++N A KTQ+ L+ A++N+       L+DP   LS+K++  ++QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 59  TIED-ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNK 117
           TI D  SKLPP Y  LE K D++EKA +R+L VTKT+E EGYDYPPNL+ESLSDWW+++ 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND- 120

Query: 118 EGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXX 177
                                     +PRSFAQAI+ A+ D+   + ++           
Sbjct: 121 -------DNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDD 173

Query: 178 XXXXXXI---TPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234
                     + L K+F +   C   ID GK EMD L+  EFN KL  LI  +FKN   L
Sbjct: 174 EEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233

Query: 235 RRKVEDSRLKFDTMRYEVKLTE-QQSKQAMENE-KAQFKESDLSSKE----EGADANETS 288
           R+ VE+SRLKFDTMRYE+K+ E +++   ME E K+   +   S KE    E +      
Sbjct: 234 RKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEASKKETPK 293

Query: 289 NEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHN 348
            E+ K    T E    ND   +LLEKLEDEFVSNT  AVE M E+TD+++++NLVKL+ N
Sbjct: 294 KEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQN 353

Query: 349 FQLVYHRQCVQDLEASLSTLNELE 372
           FQLVY++QC+Q++E++L  LN LE
Sbjct: 354 FQLVYYKQCIQEIESNLKILNGLE 377

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  289 bits (740), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 167/418 (39%), Positives = 232/418 (55%), Gaps = 44/418 (10%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58
           MS YF  FS +KL D+L +AA KTQDTLS AI N+ +D  DPQ  L+L +++HYLQE++G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
            I +ISKLP QY  LE+K D+LEK  +R+L+VT TFE+EGYDYPPNLSES+S+WW ++  
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 119 GLF---------GLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKX- 168
                                             +PRSF  AI+KA+ DS  +L  L   
Sbjct: 146 AFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNN 205

Query: 169 -----XXXXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNAL 223
                               I  LIK+F +WS C   ID+ K + D L+ K+FN+KL +L
Sbjct: 206 EKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265

Query: 224 IEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKA--------------- 268
           ++ +FKN   LR KV+D+RLKFDTMRYE+    +   +A EN+K                
Sbjct: 266 LDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEENDKPVEMEKGEGEDEGEGE 325

Query: 269 QFKESDLSSKEEGADANETSNEVGKSVTKTKEEQA---------TNDAAQE---LLEKLE 316
              +     +         S    K    T E Q           ND+  E   LLE LE
Sbjct: 326 GKGKGKGKGETASTSTETASTSTTKDAAATIESQKKDSPNPEFEKNDSQNEDEKLLEHLE 385

Query: 317 DEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374
           DEFVS+T+ AVETM EIT+S+++L+L+KLF NFQL++++QC++++E ++  L +L  E
Sbjct: 386 DEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  281 bits (718), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/405 (42%), Positives = 229/405 (56%), Gaps = 58/405 (14%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQ------LDDPQAILSLKARKHYLQETLG 58
           F  FS +KLTD+++N A KTQ+  + AI ++       L+DP   LS++AR  Y+QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 59  TIED-ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNK 117
           T++D ISKLP QY  LE K DS+EK  +R+L+VT TF  EGYDYPPNL+ES+SDWW+ ++
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121

Query: 118 EGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXX 177
                                     +PRSFAQA+AKA  DS  +    +          
Sbjct: 122 -------------------TTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPK 162

Query: 178 XXXXXXITP---------------------LIKMFSAWSECQYKIDQGKAEMDALMAKEF 216
                   P                     L K F A S     ID GK EMD ++  EF
Sbjct: 163 NTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEF 222

Query: 217 NQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLS 276
           N+KL  L+E +FK  + LRR VE+SRLKFDTMRY+VKL E +++Q    E +  KE  + 
Sbjct: 223 NKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKE--IE 280

Query: 277 SKEEGADANET-SNEVGKSVTKTKEEQ--------ATNDAAQELLEKLEDEFVSNTTEAV 327
            KE      ET   E  +  TK  EE+           D   +LLE+LEDEFVSNT+ AV
Sbjct: 281 KKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAV 340

Query: 328 ETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372
           E M E+TDSA++L+LVKLF NFQLVY+RQCVQ++E +L T+++LE
Sbjct: 341 EKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  270 bits (690), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/370 (41%), Positives = 209/370 (56%), Gaps = 39/370 (10%)

Query: 36  QLDDPQAILSLKARKHYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFE 95
           Q +DP+  LS+KA+  +LQE +G   DISKLPPQY +LEKKCDS+EK  +R+L+VTKT+E
Sbjct: 23  QFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYE 82

Query: 96  VEGYDYPPNLSESLSDWWSS-----------NKEGLFGLMXXXXXXXXXXXXXXXXXXLM 144
           +EGYDYPPN+SESLS WW +           N     G +                    
Sbjct: 83  IEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG 142

Query: 145 PRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQG 204
           P SFA AIA+A KDS  +  +++                   L+K+F  WS+C Y+I   
Sbjct: 143 PPSFASAIARAGKDSQLIFESIETKDEDEKEDIDE-------LVKIFKIWSDCFYEISDS 195

Query: 205 KAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAME 264
           K EMD +M KEFN KL   +++ F+    LR KVE+SRL FDTMRYEV  T +Q+     
Sbjct: 196 KTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKEL 255

Query: 265 NEKAQFKESDLSS-------KEEGADANETSNEVGKSVT---KTKEEQATNDAAQ----- 309
             + + K S + +       KE   D  ET  +   + T   +TKE + T D+       
Sbjct: 256 GNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKEDS 315

Query: 310 ------ELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEA 363
                 +LLE+LEDEFVSNTTEAVE M E+++++ELL+L+KLF  FQL YH+ CV+ LE 
Sbjct: 316 KTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQ 375

Query: 364 SLSTLNELEG 373
           SL  LN ++ 
Sbjct: 376 SLKDLNAIDN 385

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  247 bits (630), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 226/432 (52%), Gaps = 82/432 (18%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIED-- 62
           F  F+F+K+T++++ AA   Q  ++  I      D Q  L  K    + QE +G I D  
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58

Query: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           ISKLP  Y  LE K D+LEK  +R+L+VTKT+E+EGYDYPPNLSESL+DWW S+      
Sbjct: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSD------ 112

Query: 123 LMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXX--------XXX 174
                                M  SF  AI+KAA DS  +L  LK               
Sbjct: 113 --------LKKSKKHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEE 164

Query: 175 XXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234
                       L+++F++ S C   ID+ KAEMDA++ KEFN KL  LI   FK  S L
Sbjct: 165 EVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKL 224

Query: 235 RRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQ----FKES---DLSSKEEGADANET 287
           R KV+DSRL+FDT+R+E+KL E  +++++  E +Q    FKE    ++  KEE     + 
Sbjct: 225 RTKVQDSRLEFDTLRHEIKLKEL-AQESIRQENSQKTDVFKEDSTKEVPPKEESTKEEQV 283

Query: 288 SNEVGKSVT-----------------KTKEEQA----TNDAAQE---------------- 310
           + E  K  T                 KT EEQA    T   A+E                
Sbjct: 284 NEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEAPKEDVKHNG 343

Query: 311 ----------LLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQD 360
                     LLEKLEDEFVSNT  AVE M E+T+++E++NLVKLF NFQL++++QCVQ+
Sbjct: 344 SSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQE 403

Query: 361 LEASLSTLNELE 372
           +E ++  L++LE
Sbjct: 404 IENNMKFLDQLE 415

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  222 bits (566), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 116/260 (44%), Positives = 150/260 (57%), Gaps = 24/260 (9%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64
           F  FS +K+T++L  AA KT DTLS AI      DP   LSL+++K   QE++GT+ DIS
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59

Query: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLM 124
            LP QY  LE + D+LEK  RR+L+V+KTFE+EGYDYPPNLSES SDWWS          
Sbjct: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWS---------- 109

Query: 125 XXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKD----------SGDVLAALKXXXXXXX 174
                              +PRSFAQAI+ +A+D            D             
Sbjct: 110 --LSSKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEEN 167

Query: 175 XXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234
                    +  LIK F +W++C   IDQGKAEMD++M KEFN KL  L+ E+FK    L
Sbjct: 168 EEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTL 227

Query: 235 RRKVEDSRLKFDTMRYEVKL 254
           R++V+DSRLKFDT+RYE+K+
Sbjct: 228 RKRVKDSRLKFDTVRYELKV 247

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 65/92 (70%), Gaps = 11/92 (11%)

Query: 292 GKSVTKTKEEQATNDAA-----------QELLEKLEDEFVSNTTEAVETMGEITDSAELL 340
            +S TK  EE+A+ D              +LLE+LED FVS+T  AVE M EITDS+E++
Sbjct: 352 AESATKVDEEKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEII 411

Query: 341 NLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372
            LVKLF NFQLVY+RQCVQ++EA+L TLNELE
Sbjct: 412 GLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  221 bits (563), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 160/292 (54%), Gaps = 40/292 (13%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64
           F  FS +K+T+++ NAA K  +TL+ AI      DPQ  LS+K++    QE LGTI DIS
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDIS 59

Query: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWW------SSNKE 118
           KLP QY+ LE K DSLEK+ +R+L+V+KTFE+EGYDYPPNL+ES SDWW      SS+++
Sbjct: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119

Query: 119 GLFGLMXXXXXXXXXXXXXX----------XXXXLMPRSFAQAIAKAAKDSGDVLAALKX 168
               +                              +PRSFAQAI+K+A D  D+   L  
Sbjct: 120 KQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSI 179

Query: 169 XXXXXXXXXXXXXXX----------------------ITPLIKMFSAWSECQYKIDQGKA 206
                                                I  LIK F +WS C   IDQGK+
Sbjct: 180 QETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKS 239

Query: 207 EMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQ 258
           EMD++M KEFN KL  LI  +FK  + LR+KV DSRLKFDT+R+E+K+ E++
Sbjct: 240 EMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEE 291

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 69/92 (75%), Gaps = 1/92 (1%)

Query: 282 ADANETS-NEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELL 340
           A  N+TS +++ K     K+++  +    +LLE+LEDEFVS+T  AVE M EIT+S+ ++
Sbjct: 380 AKVNDTSKDQLKKEDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSII 439

Query: 341 NLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372
            L+KLF NFQLVY+RQCVQ++EA+L TLNEL+
Sbjct: 440 GLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  172 bits (437), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 142/283 (50%), Gaps = 57/283 (20%)

Query: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI--ED 62
           F  FS +KLT T+TNAA   QDT+   I +    D Q  L       Y QE +GTI  ++
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58

Query: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSN-----K 117
           I+KLP  YQ L++K +++EK  +R+LVVTKTFE+EGYDYPPN++ESL+ WW+ +     K
Sbjct: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKK 118

Query: 118 EGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXX-- 175
              FG                    ++ RSFA AI KA  DS  +L+ LK          
Sbjct: 119 TQDFG-----------------DSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEE 161

Query: 176 ----------------------------XXXXXXXXITPLIKMFSAWSECQYKIDQGKAE 207
                                               +  +I  F  WS C   IDQ KAE
Sbjct: 162 KKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAE 221

Query: 208 MDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRY 250
           MD+++ KEFNQKL  ++E  FK    L  +V+DSRL+FDT+R+
Sbjct: 222 MDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 50/58 (86%)

Query: 317 DEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374
           DEFVSN T AVE M E+TDS+EL++LVKLF N QLV++RQCVQ+LEAS+ +L+ELE E
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/342 (25%), Positives = 141/342 (41%), Gaps = 59/342 (17%)

Query: 28  LSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRR 86
           LSTA++    D    + SL ++ +  +QE LG + DIS+LP  Y  LE K D ++     
Sbjct: 37  LSTAVSQKTQDFTTQLPSLAQSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYEN 96

Query: 87  MLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPR 146
            L VT+ +E E YDYP N+ +S++++ S     L  L                     P+
Sbjct: 97  FLKVTQVYENESYDYPNNVRDSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPK 156

Query: 147 SFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKA 206
           +   A++K A  S + L                     + L+K    +S+ Q KI Q + 
Sbjct: 157 TLNYALSKVALTSSEYL---------NKSPGAEDSEVSSSLLK----YSDVQAKIAQARL 203

Query: 207 EMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENE 266
             D L+  +FN+KL A + +    A   R+ VE+ RL++D  R             + N 
Sbjct: 204 HQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARAN-----------LANA 252

Query: 267 KAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEA 326
           + + KE+ L  +                                 +E LEDEF   T +A
Sbjct: 253 RPE-KEASLRVQ---------------------------------MESLEDEFAQATDDA 278

Query: 327 VETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTL 368
           V  M ++ +S+ELL  ++     Q  Y++Q  + L   L  L
Sbjct: 279 VVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEFLPQL 320

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 85.5 bits (210), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 145/348 (41%), Gaps = 63/348 (18%)

Query: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLP 67
           +FN  T++L     K Q+ LSTA++    +    + SL ++ +  +QE LG + DIS+LP
Sbjct: 3   TFNNFTNSLN---QKFQE-LSTAVSQRTQEISTNLPSLTQSTQRLVQERLGQVTDISQLP 58

Query: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXX 127
            +Y  LE+K D+++      L VT  +E E YDYP  ++ES++D+       +  L    
Sbjct: 59  REYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHAS 118

Query: 128 XXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPL 187
                            PR+   A++K +  S + L  +                  + L
Sbjct: 119 SASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLNHIGDHDEAQVA---------SVL 169

Query: 188 IKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDT 247
           +K    +S+ Q K+ Q + + D ++   FN++L   +E  FK A   R+ VE  RL++D 
Sbjct: 170 LK----YSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDV 225

Query: 248 MRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDA 307
            R                                            ++ + K E+  +  
Sbjct: 226 AR-------------------------------------------SNLAQAKPEKEASLR 242

Query: 308 AQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHR 355
            Q  +E LED+F   T +A   M E+  +A+    +K   N QL YH+
Sbjct: 243 VQ--METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQ 288

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 85.1 bits (209), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 130/272 (47%), Gaps = 26/272 (9%)

Query: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLP 67
           SFN  T++L+    K Q+ LSTA++    +   +I +L ++ +  +QE LG + DIS+LP
Sbjct: 2   SFNSFTNSLS---QKFQE-LSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTDISQLP 57

Query: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXX 127
            +Y  LE++ D+++      L +T  +E E YDYP  +S+S++D+       +  L    
Sbjct: 58  QEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKVTELSHAT 117

Query: 128 XXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPL 187
                            PR+   A++K A +S + LA L                   P+
Sbjct: 118 SAQEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQLADPNEG-------------PV 164

Query: 188 IKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDT 247
                 +S+ Q KI Q +   D L+  +FN++L   +E     AS  R+ V+  RL++D 
Sbjct: 165 ADALLKFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDV 224

Query: 248 MRYEVKLTEQQS-KQA-----MENEKAQFKES 273
            R   KLT+ +  K+A     ME+ + QF +S
Sbjct: 225 AR--SKLTQAKPEKEASLRVEMESLEEQFAQS 254

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 147/365 (40%), Gaps = 76/365 (20%)

Query: 8   FSFNKLTDTL--------TNAAHKTQDT--------LSTAIANIQLDDPQAILSL-KARK 50
            SFN   D+L        T+ + K Q+         LS A++    D   ++ SL ++ +
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 51  HYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLS 110
             +QE LG + DIS+LP +Y  LE + D +       L VT+ +E E YDYP N+ +S++
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 111 DWWSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXX 170
           ++  +    L  L                     P++   A++K A  S + L+      
Sbjct: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLS------ 174

Query: 171 XXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKN 230
                         T L+K    +S+ Q KI Q + + D L+  +FN+KL   +      
Sbjct: 175 ----KSGHEDETIATALLK----YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNK 226

Query: 231 ASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNE 290
           A   R++VE+ RL++D  R             + N K + KE+ L  +            
Sbjct: 227 AVKARKEVENKRLQYDIARAN-----------LANAKPE-KEASLRVQ------------ 262

Query: 291 VGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQ 350
                                +E LEDEF   T +A   M ++  S+E L  +    + Q
Sbjct: 263 ---------------------MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQ 301

Query: 351 LVYHR 355
           L Y++
Sbjct: 302 LAYYK 306

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 83.2 bits (204), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 88/367 (23%), Positives = 143/367 (38%), Gaps = 75/367 (20%)

Query: 8   FSFNKLTDTL--------TNAAHKTQDT--------LSTAIANIQLDDPQAILSL-KARK 50
            SFN   D++        +  + + QD         LS+A++    D    + S  ++ +
Sbjct: 1   MSFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQ 60

Query: 51  HYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLS 110
             +QE LG + DIS+LP +Y  LE K D +       L VT+ +E E YDYP N+ +S++
Sbjct: 61  RLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 111 DWWSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXX 170
           ++ S     L  L                     P++   A++K A  S + L       
Sbjct: 121 EFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALSKVALTSSEYL------- 173

Query: 171 XXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKN 230
                           L+K    +S+ Q K+ Q + + D L+   FN+KL  ++      
Sbjct: 174 --NKSVGGDDSEVSNALLK----YSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNE 227

Query: 231 ASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNE 290
           A   R+ VE  RL++D  R             + N K + KE+ L  +            
Sbjct: 228 AQKARKNVEHKRLQYDIARSN-----------LANAKPE-KEASLRVQ------------ 263

Query: 291 VGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQ 350
                                +E LEDEF   T +AV  M ++  S+ELL  ++     Q
Sbjct: 264 ---------------------MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQ 302

Query: 351 LVYHRQC 357
             YH+Q 
Sbjct: 303 ADYHKQS 309

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 81.6 bits (200), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 112/250 (44%), Gaps = 24/250 (9%)

Query: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDT-LSTAIANIQLDDPQAILSLKARKHYLQETLGT 59
           MS YF  FS  K+ +  T+ + K Q+  L     +++ + P   L   + +  LQE LG 
Sbjct: 1   MSQYFDSFS-KKVQELSTSVSQKAQEAQLDQKFKDLKTNLP---LLANSTQRMLQEKLGQ 56

Query: 60  IEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEG 119
           + DIS+LP +Y  LE + ++++      L VTK +E E YDYP N+ ES+ ++       
Sbjct: 57  VTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGK 116

Query: 120 LFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXX 179
           L  L                     P++   A++K A  S + +                
Sbjct: 117 LHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHVED-------------- 162

Query: 180 XXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVE 239
                  L    + +S+ Q KI Q + + D ++  +FN+ +   +E+  + ++  R+ VE
Sbjct: 163 -----ESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVE 217

Query: 240 DSRLKFDTMR 249
             RL++D +R
Sbjct: 218 QKRLQYDVVR 227

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 106/242 (43%), Gaps = 20/242 (8%)

Query: 8   FSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDISKLP 67
            SFN    +L+    K    LST+++    D P      ++ +  +QE LG + DIS+LP
Sbjct: 1   MSFNAFASSLS----KKLQELSTSVSERTQDLPNLA---QSTQRMVQERLGQVTDISQLP 53

Query: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXX 127
            +Y  LE K D+++      L VT  +E   YDYP  ++ES++++ SS    L  L    
Sbjct: 54  REYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLASKLTELTHAT 113

Query: 128 XXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPL 187
                            P++   A++K A +S + L  +                   PL
Sbjct: 114 SASQAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQ-------------PL 160

Query: 188 IKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDT 247
                 +S+ Q KI Q + + D L+  +FN+KL   +  +   A   R++V   RL++D 
Sbjct: 161 ASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDV 220

Query: 248 MR 249
            R
Sbjct: 221 AR 222

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/357 (23%), Positives = 134/357 (37%), Gaps = 58/357 (16%)

Query: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDISKLPP 68
           SFN    +L    +    ++S        D P      +  +  +QE LG + DIS+LP 
Sbjct: 3   SFNSFASSLNKTLYDFGSSVSQKTQEFSRDLPSLA---QTTQRLVQEKLGQVTDISQLPQ 59

Query: 69  QYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXXX 128
           +Y  LEK+ D+L+      L VT  +E E YDYP  + +S+++W  +    +  L     
Sbjct: 60  EYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVNEWSRTVATRVSELRHVSS 119

Query: 129 XXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPLI 188
                           P++   A++K A +   ++  L                  T L 
Sbjct: 120 AAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDNLDAPRTPRE----------TQLS 169

Query: 189 KMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTM 248
                +S  + ++ Q + E DA +  +FN+KL   +  +   A+  R++V   RL++D  
Sbjct: 170 SGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVA 229

Query: 249 RYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAA 308
           R  +                      L++K E     E S  V                 
Sbjct: 230 RTNL----------------------LNAKPE----KEASLRVQ---------------- 247

Query: 309 QELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASL 365
              +E LEDEF   T  A   M E+   A+LL  V+     Q  YH +    LE  L
Sbjct: 248 ---METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERSAAILEGFL 301

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 117/252 (46%), Gaps = 19/252 (7%)

Query: 3   SYFGGF--SFNK-LTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLG 58
           S F  F  SFNK L +  T  + KTQ+  ST + +I         SL ++ +  +QE LG
Sbjct: 2   STFNSFTNSFNKRLQELSTTVSQKTQE-FSTNMPDIN--------SLAQSTQRMVQERLG 52

Query: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118
            + DIS+LP +Y  LE+K D+++      L VT TFE + YDYP    ES+ ++  S   
Sbjct: 53  QVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKSAVS 112

Query: 119 GLFGLMXXXXXXXXXXXXXXXXXXLM-PRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXX 177
            +  L                   +  P++   A++KA+  S + L   K          
Sbjct: 113 KVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKASLISSEQLN--KQFSTDDDNNS 170

Query: 178 XXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRK 237
                 ++ ++  F   S+ Q KI Q + + D L+ ++FN  L   +   F+ A  +R+ 
Sbjct: 171 NSDFKLVSSILLKF---SDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKD 227

Query: 238 VEDSRLKFDTMR 249
           V++ RL++D  R
Sbjct: 228 VQNKRLQYDVAR 239

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/359 (22%), Positives = 138/359 (38%), Gaps = 65/359 (18%)

Query: 8   FSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDISKLP 67
            SF+K T+ L     +    LST ++    +  Q I        Y+QE LG   DIS++P
Sbjct: 1   MSFSKFTEGLNEKFQQ----LSTTVSGKAQEFSQGI---PVTHRYMQEKLGHATDISEMP 53

Query: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXX 127
            +Y  L  K D+++      L VT+ ++ E YDYP  ++ES++++  +    +  L    
Sbjct: 54  QEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINEFSRTVGSKIQELSHAS 113

Query: 128 XXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPL 187
                            P++   A+++ +  S + +  L                    L
Sbjct: 114 SAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECMEHLSTHDDAL-------------L 160

Query: 188 IKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDT 247
                 +S+ Q ++ Q +   D+L+   FN KL   I+   K A  +RR VE+ RL +D 
Sbjct: 161 ASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDA 220

Query: 248 MRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDA 307
                      S+  +E  K + KE+ L  +                             
Sbjct: 221 -----------SRTHLEKAKPE-KEAQLRVQ----------------------------- 239

Query: 308 AQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLS 366
               +E  E+EF   T  A+  M E+   A  + L++     Q  YH    Q ++A LS
Sbjct: 240 ----METAEEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETAAQRMQAFLS 294

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 114/247 (46%), Gaps = 26/247 (10%)

Query: 8   FSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYL-QETLGTIEDISKL 66
            SFN    +LT    K Q+ LST ++    D   +I S+ +    L QE LG + DIS+L
Sbjct: 1   MSFNDFASSLT---QKFQE-LSTVVSERTQDLGTSIPSIASSTQRLVQEKLGNVTDISQL 56

Query: 67  PPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXX 126
           P +Y  LEK+ D+++      L +T  ++ E YDYP  +S+S++D+    +  +  L   
Sbjct: 57  PQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKLFQSKIEDLSRA 116

Query: 127 XXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITP 186
                             PR+   A++K A  S + L  L+                ++ 
Sbjct: 117 TSAEEAQNILVTPGPITEPRTLNYALSKVALTSSESLNQLQ-------------DPNVSA 163

Query: 187 LIKMFSAWSECQYKIDQGKAEMDALMAKEFN----QKLNALIEEKFKNASVLRRKVEDSR 242
           +      +S+ Q KI Q + + D L+  + N    +KL++LIE+  K+    RR V+  R
Sbjct: 164 VASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKS----RRDVQYKR 219

Query: 243 LKFDTMR 249
           L++D  R
Sbjct: 220 LQYDVAR 226

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 112/246 (45%), Gaps = 25/246 (10%)

Query: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLP 67
           SFN+ T++ T    K    LST+++    +    + +L ++ +  +QE LG + DIS+LP
Sbjct: 3   SFNEFTNSFT----KRFQELSTSVSQRTQELSNNLPTLAQSTQRLVQEKLGQVTDISQLP 58

Query: 68  PQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXX 127
            +Y  LEKK DS++      L VT  +E E YDYP  + +S++D+  +    +  L    
Sbjct: 59  QEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMAAKITDLSHAS 118

Query: 128 XXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPL 187
                            P++   A++K +  + +V+  +                  TP 
Sbjct: 119 SASEAQNILISPGPIRDPKTLNYALSKVSLTASEVINQVGS----------------TPN 162

Query: 188 IKMFSA----WSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRL 243
               S+    +S  Q KI Q + + D L+  +FN+ L   +      A+  R++V++ RL
Sbjct: 163 ESALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRL 222

Query: 244 KFDTMR 249
           ++D  R
Sbjct: 223 QYDVAR 228

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 107/243 (44%), Gaps = 22/243 (9%)

Query: 8   FSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKL 66
            SFN    +L+    K    +ST+++    +  Q + SL ++ +  +QE LG + DIS+L
Sbjct: 1   MSFNAFASSLS----KKLQEISTSVS----EKTQELPSLAQSTQRMVQERLGQVTDISQL 52

Query: 67  PPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXX 126
           P +Y  LE+K D+++      L VT  +E   YDYP  ++ES++++  S    L  L   
Sbjct: 53  PREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA 112

Query: 127 XXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITP 186
                             P++   A++K A +S + L  +                   P
Sbjct: 113 TSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMLPTEEQ-------------P 159

Query: 187 LIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFD 246
           L      +S+ Q KI Q + + D L+  +FN+ L   +  +   A   R+ V   RL++D
Sbjct: 160 LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYD 219

Query: 247 TMR 249
             R
Sbjct: 220 VAR 222

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/364 (22%), Positives = 141/364 (38%), Gaps = 76/364 (20%)

Query: 9   SFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-----------------KARKH 51
           SFN   D+ +    +   T+       QLD     LSL                 +  + 
Sbjct: 2   SFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQR 61

Query: 52  YLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSD 111
            +QE LG + DIS++P +Y  LE++ D  +      L V++ +E E YDYP ++S+S++D
Sbjct: 62  RVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVND 121

Query: 112 WWSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXX 171
           +  +    +  L                     P++   A++K A  S + L+       
Sbjct: 122 FSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLS------- 174

Query: 172 XXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNA 231
                       +T  I +   +S+ Q KI Q + + D L+   FN++L   +  +F  A
Sbjct: 175 -----KSGSDDVVTADILL--KYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEA 227

Query: 232 SVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEV 291
              R++V+  RL++D  R                                  AN T+   
Sbjct: 228 MQSRKQVDQKRLQYDIAR----------------------------------ANFTAAR- 252

Query: 292 GKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQL 351
                   E+QA+    +  +E LED+F  +T +AV  M  + D  E L   +     QL
Sbjct: 253 -------PEKQAS---LRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQL 302

Query: 352 VYHR 355
            +H+
Sbjct: 303 GFHK 306

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 106/243 (43%), Gaps = 22/243 (9%)

Query: 8   FSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKL 66
            SFN    +L+    K    +ST+++    +  Q + SL ++ +  +QE LG + DIS+L
Sbjct: 1   MSFNAFASSLS----KKLQEISTSVS----EKTQELPSLAQSTQRMVQERLGQVTDISQL 52

Query: 67  PPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXX 126
           P +Y  LE K D+++      L VT  +E   YDYP  ++ES++++  S    L  L   
Sbjct: 53  PREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA 112

Query: 127 XXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITP 186
                             P++   A++K A +S + L  +                   P
Sbjct: 113 TSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQ-------------P 159

Query: 187 LIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFD 246
           L      +S+ Q KI Q + + D L+  +FN+ L   +  +   A   R+ V   RL++D
Sbjct: 160 LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYD 219

Query: 247 TMR 249
             R
Sbjct: 220 VAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 13/210 (6%)

Query: 53  LQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDW 112
           +QE LG + DIS+LP +Y  LE K D+++      L VT  +E   YDYP  ++ES++++
Sbjct: 39  VQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 113 WSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXX 172
             S    L  L                     P++   A++K + +S + L  +      
Sbjct: 99  SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSECLNKMFPAEEQ 158

Query: 173 XXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNAS 232
                        PL      +S+ Q KI Q + + D L+  +FN+KL   +  +   A 
Sbjct: 159 -------------PLASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKAD 205

Query: 233 VLRRKVEDSRLKFDTMRYEVKLTEQQSKQA 262
             R+ V   RL++D  R  +   ++  K+A
Sbjct: 206 KCRKDVHSMRLRYDVARTNLANNKKPEKEA 235

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 108/241 (44%), Gaps = 30/241 (12%)

Query: 10  FNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYL-QETLGTIEDISKLPP 68
           F  L+ T+T    KTQD  ST            + S+    H + QE LG I DIS++P 
Sbjct: 34  FKDLSMTVT---QKTQDLTST------------LPSIAQTTHRMVQEKLGQITDISQMPE 78

Query: 69  QYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMXXXX 128
           +Y  +EK+ D +       L VT+ +E E YDYP ++SES+++   +    +  L     
Sbjct: 79  EYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVNEISKTVTGKIQELTKATS 138

Query: 129 XXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXXXITPLI 188
                           P++   A++K +  S + L+                   +T  I
Sbjct: 139 TEEAQNILISPGPAKDPKTLNYALSKVSLTSSEYLS------------KSGSDSNVTADI 186

Query: 189 KMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTM 248
            +   +S+ Q +I Q + + D L+   FN++L   +  +F  A+  R++V++ RL++D  
Sbjct: 187 LL--KYSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIA 244

Query: 249 R 249
           R
Sbjct: 245 R 245

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/358 (22%), Positives = 139/358 (38%), Gaps = 71/358 (19%)

Query: 3   SYFGGFSFNKLTDTL---TNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGT 59
           S F  F+ N L + L   +N   +    LST I  +           ++ +  +QE LG 
Sbjct: 2   SNFNSFA-NSLRENLQSFSNTVSQKTHELSTNIPTL----------AQSTQRMVQEKLGQ 50

Query: 60  IEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEG 119
           + DIS+LP +Y  LE K D+++      L VT  +E E YDYP  +SES++++  +    
Sbjct: 51  VTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAK 110

Query: 120 LFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXX 179
           +  L                     P++   A++K A ++ + L                
Sbjct: 111 VQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYL------------NHSF 158

Query: 180 XXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVE 239
                  L K+   +S+ Q K+ Q + + D  +  +FN+ +   + E    A+  R+ V+
Sbjct: 159 DDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQ 218

Query: 240 DSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTK 299
             RL++D  R             ++N K + KE+ L  +                     
Sbjct: 219 SKRLQYDVARTN-----------LQNAKPE-KEAGLRVQ--------------------- 245

Query: 300 EEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQC 357
                       +E LED+F   T +A   M E+  SA  L  +K     QL Y+ Q 
Sbjct: 246 ------------METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 111/251 (44%), Gaps = 27/251 (10%)

Query: 3   SYFGGF--SFNK-LTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGT 59
           S F  F  SF+K L++  +  + KTQ+ LST + N+           ++ +  +QE LG 
Sbjct: 2   SSFNSFTNSFSKTLSELSSTVSQKTQE-LSTNLPNLA----------QSTQRMVQERLGQ 50

Query: 60  IEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEG 119
           + DIS+LP +Y  LE K DS+++     L V+  +E + YDYP    ESL ++  +    
Sbjct: 51  VTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASK 110

Query: 120 LFGLMXXXXXXXXXXXXXXXXXXLM-PRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXX 178
           +  L                   +  P++   A++K A  S + L               
Sbjct: 111 VEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSA-- 168

Query: 179 XXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKV 238
                 + L+     +S  Q KI Q + + D L+ ++FN  L   +      A+ +R++V
Sbjct: 169 ------SALLN----FSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEV 218

Query: 239 EDSRLKFDTMR 249
           +  RL++D  R
Sbjct: 219 QSKRLQYDIAR 229

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 101/241 (41%), Gaps = 38/241 (15%)

Query: 53  LQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDW 112
           +QE  G + DIS LP +Y  LE++ DS++      L +T  +E E YDYP ++ +S++++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 113 WSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLM----------------PRSFAQAIAKAA 156
             +    +  L                   +                 PR+   A++KAA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 157 KDSGDVLAALKXXXXXXXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEF 216
             + + L   K                      +F ++SE +  I   + + D ++ K F
Sbjct: 121 LFAAEQLKMDKDSST------------------VFHSFSEAESIISDERIKQDKIIQKSF 162

Query: 217 NQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLT----EQQSKQAMENEKAQFKE 272
           N +L  ++  +   A+  R+ V++ RL++D  R ++       E   + AME  K  F++
Sbjct: 163 NTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKLDHASEDKESSLRVAMEQHKQAFEQ 222

Query: 273 S 273
           S
Sbjct: 223 S 223

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 114/309 (36%), Gaps = 68/309 (22%)

Query: 53  LQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDW 112
           ++E LG ++DIS LP +Y  LE K D+ +      L +T  +E E YDYP   SES++++
Sbjct: 39  VKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF 98

Query: 113 WSSNKEGLFGLMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXX 172
             S    ++                       PR+   A++K +  + +    L      
Sbjct: 99  TDSIGNKMYEFSNGVSTEGSSGK--------TPRTLNYAVSKVSMGASEQFQKLHDTDDK 150

Query: 173 XXXXXXXXXXXITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNAS 232
                         +  + +     +  I + +   D  +  +FN +L   I +  + AS
Sbjct: 151 R-------------IANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERAS 197

Query: 233 VLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVG 292
             R++V   RLK+D  R      E+ SK    +EK                         
Sbjct: 198 KYRKEVYHKRLKYDIAR------EKYSK----HEK------------------------- 222

Query: 293 KSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLV 352
                       N   +  LE LEDEF   T +A+  M EI  +      +K F   +L 
Sbjct: 223 ------------NGTVKVELEILEDEFNHATKDAIMVMQEIISNNRFEQNLKDFAAAKLA 270

Query: 353 YHRQCVQDL 361
           YH + V  L
Sbjct: 271 YHEKSVDAL 279

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 132/368 (35%), Gaps = 84/368 (22%)

Query: 5   FGGFS--FNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIED 62
           F  FS  FNK    L+    +   T+     N Q                ++E LG  +D
Sbjct: 3   FNSFSSSFNKKFQELSEKTQEMTSTIPHVAQNTQ--------------RLMKEKLGQAKD 48

Query: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFG 122
           IS LP +Y  LE K D++++     L VT  +E E YDYP    ES  ++  S  E    
Sbjct: 49  ISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFWEFTDSVGEKFSA 108

Query: 123 LMXXXXXXXXXXXXXXXXXXLMPRSFAQAIAKAAKDSGDVLAALKXXXXXXXXXXXXXXX 182
           L                    +P++   A+      + + +  L                
Sbjct: 109 LNISEHNNKVK----------IPKTLNYALHNVFLTANEKVKLLHEPLD----------- 147

Query: 183 XITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSR 242
               L +  ++ SE +  I + +   D+L+    N +L   + + F+ A+  R+ V   R
Sbjct: 148 --NSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKYRKAVHHKR 205

Query: 243 LKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQ 302
             +D            +K   E+ K                                E+Q
Sbjct: 206 FNYDV-----------AKTNFEHAKP-------------------------------EKQ 223

Query: 303 ATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLE 362
           AT  A  ++   L+DEF   T +A   M EI  ++ L +++K     QLVYH++    L 
Sbjct: 224 ATLSAQADI---LKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRSTDLLN 280

Query: 363 ASLSTLNE 370
             L   N+
Sbjct: 281 KFLDAQND 288

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 58/113 (51%), Gaps = 19/113 (16%)

Query: 8   FSFNKLTDTLTNA--------AHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGT 59
            SFN L  ++  A        + KTQ+  ST  A  Q+           ++   QE LG 
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYAQV-----------QQRLAQEKLGQ 49

Query: 60  IEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDW 112
           I DIS++P +Y  LE + D+L+ + + +L VT+ +E   YD+P +  ES+ DW
Sbjct: 50  ITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDW 102

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 70/183 (38%), Gaps = 45/183 (24%)

Query: 193 AWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEV 252
           A+S+ Q K+ Q +   D  +  +FN++L  ++      A+  R+ V+  R+ +D  R   
Sbjct: 172 AYSDTQAKLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIARTN- 230

Query: 253 KLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQELL 312
                     ++N + + KE+ L  +                                 +
Sbjct: 231 ----------LQNARPE-KEASLRVE---------------------------------M 246

Query: 313 EKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372
           E LED+F   T EA   M E   +  LL  V      Q  Y++Q ++ +   +   N  +
Sbjct: 247 ETLEDQFAQITEEATIVMQETLSNTHLLKNVAELAEIQKNYYKQSLELMNDLMPVFNTAK 306

Query: 373 GED 375
           G+D
Sbjct: 307 GDD 309

>Kwal_33.14110 s33 complement(531600..532964) [1365 bp, 454 aa] {ON}
           YJL123C - Hypothetical ORF [contig 105] FULL
          Length = 454

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSE---SLSDWWSSN 116
           + K  P  Q+ EKK  S  KA       ++T  VE    PP LS+   SLS+WWSS+
Sbjct: 97  VQKAAPAAQVPEKKSSSPAKAA------SETPSVEASAEPP-LSDPITSLSNWWSSS 146

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 20   AAHKTQDTLSTAIANIQLDDPQA----ILSLK-------ARKHYLQETLGTIEDISKLPP 68
            A HK     S  IA + L DPQ      L+LK        +  Y +E L  I D+ ++P 
Sbjct: 1432 AHHKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQIPE 1491

Query: 69   QYQ 71
            QYQ
Sbjct: 1492 QYQ 1494

>KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1486

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 15/79 (18%)

Query: 281  GADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELL 340
            G+ AN+  NEV ++  + K       A QE LE +E E      +     GE   S    
Sbjct: 1103 GSHANQDYNEVWRNSEEYK-------AVQEELEWMERELPKKPMDNSAEQGEFASS---- 1151

Query: 341  NLVKLFHNFQLVYHRQCVQ 359
                LF+ + LV HR C Q
Sbjct: 1152 ----LFYQYYLVTHRLCQQ 1166

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 7/86 (8%)

Query: 17   LTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDISKLPPQYQLLEKK 76
            LT  A+   +  S+ + +I+ D+ + +LSL++ +  LQE L   E       + +LL ++
Sbjct: 1137 LTTQANDEDNAESSGVNSIEGDN-KLVLSLRSERDLLQERLNVTE------AEEKLLRER 1189

Query: 77   CDSLEKACRRMLVVTKTFEVEGYDYP 102
              S+EK  R   +  +  + E ++YP
Sbjct: 1190 LTSIEKDFRATDLELQKIKEETHNYP 1215

>Skud_12.343 Chr12 (611224..613746) [2523 bp, 840 aa] {ON} YLR263W
           (REAL)
          Length = 840

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 282 ADANETSNEVGKSVTKTKEEQAT------NDAAQELLEKLEDEFVSNTTEAVETMGEITD 335
           +  N  SNE+ + ++   +E  T      ++  Q+L  +L+D F ++T E ++ MGEI D
Sbjct: 758 SSINHFSNELVRKISIINQELNTKILKELSEKYQKLFSELQDSFQNDTNEMLKFMGEIKD 817

Query: 336 SAEL 339
              L
Sbjct: 818 MINL 821

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,952,644
Number of extensions: 1334079
Number of successful extensions: 11321
Number of sequences better than 10.0: 684
Number of HSP's gapped: 11039
Number of HSP's successfully gapped: 842
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)