Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212223.489ON37337319480.0
KLTH0F14762g3.489ON65037314140.0
SAKL0F02838g3.489ON65437611611e-154
Kpol_480.163.489ON6553799951e-129
NCAS0E008303.489ON6713889791e-127
AFR307C3.489ON6503799561e-124
ZYRO0D10054g3.489ON6643899541e-123
TDEL0D055703.489ON6493839441e-122
KLLA0E04665g3.489ON6473769191e-118
TBLA0C044603.489ON6983899221e-118
TPHA0D042303.489ON6523818961e-115
Suva_7.4163.489ON7133968701e-110
NDAI0G009603.489ON7003808381e-105
Smik_6.2243.489ON7053978171e-102
YGR128C (UTP8)3.489ON7133978101e-101
Skud_7.4393.489ON7133937936e-99
CAGL0I10560g3.489ON6783797708e-96
KNAG0B008303.489ON6073856971e-85
KAFR0C019403.489ON6094016491e-78
Ecym_26447.81ON120591840.091
KAFR0H022608.324ON93860810.19
Smik_12.5404.328ON44852694.5
Ecym_62428.734ON25665667.7
Ecym_42558.324ON93795679.0
KLTH0E16500g8.879ON83391679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21222
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   754   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   549   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   451   e-154
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   387   e-129
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   381   e-127
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   372   e-124
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   372   e-123
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   368   e-122
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   358   e-118
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   359   e-118
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   349   e-115
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   339   e-110
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   327   e-105
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   319   e-102
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   316   e-101
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   310   6e-99
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   301   8e-96
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   273   1e-85
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   254   1e-78
Ecym_2644 Chr2 complement(1241951..1245568) [3618 bp, 1205 aa] {...    37   0.091
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    36   0.19 
Smik_12.540 Chr12 (951545..952891) [1347 bp, 448 aa] {ON} YLR443...    31   4.5  
Ecym_6242 Chr6 (453080..453850) [771 bp, 256 aa] {ON} similar to...    30   7.7  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    30   9.0  
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    30   9.0  

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120
           AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120

Query: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENFQ 180
           HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENFQ
Sbjct: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENFQ 180

Query: 181 SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIND 240
           SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIND
Sbjct: 181 SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIND 240

Query: 241 ELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQLLNL 300
           ELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQLLNL
Sbjct: 241 ELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQLLNL 300

Query: 301 VLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLSVGE 360
           VLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLSVGE
Sbjct: 301 VLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLSVGE 360

Query: 361 GAITAYSVEQLEL 373
           GAITAYSVEQLEL
Sbjct: 361 GAITAYSVEQLEL 373

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 321/373 (86%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF PIS NRALLT DNK++LLDLLHNAILSQRE  HVK FQLL TAVIPGNS+ NN TI
Sbjct: 278 ISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTI 337

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120
           A+GV+ K G+  +SSLD++NIDVGTGTL+DSMGKGF+S + K Q  Q L+ T NDTE  E
Sbjct: 338 ALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTEAAE 397

Query: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENFQ 180
            NY +ILK+L+K   N + FDSVFFK+L IKN+YYTDSDRF+ND+EFL +   LIF++F+
Sbjct: 398 FNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK 457

Query: 181 SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIND 240
           SEYPKALTYLLT+PLFP++ TH+LLQKLKDHPRLFKQAIVTCPNL L +L+QELFTVIND
Sbjct: 458 SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIND 517

Query: 241 ELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQLLNL 300
           ELCLDLSLRILQDF+KDSIK AIKQ+SK+DVN FINFV++EN +EDR+KNKPRLFQLL+L
Sbjct: 518 ELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSL 577

Query: 301 VLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLSVGE 360
           VLDSVGLFALE+E L+KL+ YID+QLSVVK+NV+LYNLV+E+NFKN  GQ   D+ + GE
Sbjct: 578 VLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGE 637

Query: 361 GAITAYSVEQLEL 373
             ITAYS+EQLEL
Sbjct: 638 PVITAYSIEQLEL 650

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 288/376 (76%), Gaps = 5/376 (1%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF PIS NRALLT DN++YLLDLLHNAILSQRE THVKTFQLL TA+IPGN++ NN TI
Sbjct: 279 VSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTI 338

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTE--- 117
           AIGV+TK  N +TS+LD+VNI+VG+GTLKDSM KGFL+     +   SL    +D     
Sbjct: 339 AIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEVLNSLFDEQDDELDED 398

Query: 118 -VQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIF 176
              + +Y QIL +L K KS ++KFD+VFFK LNIK +YYT+ DRF N Q FL   L LIF
Sbjct: 399 GTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIF 458

Query: 177 ENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFT 236
           ENF  EYP+ALTYLLTHPLFP      LL K K+HPRLF+QAIVTCPNLPL  LL ELFT
Sbjct: 459 ENFNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFT 518

Query: 237 VINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQ 296
           VINDELCLDLSLRILQDF+KDSIK +IK+ SKVD+N FI FV+NE+ DE+R K+KP+LFQ
Sbjct: 519 VINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQ 578

Query: 297 LLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFK-NILGQHHADS 355
           LLNLVLDS+GLFAL+ E+L+ L  +I+ Q+ +V+QN++L NL+D+ + K   +   ++ S
Sbjct: 579 LLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSAS 638

Query: 356 LSVGEGAITAYSVEQL 371
            S  E A+ +YSVE L
Sbjct: 639 SSTTEQALPSYSVEYL 654

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 276/379 (72%), Gaps = 7/379 (1%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNS-T 59
           +SF PI+ NR LLT +NK+YLLDL+HN+IL++R+ +HVK +QLL + V+P    + NS T
Sbjct: 278 LSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKT 337

Query: 60  IAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDT--- 116
           IAIGV+ K G +  SSL+V+N+DVG+GTLKDS+GK F  +  K   P   L   ++T   
Sbjct: 338 IAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYA 397

Query: 117 --EVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKL 174
             E +  +Y  IL++L   K++ +KFD +FFKKLNI  +YYT+ DRF+ DQ+FL + L L
Sbjct: 398 KGEQKSFDYKNILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDL 457

Query: 175 IFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQEL 234
           IF  F+ +YP+ALT+LLTHPLFPI+ T +LL K ++ PRLFKQA+VTCPNLPL +LL EL
Sbjct: 458 IFSAFKKDYPRALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAEL 517

Query: 235 FTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRL 294
           FT+ N ELCLD+SLRILQD+++DSIK  +K  SKVD+  FI FV++ +  ED+ +  P+L
Sbjct: 518 FTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVIDTD-SEDKSQFNPQL 576

Query: 295 FQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHAD 354
           FQLL+LVLD+ GLFALE+E L+KLS YID Q++V ++N +L++L+DE + K        D
Sbjct: 577 FQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQAND 636

Query: 355 SLSVGEGAITAYSVEQLEL 373
              +   +++AYSVE LEL
Sbjct: 637 QNVLQTKSLSAYSVEYLEL 655

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  381 bits (979), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 200/388 (51%), Positives = 272/388 (70%), Gaps = 16/388 (4%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF PIS NR LLT +NK+YLLDL+HN+ILS+RE TH+KTFQLL TAV+  N + N  T+
Sbjct: 285 VSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNR-TL 343

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTK--VQCPQSLLGTPND--- 115
           AIGV+TK G+  TSSL+++N+DVGT T+KDS+GK F +S T+  VQ  +SL    ND   
Sbjct: 344 AIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSD 403

Query: 116 --TEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLK 173
              +V+  NY +I K+L  +K++  KFD +FFK  +IK +YYT+ DRF+ + EFL   + 
Sbjct: 404 KKKQVKNFNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIID 463

Query: 174 LIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQE 233
           LIFE F+ EYPK  TYLLT PLFP+  T  LL +L +HPRLFKQAIVTCPNLPL++LL E
Sbjct: 464 LIFETFKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAE 523

Query: 234 LFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPR 293
           LFT+ N EL LD+SLRILQD+++DSIK  +K+  K++V  FI F+++E  D     N P 
Sbjct: 524 LFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNAPH 583

Query: 294 LFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERN--------FK 345
           LFQLL+LV+DS+GLFAL++  L++LS YID Q+++ + N +L++L+D  N        F 
Sbjct: 584 LFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFV 643

Query: 346 NILGQHHADSLSVGEGAITAYSVEQLEL 373
               +    SL + E  +  YSVE L+L
Sbjct: 644 TSTSKDSNTSLKLQEEVLPKYSVEYLDL 671

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  372 bits (956), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 268/379 (70%), Gaps = 11/379 (2%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNS-SSNNST 59
           +S   IS NR LLTC NK++LLDLLHNAIL +RE +++K FQLL  AVIPG +   +N T
Sbjct: 275 VSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRT 334

Query: 60  IAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSK-TKVQCPQSLLGTPNDTEV 118
            AIGV+TK G+  +S+LDVV I VGTGTLKDS+GKGFLS +  + +  + L GT +D E 
Sbjct: 335 FAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGT-DDDES 393

Query: 119 QEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFEN 178
              ++  IL +L  +++    FDS+F+K+L  K +YYT+ DRF+N+ EFL   L  IF  
Sbjct: 394 PNIDFAAILAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFAT 452

Query: 179 FQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVI 238
           F  E+PKAL YLLTHPLFP + T  LL KLK HPRLFKQA+VTCPNLPL +LL ELFTV+
Sbjct: 453 FADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVL 512

Query: 239 NDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVD-EDRVKNKPRLFQL 297
           NDEL LDLSLR+LQ+F+K+ IK  I++ S+VD++ F+NFV+ ++ D E+R K KP+LFQL
Sbjct: 513 NDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQL 572

Query: 298 LNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLS 357
           L+LV+D+VGL ALE + L +LS +ID Q++V  Q V+L  L++  + K   G+H      
Sbjct: 573 LSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKK--GKHLNSVTR 630

Query: 358 VGEGAITA----YSVEQLE 372
           + E  + A    YSVE L+
Sbjct: 631 LDESPVAATIPLYSVEYLD 649

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 272/389 (69%), Gaps = 17/389 (4%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNS-- 58
           +S  P+S NR LLT +N+VYLLDL+H+++LS+R  TH KTFQLL +A +  +SS   S  
Sbjct: 277 VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEF 336

Query: 59  ---TIAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLS---SKTKVQCP-----Q 107
              T+AIGV TK GN  TS+L+V+N+DVGTGTLKDS+GK F S   SKT    P     +
Sbjct: 337 ATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDE 396

Query: 108 SLLGTPNDT-EVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQE 166
           S  G   D+ EV    Y  I K+L+K   +  KFDS F K+LNI+ ++YTD +RF+ DQE
Sbjct: 397 SDAGDNADSDEVVAFAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQE 456

Query: 167 FLGNSLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLP 226
           FL   ++LI ++F  EYP+ALT+LLTHPLFP  CT  LL++ ++HPRLFKQAIVTCPNLP
Sbjct: 457 FLSKVVRLILDSFDQEYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLP 516

Query: 227 LSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDED 286
           L DLL ELF++ N ELCLD+SLRILQDF+ D IK+ +K+ +KVDV+ F+NF+++   DE+
Sbjct: 517 LDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK-DEE 575

Query: 287 RVKNKP--RLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNF 344
            ++NK    LFQLL+LV+D++GLFAL+   L +LS+YID Q+ + ++N +L+NL+D RN 
Sbjct: 576 LIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNK 635

Query: 345 KNILGQHHADSLSVGEGAITAYSVEQLEL 373
                   A S    E  +  Y+VE LEL
Sbjct: 636 NRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  368 bits (944), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 268/383 (69%), Gaps = 11/383 (2%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSS---NN 57
           +S  PIS NR L+T DNK+YLL+L HN+IL QRE TH+K+FQLL +AVI    SS   N 
Sbjct: 268 ISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ 327

Query: 58  STIAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKV-QCPQSLLGTPNDT 116
            T  IGV TK G   TSSL++VN+DVGTGTLKDS+GKGF  S   + Q  + L    ++ 
Sbjct: 328 KTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNE 387

Query: 117 ------EVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGN 170
                 + +  ++ QI + L K K +   FD +F ++LNIK ++YT+ DRF+ D++FL N
Sbjct: 388 AEDEDNKFEHFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSN 447

Query: 171 SLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDL 230
            + LI +NFQ EYPKALT+LLTHPLFP+ CT  LL +L++HPRLFKQAIVTCPNLPL +L
Sbjct: 448 VVHLILQNFQEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQEL 507

Query: 231 LQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKN 290
           L ELF++ N EL LD+SLRILQD++ D IK  +++ +K+DV  FI FV++ N DE+ +++
Sbjct: 508 LSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSN-DENAIRS 566

Query: 291 KPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQ 350
             +LFQLL+LVLDS+GLFAL+   LD+L++YI  ++++ ++N +L +L+D++       +
Sbjct: 567 SHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAK 626

Query: 351 HHADSLSVGEGAITAYSVEQLEL 373
             A S+     A+  Y+VE L+L
Sbjct: 627 SGAGSVGSTREAVPKYTVEYLDL 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 263/376 (69%), Gaps = 5/376 (1%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +S  P+S NR LLT DN +YL+DLL+NAIL Q++  ++K  QLL TAV+  NS  N  TI
Sbjct: 272 VSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTI 331

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFL-SSKTKVQCPQSLLGTPNDTEVQ 119
           A+ V TK G   TS LDV+NIDVGTGTLKD+MGKGF+   K K+Q         +D E+ 
Sbjct: 332 ALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVKQKQKLQKLFEESNEDDDVELP 391

Query: 120 EHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENF 179
             +Y +I+K L   K   + FDS+FFK L++  +YYTD+DRFLND + L   +  +F NF
Sbjct: 392 SPDYERIIKQLHICKK-IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNF 450

Query: 180 QSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIN 239
           + EYPKALTYLLTHPLFP      LL KLK++PRLFKQAIVTCPN+PL DLL ELF + N
Sbjct: 451 KDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITN 510

Query: 240 DELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNEN-VDEDRVKNKPRLFQLL 298
            ELC D++LR+LQD+ K+SIK  I++  K+D+  F++ ++N N  D D   NKP++FQL+
Sbjct: 511 AELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLM 570

Query: 299 NLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDE--RNFKNILGQHHADSL 356
           +L++DS+GLFAL+DE L+KLS+++D Q+SVV QN++L +L +   ++   +  + ++ + 
Sbjct: 571 SLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTN 630

Query: 357 SVGEGAITAYSVEQLE 372
           S     I+AY+V+ LE
Sbjct: 631 SSSTQPISAYTVDYLE 646

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  359 bits (922), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 193/389 (49%), Positives = 276/389 (70%), Gaps = 24/389 (6%)

Query: 2   SFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTIA 61
           S  P++ NR +L  +N VYL+D LH +IL++REFTHVKTFQLL +A I G+S+    TIA
Sbjct: 317 SIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIA 375

Query: 62  IGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGF---LSSKTKVQC--------PQSLL 110
           IGV+TK G TS S+L+++NI+VG+GTLKDS+GKG    LS  +             +SL+
Sbjct: 376 IGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGSHSDLKPLFDENDEKSLI 435

Query: 111 GTP--NDTEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFL 168
           GTP  + + V+  N+ +IL DL  + + SD FD  FF+ L IK ++YT++DRF++DQ+F+
Sbjct: 436 GTPVHDISNVKSFNFNKILADLKSSDTISD-FDKTFFESLEIKENHYTENDRFISDQDFI 494

Query: 169 GNSLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLS 228
            N++ LIF+ F +E+PKA T+LLTHPLFPI  T  LL KLKDHPRLFKQAIVTCPNLPLS
Sbjct: 495 ANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLS 554

Query: 229 DLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRV 288
           +LL +LFTV N EL LD+SLR+LQD+S++ +K  IK+   VD+  FI F++    +E + 
Sbjct: 555 ELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQT 614

Query: 289 KNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD----ERNF 344
            N P+LFQLL+LVLDS+GLFAL+   L++LSNYI+ Q+++ +++ +L++L+D     R F
Sbjct: 615 -NTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPF 673

Query: 345 KNILGQHHADSLSVGEGAITAYSVEQLEL 373
           KN     +  S+   +  ++ YSV+ L++
Sbjct: 674 KN----AYLKSVIGNKETLSVYSVDYLDI 698

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/381 (49%), Positives = 270/381 (70%), Gaps = 14/381 (3%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNN-ST 59
           +SF P+S NR LLT DNK+++LDL+H A L++R   HVK FQLL + VI  N +SNN  T
Sbjct: 278 ISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKT 337

Query: 60  IAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQ 119
           IAIGV+ K G +  ++L+++N +VGTGTLKDS+G  F  SK+        L T +   V+
Sbjct: 338 IAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVK 397

Query: 120 EHN--YTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFE 177
            H+  Y  ILK L+ T+++  KFD +FF  L I+ +YYTD++RF+ D  FL + + LIF+
Sbjct: 398 RHDFKYEAILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFK 457

Query: 178 NFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTV 237
           NFQ EYP ALT+LLTHPLFPI  T +LL KL++HPRLFKQA+VTCPNLP+ +LL ELF++
Sbjct: 458 NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSI 517

Query: 238 INDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQL 297
            N EL +D+SLRILQD++KDSIK  +K  +K+D+  FI+FV++ N +E++ K+  +LF L
Sbjct: 518 TNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVL 576

Query: 298 LNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD----ERNFKNILGQHHA 353
           L+LVLD+ GLF++E   L +LS YID+Q+ +++++ +L++L+D    +RN       +  
Sbjct: 577 LSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRN-----NHYQT 631

Query: 354 DSLSVGE-GAITAYSVEQLEL 373
              +V E  A+TAYSVE LEL
Sbjct: 632 SGATVPEIKALTAYSVEYLEL 652

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  339 bits (870), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 270/396 (68%), Gaps = 25/396 (6%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF P+S+NR LLT +N +YLLDLLH +IL+QRE THV+TFQLL +AVI    S N+ TI
Sbjct: 320 ISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTI 379

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSK--TKVQCPQSLLGTPN---- 114
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F   K  T     + L    N    
Sbjct: 380 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKNDTSSVVLKPLFDDENVADN 439

Query: 115 ---------DTEVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRFLND 164
                    +  V    Y +I+K ++  K+N    FD +FFK L +K ++YT+ DRF++D
Sbjct: 440 MVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKDRFISD 499

Query: 165 QEFLGNSLKLIFENFQ-SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCP 223
            EFL   L LIFE F  ++YPKALT+LLTHPLFP+  TH+LL +L+D PRLFKQAIVTCP
Sbjct: 500 SEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHNLLSRLRDQPRLFKQAIVTCP 559

Query: 224 NLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENV 283
           NLPL++LL+ELF++ N EL LD+S RILQDF++DSIK  +K  SK+D+  FI+F+   N 
Sbjct: 560 NLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFIT--NT 617

Query: 284 DEDRV------KNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYN 337
           DED            +LFQLL+LVLDS+GLF+LE   LD L++YID+Q+ + ++N +L+N
Sbjct: 618 DEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLASYIDKQVEIAERNTELWN 677

Query: 338 LVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373
           LV+ +  ++     ++DS +  + A+  Y++E LE+
Sbjct: 678 LVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  327 bits (838), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 260/380 (68%), Gaps = 30/380 (7%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +S  PIS NR LLT +NK+YLLDL+HN+ILS+RE TH+K+ QLL +AVI G   +NN TI
Sbjct: 286 VSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTI 344

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGF--LSSKTKVQCPQSLL-------- 110
            IGV+TK G   TSSL+++N+DVG+ TLKDS+GK F  L+ + ++Q     L        
Sbjct: 345 TIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNT 404

Query: 111 -GTPND------TEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLN 163
            G  +D         ++ NY +IL  L++  ++  KFD +FF+  NIK ++YT++DRF+ 
Sbjct: 405 DGDKDDDLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIY 464

Query: 164 DQEFLGNSLKLIFENFQS--------EYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLF 215
           + EF    + LIFE F S        EYPK LT+LLTHPLFP+  T  LL +  +HPRLF
Sbjct: 465 NHEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLF 524

Query: 216 KQAIVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFI 275
           KQAIVTCPNLPL +LL EL T+ N+EL LD+SLRILQD+SKDSIK  ++   ++++  FI
Sbjct: 525 KQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFI 584

Query: 276 NFVMNENVDEDRVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQL 335
           +F++N+ + +D+  N P+LFQLL LVLDS+GLFAL D  L+ LS YIDRQ+S+V++N +L
Sbjct: 585 DFILNDEIKDDQ--NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTEL 642

Query: 336 YNLVDERNFKNILGQHHADS 355
           + L+D  N  NI   +  D+
Sbjct: 643 WYLIDSNN--NIFSHNKKDN 660

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 265/397 (66%), Gaps = 28/397 (7%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF P+S+NR LLT +N VYLLDLLH + L QRE +HVKTFQLL TAVI    S ++ TI
Sbjct: 313 ISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTI 372

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTP--NDTEV 118
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F + K       S++  P  +D EV
Sbjct: 373 AIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKD----SSVILKPLFDDEEV 428

Query: 119 QEH----------------NYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRF 161
            E+                 Y +I+  L+  KSN    FD +FFK L IK ++YT+ DRF
Sbjct: 429 TENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRF 488

Query: 162 LNDQEFLGNSLKLIFENFQ-SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIV 220
           ++D  FL   L LIFE F  ++YPK LT+LLTHPLFP+  T +LL  L+D PRLFKQAIV
Sbjct: 489 ISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQPRLFKQAIV 548

Query: 221 TCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN 280
           TCPNLPL++LL+ELF++ N EL LD+S RILQDF++DSIK  +K+ SK+D+  FI F+ +
Sbjct: 549 TCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTS 608

Query: 281 ENVDED----RVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLY 336
              D            +LFQLL+LVLDS+GLF+LE   L+ L++YID+Q+ + ++N +L+
Sbjct: 609 TENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVKIAERNTELW 668

Query: 337 NLVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373
           NL+D ++ ++       +S S  + A+  Y++E L++
Sbjct: 669 NLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/397 (46%), Positives = 261/397 (65%), Gaps = 28/397 (7%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF P+S+NR LLT +N +YLLDLLH + LSQRE THVKTFQLL +AVI    S N+ TI
Sbjct: 321 ISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTI 380

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKT------------------K 102
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F                       +
Sbjct: 381 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKR 440

Query: 103 VQCPQSLLGTPNDTEVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRF 161
           V+C         D+ V   +  ++++ L+  + N    FD +FFK+L IK ++YT+ DR+
Sbjct: 441 VKCND----VSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRY 496

Query: 162 LNDQEFLGNSLKLIFENFQS-EYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIV 220
           ++D  FL   L LIF  F   +YPK LT+LLTHPLFP++ T +LL  L+D PRLFKQAIV
Sbjct: 497 ISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIV 556

Query: 221 TCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN 280
           TCPNLPL++LL+ELF++ N EL LD+S RILQDF++DSIK  +K+ SK+DV  FI F+ +
Sbjct: 557 TCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITS 616

Query: 281 ENVDEDRVKNKP----RLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLY 336
              D       P    +LFQLL+LVLDS+GLF+LE   L+ L+ YID+Q+ + ++N +L+
Sbjct: 617 GGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELW 676

Query: 337 NLVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373
           NL+D + F++       D+ +  + A+  Y++E L++
Sbjct: 677 NLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  310 bits (793), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 183/393 (46%), Positives = 257/393 (65%), Gaps = 20/393 (5%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF P+S+NR LLT +N +YLLDLLH +IL+ RE THVKTFQLL +A+I    S N+ TI
Sbjct: 321 ISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTI 380

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDT---- 116
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F   K         L    D     
Sbjct: 381 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGKNDASVILKPLFDDEDVTNNM 440

Query: 117 ----------EVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRFLNDQ 165
                      V   +Y ++++ L+  K+N    FD +FF  L +K ++YT+ DRF++D 
Sbjct: 441 VKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRFISDP 500

Query: 166 EFLGNSLKLIFENFQS-EYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPN 224
            FL   L LIF  F   +YPKALT+LLTHPLFP+  TH LL  L+D PRLFKQAIVTCPN
Sbjct: 501 GFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHGLLSLLRDQPRLFKQAIVTCPN 560

Query: 225 LPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVD 284
           LPL++LL+ELF++ N EL LD+S R+LQDF++DSIK  +K+ SK+D+  FI  + N   D
Sbjct: 561 LPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEED 620

Query: 285 ED----RVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD 340
                    +  +LFQLL+LVLDS+GLF+LE   L+ L+ YID+Q+ + ++N +L+NL+D
Sbjct: 621 GPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLID 680

Query: 341 ERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373
            +  ++      + S +  + A+ AY++E L++
Sbjct: 681 IKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  301 bits (770), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 255/379 (67%), Gaps = 9/379 (2%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +S  PI+ NR LLT  NK+YLLDLLH +ILS+RE +H+KTFQ+L TA +  + S +  T+
Sbjct: 303 ISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTA-MNRDGSESKLTL 361

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120
           A+G++TK G   TS+L+++NIDVG+ +LKDS+GK FL    ++Q     L      E+  
Sbjct: 362 ALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPEPKYELPS 421

Query: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFE--N 178
            N+ +IL  L K  ++++KFD  FF  LNIK + +T++ RFLNDQ FL + L LIF   +
Sbjct: 422 INFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKID 480

Query: 179 FQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVI 238
           +    P++L +LLTHPLFP      LL K+K + RLFKQAIVTCPNLPL +LLQELFT+ 
Sbjct: 481 YNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIK 540

Query: 239 NDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKN----KPRL 294
           N EL +D+S+RILQD++KD+IK  IK+  +V V  F+NF++  N  E  V +     P++
Sbjct: 541 NSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQI 600

Query: 295 FQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHAD 354
           F+LL+L+LDS+GLF LE+  L +LS+ I++++ + ++NV+L+N++D +          A 
Sbjct: 601 FKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAA 660

Query: 355 SLSVGEGAITAYSVEQLEL 373
           S  + E + T Y VE +++
Sbjct: 661 S-KLAENSQTPYIVEYIDI 678

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  273 bits (697), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 153/385 (39%), Positives = 233/385 (60%), Gaps = 22/385 (5%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           ++F  +  +R  L   N++YLLDL   ++LS  +F  +K  +L+  A         + + 
Sbjct: 233 LTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSF 284

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGT-----PND 115
           AI ++  P + + S LD++N+++G+ ++KDS+GKGF +   + +  +S +         D
Sbjct: 285 AIALSHGPQDNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGD 343

Query: 116 TEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLI 175
              +  +Y  ILK L     +  KFD +FFK+L I  + YT+ DRF+ DQ FL  ++ +I
Sbjct: 344 KTKRSFDYASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVI 403

Query: 176 FENFQ----SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLL 231
            +N+     S+YP A TYLLTHPLFP   T  LL K+K  PRL+KQ IVTCPNLPL +LL
Sbjct: 404 LKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELL 463

Query: 232 QELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN--ENVDEDRVK 289
            E F + N+EL LDLSL+ILQD++KDSIK  +K   +V+V  FI FV+    N DE  V 
Sbjct: 464 TESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVA 523

Query: 290 NKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDER-NFKNIL 348
             P+LFQLL+LV+DS+GLFAL+ E L +L+ YID  + + + N +L+NL++ R N  ++ 
Sbjct: 524 T-PQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVA 582

Query: 349 GQHHADSLSVGEGAITAYSVEQLEL 373
           G + +  +   +     Y V+ LE+
Sbjct: 583 GSNRSKYVKTQKKVFPPYLVDHLEI 607

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  254 bits (649), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 157/401 (39%), Positives = 245/401 (61%), Gaps = 45/401 (11%)

Query: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60
           +SF  +  N  ++  ++ +Y L+L  ++++S  E  ++K F+L+          SN   +
Sbjct: 226 VSFTVVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNL-------SNQFVL 278

Query: 61  AIGVATKPGNTSTSSLDVVNIDVGTG-TLKDSMGKGFLS------SKTKVQCPQSL---- 109
            +       N      +++N+D+ +   LKDS+GKGF +      S+ +    +SL    
Sbjct: 279 GLSF-----NNENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSAD 333

Query: 110 -----LGTPNDTEVQEH--NYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFL 162
                L   +D++V EH  NY +I+ DL K   N  KFD +FF+K NIK ++YT++DRFL
Sbjct: 334 EADEDLHNDSDSDV-EHTFNYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFL 392

Query: 163 NDQEFLGNSLKLIFENFQ-----SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQ 217
            +Q+FL   ++LI +N++     + YPK LTYLLTHPLFP++ T +LL K ++ PRL+KQ
Sbjct: 393 VNQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQ 452

Query: 218 AIVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINF 277
           AIVTCPNLPL +LL +LFT+ N+EL LD+SLR+LQD++KDSIK  IK   KVD+  FI F
Sbjct: 453 AIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEF 512

Query: 278 VMNENVDEDRVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYN 337
           V     DED+ +   +LFQLL+L++DS+GLFAL+ + L ++SN+I+ +  V KQN +L +
Sbjct: 513 VTQ---DEDQ-QVSSQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLH 568

Query: 338 LVDERNFKNILGQHHA-----DSLSVGEGAITAYSVEQLEL 373
           L+D    K    +  +     ++ S+    +  Y+VE L+L
Sbjct: 569 LLDYNPSKQSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

>Ecym_2644 Chr2 complement(1241951..1245568) [3618 bp, 1205 aa] {ON}
            similar to Ashbya gossypii ACR285C
          Length = 1205

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 14/91 (15%)

Query: 49   IPGNSSSNNSTIAIGVATK-PGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQ 107
            +P +  +N+S  ++G AT  PGN ++S+   +   +G    + S+G G   S  + Q P 
Sbjct: 922  VPSSKVTNDSMKSVGSATPVPGNLTSSAASPM---LG----RQSVGPG---SVAQSQKPL 971

Query: 108  SLLGTPNDTEVQEHNYTQ---ILKDLAKTKS 135
             L GTP +T   E+ Y Q    LKDLA  K+
Sbjct: 972  PLKGTPTNTSPSENPYRQDELRLKDLALKKA 1002

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa]
          {ON} Anc_8.324 YLR129W
          Length = 938

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 38 VKTFQLLGTAVIPGNSSSNNSTIAIGVATKPGNTSTSSLDVVNI-DVGTGTLKDSMGKGF 96
          VK++Q      + G  SSN++++ I     PGN  TS+L+ +NI D+ TG L + +  G 
Sbjct: 2  VKSYQRFEQTSVFGVISSNSNSVWIPNGNGPGNIITSALENINIWDIKTGELVNQLTDGL 61

>Smik_12.540 Chr12 (951545..952891) [1347 bp, 448 aa] {ON} YLR443W
           (REAL)
          Length = 448

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 228 SDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVM 279
           +++L  L+ VI+ ++C+ L L I   + K    NA+K+R+ V +N  ++ V+
Sbjct: 203 ANVLHLLYAVISFQVCM-LFLMIWYYYIKGRFMNALKERALVHINSLLSLVV 253

>Ecym_6242 Chr6 (453080..453850) [771 bp, 256 aa] {ON} similar to
          Ashbya gossypii AER351W
          Length = 256

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 9  NRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSS------NNSTIAI 62
          N+AL    NK YL DL H  + SQR      T + L   VIP  SS       N +   +
Sbjct: 41 NQALELFKNKEYLSDLKHIIVTSQR------TVECLYEEVIPSLSSDEKSKLFNKTVYVV 94

Query: 63 GVATK 67
          G AT+
Sbjct: 95 GPATQ 99

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 38  VKTFQLLGTAVIPGNSSSNNSTIAI---GVATKPGNTSTSSLDVVN-IDVGTG----TLK 89
           V ++Q        G  +SN++ + I   G  T PG   TSSL+ +N  D+ TG    TL 
Sbjct: 2   VNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLS 61

Query: 90  DSMGKGFLSSKTKVQCPQSLLGTPNDTEVQEHNYT 124
           DS+  G + +K +     + L   ++T +    Y 
Sbjct: 62  DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYA 96

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} similar
           to uniprot|P05085 Saccharomyces cerevisiae YML099C ARG81
           Zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type involved in the regulation
           of arginine-responsive genes acts with Arg80p and Arg82p
          Length = 833

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 19/91 (20%)

Query: 241 ELCLDLSLRILQDFSKDSIKNAIKQRSKVDV------NCFINFVMNENVDEDRVKNKP-- 292
           ++CL+ + +  Q+  KD I  AI   + +DV      +C  + ++ EN+ E+R+K +P  
Sbjct: 469 KICLESTAK--QERYKD-ILTAILSMNSIDVVWGTMADCQYHLMLCENLVEERMKTRPKI 525

Query: 293 --------RLFQLLNLVLDSVGLFALEDEAL 315
                   R+F  L L+ DS  L  ++++ +
Sbjct: 526 SGKARSLHRIFSFLKLIQDSTALDKVQEKEI 556

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,123,012
Number of extensions: 2056988
Number of successful extensions: 8659
Number of sequences better than 10.0: 107
Number of HSP's gapped: 8980
Number of HSP's successfully gapped: 107
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)