Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212263.490ON19619610091e-141
KLTH0F14784g3.490ON1951935832e-76
SAKL0F02816g3.490ON1921963522e-41
Ecym_12393.490ON1931933486e-41
ZYRO0D10032g3.490ON2092022951e-32
TDEL0D055803.490ON1931982801e-30
AFR308W3.490ON1921852671e-28
NCAS0E008203.490ON2021982574e-27
Kpol_480.153.490ON2072052532e-26
YGR129W (SYF2)3.490ON2152252435e-25
KLLA0E04643g3.490ON2211922402e-24
Suva_7.4173.490ON2122202304e-23
Skud_7.4403.490ON2132102244e-22
CAGL0I10538g3.490ON2001942052e-19
Smik_6.2253.490ON2132182001e-18
NDAI0G009503.490ON2132051964e-18
TBLA0C044703.490ON2222181931e-17
TPHA0D042403.490ON2092101842e-16
KAFR0C019503.490ON1571911332e-09
KNAG0B008203.490ON2072011142e-06
Ecym_60185.187ON18654710.62
CAGL0M07898g5.123ON825128711.0
KLTH0F16324g5.422ON683112691.7
Skud_12.3894.49ON18763662.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21226
         (196 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   393   e-141
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   229   2e-76
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   140   2e-41
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   138   6e-41
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   118   1e-32
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   112   1e-30
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...   107   1e-28
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   103   4e-27
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...   102   2e-26
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    98   5e-25
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    97   2e-24
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    93   4e-23
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    91   4e-22
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    84   2e-19
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    82   1e-18
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    80   4e-18
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    79   1e-17
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    75   2e-16
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    56   2e-09
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    49   2e-06
Ecym_6018 Chr6 complement(34640..35178,35238..35259) [561 bp, 18...    32   0.62 
CAGL0M07898g Chr13 (786678..789155) [2478 bp, 825 aa] {ON} simil...    32   1.0  
KLTH0F16324g Chr6 (1325151..1327202) [2052 bp, 683 aa] {ON} simi...    31   1.7  
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    30   2.8  

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  393 bits (1009), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/196 (100%), Positives = 196/196 (100%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 61  EANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNT 120
           EANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNT
Sbjct: 61  EANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNT 120

Query: 121 KYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ 180
           KYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ
Sbjct: 121 KYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ 180

Query: 181 FNDKLERQTKKRETED 196
           FNDKLERQTKKRETED
Sbjct: 181 FNDKLERQTKKRETED 196

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  229 bits (583), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 145/193 (75%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           MDL+KYADRLKNLKRK + LSVKNK ++++EEK  SA  KPAVYSM  E A      + +
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 61  EANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNT 120
           +  KLL+YSM ++EQWQDK ++ S +    A +QDLAK TYDKEVQQL K   N+V K  
Sbjct: 61  KEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120

Query: 121 KYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ 180
           K  +N KGKIVV+DD  LV  L ++LNKTA+ERYARI+KKI RQM + T GG+INEKNKQ
Sbjct: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180

Query: 181 FNDKLERQTKKRE 193
           FNDK+ERQTKKRE
Sbjct: 181 FNDKIERQTKKRE 193

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  140 bits (352), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 125/196 (63%), Gaps = 15/196 (7%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           MDL+    +LK LKRK +D+SVKN+ E  +EEK    S KP VYSMN    E+E  KD  
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMN----EDETFKDQK 56

Query: 61  EAN---KLLKYSMLEYEQWQDKVK---KNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGN 114
           E +   KLL YS+ +YE+WQ K     KNS     G+S QDLAK TYDKE++++ K    
Sbjct: 57  EEDTRGKLLNYSIKDYEKWQLKRTAKLKNSD----GSSQQDLAKYTYDKEIREMEKDGSL 112

Query: 115 RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYI 174
              K TK R+N KG+I + DD++ +  L + LNK+   RY   +KK   +++++T+GG+I
Sbjct: 113 NRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIE-RKKQAEKLDSSTTGGFI 171

Query: 175 NEKNKQFNDKLERQTK 190
           N+KNKQFN+KL RQ K
Sbjct: 172 NDKNKQFNEKLSRQFK 187

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  138 bits (348), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/193 (41%), Positives = 122/193 (63%), Gaps = 7/193 (3%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAE--EEIAKD 58
           MD+   + RL+ LK KR+D+S+KN+ E++ EE +     KP VYS+N EGA   E  +  
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 59  VTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNK 118
            TE  KLL YS+++YE+W +K K+ +     G    D+A STY  E++QL K  G    K
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKEKQANF---DGTYSGDIAYSTYKNEIKQLRK-GGLTKGK 116

Query: 119 NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKI-GRQMNNTTSGGYINEK 177
            TK R++  GK+ +ED+++LV  L +TL KT+ ER+ R +K++ G + N +  G ++NEK
Sbjct: 117 ITKGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEK 176

Query: 178 NKQFNDKLERQTK 190
           N+ FN+KL RQ K
Sbjct: 177 NRHFNEKLSRQFK 189

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 121/202 (59%), Gaps = 22/202 (10%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIA-KDV 59
           MDL ++      LK+K  ++SV+N+  V  E K ++A RKP VY +  E  E  +  +D 
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL--EAPEPSLPTQDD 68

Query: 60  TEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSK--------I 111
              N+L+ Y++ +YE+W  + +  +++ + G + QD+AK TYDKE+ +L K         
Sbjct: 69  KHGNQLMNYTIQQYEEWNSRQRDQTNKRDSG-NLQDMAKYTYDKELNKLHKDTMLQNRYT 127

Query: 112 DGN---RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQ--MN 166
           +G    ++N+N K      GK+ ++DD QLV  L + ++KTA ERY   ++++ R    N
Sbjct: 128 NGGSIQKMNRNPK-----TGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQN 182

Query: 167 NTTSGGYINEKNKQFNDKLERQ 188
            ++ GGYINEKNKQFN+KL+RQ
Sbjct: 183 ASSGGGYINEKNKQFNEKLDRQ 204

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  112 bits (280), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 117/198 (59%), Gaps = 11/198 (5%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           MDL    +R K+LK++ +D++++ +    RE K  S   KP +YSM  E   E   + V 
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSM--EDTNEMGTRPVD 58

Query: 61  EAN----KLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRV 116
            +     KL+ YSM EYE+W DK +K      GGA+ Q+LAK +Y+K++ +  + +GNRV
Sbjct: 59  SSERRRLKLMNYSMREYEEW-DKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRV 117

Query: 117 NK-NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYIN 175
            K +T  + N   ++ V+DD++LV  L   L KT  ER+   +K + +     T GGYIN
Sbjct: 118 VKISTDAKTN---RLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYIN 174

Query: 176 EKNKQFNDKLERQTKKRE 193
           EKNKQFN KL+RQ K+ E
Sbjct: 175 EKNKQFNLKLDRQMKETE 192

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score =  107 bits (267), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 111/185 (60%), Gaps = 4/185 (2%)

Query: 9   RLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDV-TEANKLLK 67
           RL+ LK+KR+D S++N+ E   EE+   A  KP VYSM  E A+E  A D  +E  KLL 
Sbjct: 9   RLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQSEQLKLLN 68

Query: 68  YSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNTKYRVNNK 127
           Y + +YE+W +K K++    + GA   +LA STY  E+ QL +  G    + T  R++  
Sbjct: 69  YRIADYEKWDEKQKRHKQPSD-GADLGELANSTYRSELHQLHR-RGVVKGRATNGRISAS 126

Query: 128 GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQFNDKLER 187
           GK+V++D+ +LV  L   + +TA  R+   QKK  +     T+G  +N+KN+ FN+KL+R
Sbjct: 127 GKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LNDKNRHFNEKLDR 185

Query: 188 QTKKR 192
           + +KR
Sbjct: 186 EFRKR 190

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  103 bits (257), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 123/198 (62%), Gaps = 11/198 (5%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSM-----NAEGAEEEI 55
           +DL  Y+ +LK LKRK  D +++N+  V RE K + +S KP VY+M     N    +EE 
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 56  AKDVTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKI--DG 113
           A D  +  KL+ Y++ +YE+W+ K +K+    +  +  + LA  +YDK V  L++   D 
Sbjct: 62  ADD--KVAKLMNYTLRQYEEWE-KKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDK 118

Query: 114 NRVNKNTKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172
               +  + +VN+K GK+ ++D+++LV  L + L KTA++RY   +KK+  +  ++++ G
Sbjct: 119 TTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG 178

Query: 173 YINEKNKQFNDKLERQTK 190
           YINE+NK FN+KL+R+++
Sbjct: 179 YINERNKHFNEKLDRESR 196

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score =  102 bits (253), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 117/205 (57%), Gaps = 20/205 (9%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKD-- 58
           M++ +  +  K LKRK +D+ ++N+  +    + +  + KP  YSM      EE+A+D  
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSM------EELAEDDT 56

Query: 59  -----VTEANKLLKYSMLEYEQW---QDKVKKNSHRLEGGA-SFQDLAKSTYDKEVQQLS 109
                V EA++LL YS+ EYE+W   Q + K+N H  +    S   +AK TYDK++++L 
Sbjct: 57  VNTGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQ 116

Query: 110 KIDGNRVNKN--TKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMN 166
           K      N+   +K R + K GKIVV D +QL+  L E LN+T  ERY R  +K  +  +
Sbjct: 117 KQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSD 176

Query: 167 NTTSGGYINEKNKQFNDKLERQTKK 191
              +  YINEKNK+FNDKLERQ  K
Sbjct: 177 QNENYSYINEKNKEFNDKLERQETK 201

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 98.2 bits (243), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 118/225 (52%), Gaps = 42/225 (18%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSM-NAEGAEEEIA-KD 58
           MD  K  ++LK LKRKR+D+S+K++    RE + VSA+RKP VYSM +   A+E +   +
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 59  VTEANKLLKYSMLEYEQWQDKVK--KNSHRLEGGASFQDLAKSTYDKEVQQL-------S 109
             E  K   Y++ EY+ W+ +    K      GG S+  LAK +Y+K ++ L       S
Sbjct: 61  SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120

Query: 110 KIDGN----------------RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADER 153
           K D +                +V K+TK      GKI + DD +LV  L  +L   + +R
Sbjct: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTK-----TGKITIADDDKLVNKLAVSLQSESKKR 175

Query: 154 Y-ARIQKKIGRQMNN--TTSG--GYINEKNKQFNDKLERQTKKRE 193
           Y AR      RQM N  T  G   +IN+KNKQFN+KL R++K  E
Sbjct: 176 YEAR-----KRQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE 215

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 111/192 (57%), Gaps = 11/192 (5%)

Query: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVTE 61
           DL +   +LK+L+++++++S++NK  +I EEK  S  R   VYSM A+  E++   + +E
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSERR---VYSM-ADDGEDKARSNKSE 93

Query: 62  AN---KLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNK 118
                KL  YS+ EYE+W+ K + + H       FQ +AK++Y KEV  L K     ++ 
Sbjct: 94  PEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPK----DISH 149

Query: 119 NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKN 178
             K  +   GK+ VED+ +LV  +V  LN+ + +RY   ++K+ +Q       G+IN+KN
Sbjct: 150 PLKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKN 209

Query: 179 KQFNDKLERQTK 190
           K+FN KL  + K
Sbjct: 210 KRFNAKLNSEFK 221

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 93.2 bits (230), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 121/220 (55%), Gaps = 35/220 (15%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDV- 59
           MDL +  ++LK LKR+R+D S+K +    RE +  S++RKP VYSM  + +++E+ ++  
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSM-EDASDDELVRETK 59

Query: 60  -TEANKLLKYSMLEYEQWQDKVK-KNSHRLEG-GASFQDLAKSTYDKEVQQLS------- 109
             + ++   Y++ EY  W+ K K + S + +G G S+  LAK +YDK ++ L+       
Sbjct: 60  SDDKDRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKH 119

Query: 110 -----------KIDGNRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERY-ARI 157
                       +  +R+ K  K  +   GKI + DD +LV  L  TL   + +R+ AR 
Sbjct: 120 ESSVNEKDSKGSLGKSRIEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDAR- 176

Query: 158 QKKIGRQMNN--TTSG--GYINEKNKQFNDKLERQTKKRE 193
                RQM N  T SG   +IN+KNKQFN+KL R+++  E
Sbjct: 177 ----KRQMENVKTPSGVESFINDKNKQFNEKLGRESRGSE 212

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 90.9 bits (224), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 112/210 (53%), Gaps = 20/210 (9%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMN--AEGAEEEIAKD 58
           M+L K   +LK LKRK +++S+KN+    RE +    +RKP VYSM    +GAE     +
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 59  VTEANKLLKYSMLEYEQWQDKV--KKNSHRLEGGASFQDLAKSTYDKEVQQL----SKID 112
            ++ +K   Y++ EY  W+ K   +KN      G S+  +AK +Y+K ++ L    S  +
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKN 120

Query: 113 GNRVNKN-----------TKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKK 160
            N VNKN            K + N K GKI + DD +LV  L  TL   + +RY   +K+
Sbjct: 121 ENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQ 180

Query: 161 IGRQMNNTTSGGYINEKNKQFNDKLERQTK 190
           +      ++   +IN+KNKQFN+KL R+ K
Sbjct: 181 MENAKTPSSVESFINDKNKQFNEKLSREPK 210

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 83.6 bits (205), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 107/194 (55%), Gaps = 9/194 (4%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           M+L  Y ++LK LK+   D+ ++N+N + +E +      KP VYSM+ +  + +  +   
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 61  EAN----KLLKYSMLEYEQWQDKVKKNSHRLEG---GASFQDLAKSTYDKEVQQLSKIDG 113
           E +     L +Y++ ++  W+ + ++          G   Q LAK+TYDKE+Q L + + 
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 114 NRVNKNTKYRVN-NKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172
               K T++R+N + GK+ ++D+++LV  L + L +TA +RY    +KI     +T+  G
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDS-NRKIANDKEHTSLSG 179

Query: 173 YINEKNKQFNDKLE 186
            IN KN QFN  L+
Sbjct: 180 SINAKNLQFNKSLD 193

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 81.6 bits (200), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 113/218 (51%), Gaps = 30/218 (13%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSM-NAEGAEEEIA-KD 58
           M+L +   RLK LK+KR+++S+KN+    RE +  + +RKP VY+M +    +E +   +
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 59  VTEANKLLKYSMLEYEQWQDKV--KKNSHRLEGGASFQDLAKSTYDKEV-----QQLSKI 111
            ++ ++   Y+  EY  W+ +   +K       G S+  LAK +Y+K +     Q LS+ 
Sbjct: 61  SSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEY 120

Query: 112 DG----------------NRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYA 155
           D                 +R+ K+TK      GKI + DD +LV  L  +L   + +RY 
Sbjct: 121 DNFVNEKDHKNISKISRIDRIQKDTK-----TGKIRIADDHKLVNKLAVSLESESKKRYE 175

Query: 156 RIQKKIGRQMNNTTSGGYINEKNKQFNDKLERQTKKRE 193
             ++++   +  +    +IN+KNKQFN+KL R+++  E
Sbjct: 176 ARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 213

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 80.1 bits (196), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 115/205 (56%), Gaps = 13/205 (6%)

Query: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNA-----------EG 50
           +L  Y + LK LKR  +D+  +N+    +E K  S S KP VY + A           +G
Sbjct: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64

Query: 51  AEEEIAKDVTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQL-S 109
             +   ++     KL+ Y++ EYE+W  + K    +   G+   +LA  TY+KE+ +L S
Sbjct: 65  LGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNS 124

Query: 110 KIDGNRVNKNTKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNT 168
           K++     +  +  VN + GK+ V+D+++L+  LV  LN+TA +RY   +KK+  + ++ 
Sbjct: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSD 184

Query: 169 TSGGYINEKNKQFNDKLERQTKKRE 193
            +G Y  +KNKQFN+KLER+ K+R+
Sbjct: 185 IAGNYFKDKNKQFNEKLERELKERD 209

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 79.0 bits (193), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 116/218 (53%), Gaps = 34/218 (15%)

Query: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIA----- 56
           D+++     K LK K  +  + N++ +       + + KP VYSM  E  ++E+      
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 57  --KDVTE---ANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQD--------LAKSTYDK 103
             K+ +E    +KL+ Y++ EY+ W+  +K+N +  E   + +D        LAK TYDK
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWE--LKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120

Query: 104 EVQQLSKI-----DGNRVNKNTKYRVNNKG---KIVVEDDQQLVTGLVETLNKTADERYA 155
           ++++L+K       GN+ NK  K   N++    KIV++DD+ LV  LV  L   +D    
Sbjct: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSD---- 176

Query: 156 RIQKKIGRQMNN--TTSGGYINEKNKQFNDKLERQTKK 191
           R+ K +G +  N  TT  G++N KN++FN+KL R+ KK
Sbjct: 177 RLYKHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKK 214

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 75.5 bits (184), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 107/210 (50%), Gaps = 26/210 (12%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60
           MD+    D  K LK++ +D  ++++  +  +EK   +  KP VYS+N +   +  A D  
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 61  EAN----KLLKYSMLEYEQWQDKVKKN----SHRLEGGASFQDLAKSTYDKEVQQLSKID 112
             N     LL Y++ +YE+W++ +K+     ++     +S Q  AK TYDKE+ ++ K  
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 113 GNRVNKNTKYR------VNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMN 166
           G         R      V + GK++++DD+ LV G +  +NK +++RY  I++     +N
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRY--IKRMKLNAVN 178

Query: 167 NTTSG----------GYINEKNKQFNDKLE 186
           N  +G           Y N KNK FNDKLE
Sbjct: 179 NDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 92/191 (48%), Gaps = 45/191 (23%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIA---K 57
           MD++   +  ++L++K  ++ ++N+       K++S + KP  YS+  E    E++   +
Sbjct: 3   MDMANLREEFRDLRKKCREIKIENR-------KLISIASKPKTYSIREEEIGAEVSDEDE 55

Query: 58  DVTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVN 117
           D +E  KLL   + E+E         +H  E     +D+ + TY+KEV  L    G R  
Sbjct: 56  DDSEIIKLLTKPLREFET-------EAHVAENK---EDIDRLTYNKEVMSL----GKREK 101

Query: 118 KNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEK 177
           ++                   V  LV  +N+ +DERY +  +K  R+    T  G+INE+
Sbjct: 102 RD-------------------VESLVSEMNRISDERYKKGAQK--RRRLKDTERGFINEQ 140

Query: 178 NKQFNDKLERQ 188
           NK FN +LE++
Sbjct: 141 NKAFNLRLEKE 151

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 94/201 (46%), Gaps = 47/201 (23%)

Query: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNA--------EGAE 52
           M L++  D+ K L ++   L V+     IR+++  +   KP VYS+ A        +GAE
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVR-----IRKQQ--AEVEKPKVYSLQAAEPSVDGIDGAE 87

Query: 53  EEIAKDVTEANKLLKYSMLEYEQWQDKVKKNS----HRLEGGASFQDLAKSTYDKEVQQL 108
             +  +VT   KLL   + + E  + +  +N      R+EG      +AK TY KE+  L
Sbjct: 88  --VVDNVTV--KLLNTPLRQLEAREARRGENGDDAVARVEG----DRVAKDTYKKELALL 139

Query: 109 SKIDGNRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNT 168
               G +  + T YR N             V  LV  LN  + +RY   + K+ RQ    
Sbjct: 140 ----GRKSTRGT-YRDN-------------VERLVTHLNDVSKKRYLVRKNKMKRQGARG 181

Query: 169 TSG--GYINEKNKQFNDKLER 187
            S   GYINEKNKQFN KL+R
Sbjct: 182 GSSLDGYINEKNKQFNKKLQR 202

>Ecym_6018 Chr6 complement(34640..35178,35238..35259) [561 bp, 186
           aa] {ON} similar to Ashbya gossypii AAL143W
          Length = 186

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 127 KGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQ 180
           +G +V+E + + +   V+ LNKT+D+   R  +  G  ++  T GG+IN  + Q
Sbjct: 134 QGGMVIETNVRKIVEAVDELNKTSDQD-NRFSRNFGNAIHAFTQGGFINWGSHQ 186

>CAGL0M07898g Chr13 (786678..789155) [2478 bp, 825 aa] {ON} similar
           to uniprot|P46675 Saccharomyces cerevisiae YLR045c STU2
           suppressor of a cs tubulin mutation
          Length = 825

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 30/128 (23%)

Query: 68  YSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNTKYRVNNK 127
           +S +E ++W+D       R E    F       YD  + +L KIDGN  N+N     +  
Sbjct: 320 HSRVESQKWKD-------RAEALEEF-------YDHALSKLKKIDGN-ANENYTNLFSMY 364

Query: 128 GKIVVED-DQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQFNDKLE 186
           G I+ +D + Q+VT   E+++K     +A  ++K+ + +               FN  LE
Sbjct: 365 GHIISKDINVQVVTIAAESIDKIC---HALPKQKLTKHLIQLV-----------FNPLLE 410

Query: 187 RQTKKRET 194
           R  +K+ T
Sbjct: 411 RTKEKKPT 418

>KLTH0F16324g Chr6 (1325151..1327202) [2052 bp, 683 aa] {ON} similar
           to uniprot|Q06339 YDR362C Saccharomyces cerevisiae TFC6
           one of six subunits of RNA polymerase III transcription
           initiation factor complex (TFIIIC)
          Length = 683

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 34  MVSASRKPAVYSMNAEGAE--EEIAKDVTEA--NKLLKYSMLEYEQWQDKVKKNSHRLEG 89
           + ++ R P + S +A+GA     +A+       N    Y  L+  QW   +K++ +RL+ 
Sbjct: 565 LAASKRHPYLLSGSADGALMINNMARRFLTGIKNNTTVYKYLKLWQWDYSLKEDKYRLDP 624

Query: 90  -----GASFQDLAKSTYDKEVQQLSKIDGNRVNKNTKY--RVNNKGKIVVED 134
                  S  +++K+  D     +S +  N   K  K+   VNN G +VVE+
Sbjct: 625 NYEVYNFSVNEVSKAKVDPHGINISSVKWNETTKFGKFFAFVNNAGMMVVEE 676

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 11/63 (17%)

Query: 134 DDQQLVTGLV---------ETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQFNDK 184
           D Q ++TGL+         + LNK A + + + +KK    + +T SGG +N+   Q++D 
Sbjct: 127 DLQSIITGLLFLFLEPNPNDPLNKDAAKLFCQNEKKFAEIVRSTMSGGSVNQ--VQYDDV 184

Query: 185 LER 187
             R
Sbjct: 185 ASR 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.327 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,316,255
Number of extensions: 1011520
Number of successful extensions: 4751
Number of sequences better than 10.0: 289
Number of HSP's gapped: 4680
Number of HSP's successfully gapped: 297
Length of query: 196
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 92
Effective length of database: 41,556,135
Effective search space: 3823164420
Effective search space used: 3823164420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)