Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212193.488ON30230216160.0
KLTH0F14740g3.488ON30230210361e-142
SAKL0F02860g3.488ON3052917353e-96
TDEL0D055603.488ON3112986852e-88
YPR147C3.488ON3042946832e-88
Kpol_480.173.488ON3133046809e-88
Skud_16.4423.488ON3042946791e-87
TPHA0D042203.488ON3162796703e-86
Suva_16.4763.488ON3042986572e-84
Smik_16.4003.488ON3042946545e-84
CAGL0L08514g3.488ON3123136331e-80
TBLA0C044503.488ON3092856312e-80
NCAS0F035303.488ON3132886224e-79
Ecym_12413.488ON3052826121e-77
AFR306C3.488ON3192795973e-75
ZYRO0D10076g3.488ON3052775921e-74
NDAI0B058303.488ON3293185383e-66
TPHA0L016008.524ON372108900.008
TDEL0B032508.524ON348199880.013
Smik_2.3458.524ON375143880.014
YBR204C (LDH1)8.524ON375128870.021
Suva_4.4598.524ON375134860.028
KLTH0E12188g8.524ON33689840.044
Skud_2.3318.524ON376128830.066
NDAI0J014808.245ON58064820.083
TBLA0H035408.524ON378142810.11
ZYRO0F09064g8.524ON349106800.12
KAFR0E03110singletonON356109790.17
NDAI0C054308.524ON362135790.20
Kpol_299.68.524ON349107770.36
KLLA0E23035g8.524ON325111760.38
SAKL0E02662gsingletonON18054740.41
KNAG0A037708.524ON356133760.42
SAKL0H10450g8.524ON392144750.57
SAKL0E02596g2.487ON31854740.81
NCAS0B022608.524ON363115721.5
KAFR0C004303.273ON94948712.0
KAFR0A010403.273ON91242712.1
Skud_4.3608.245ON59345712.1
KLTH0D10318g8.638ON87144702.6
Smik_4.3458.245ON58545702.6
YDR101C (ARX1)8.245ON59345702.8
KLTH0E15092g3.342ON28877675.6
Kwal_27.119758.524ON33685666.8
TPHA0F008204.114ON79467677.6
Skud_15.3858.638ON93146668.1
TPHA0D038701.100ON1262134668.7
Suva_8.2718.638ON93042669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21219
         (302 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   627   0.0  
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   403   e-142
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   287   3e-96
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   268   2e-88
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   267   2e-88
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   266   9e-88
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   266   1e-87
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   262   3e-86
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   257   2e-84
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   256   5e-84
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   248   1e-80
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   247   2e-80
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   244   4e-79
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   240   1e-77
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   234   3e-75
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   232   1e-74
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   211   3e-66
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    39   0.008
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    39   0.013
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    39   0.014
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    38   0.021
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    38   0.028
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    37   0.044
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    37   0.066
NDAI0J01480 Chr10 (343226..344968) [1743 bp, 580 aa] {ON} Anc_8....    36   0.083
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    36   0.11 
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    35   0.12 
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               35   0.17 
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    35   0.20 
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    34   0.36 
KLLA0E23035g Chr5 (2051146..2052123) [978 bp, 325 aa] {ON} weakl...    34   0.38 
SAKL0E02662g Chr5 complement(213396..213938) [543 bp, 180 aa] {O...    33   0.41 
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    34   0.42 
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    33   0.57 
SAKL0E02596g Chr5 complement(208748..209704) [957 bp, 318 aa] {O...    33   0.81 
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   1.5  
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    32   2.0  
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    32   2.1  
Skud_4.360 Chr4 complement(627265..629046) [1782 bp, 593 aa] {ON...    32   2.1  
KLTH0D10318g Chr4 complement(853996..856611) [2616 bp, 871 aa] {...    32   2.6  
Smik_4.345 Chr4 complement(616569..618326) [1758 bp, 585 aa] {ON...    32   2.6  
YDR101C Chr4 complement(655686..657467) [1782 bp, 593 aa] {ON}  ...    32   2.8  
KLTH0E15092g Chr5 complement(1341132..1341998) [867 bp, 288 aa] ...    30   5.6  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    30   6.8  
TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.1...    30   7.6  
Skud_15.385 Chr15 complement(691276..694071) [2796 bp, 931 aa] {...    30   8.1  
TPHA0D03870 Chr4 complement(808388..812176) [3789 bp, 1262 aa] {...    30   8.7  
Suva_8.271 Chr8 complement(491197..493989) [2793 bp, 930 aa] {ON...    30   9.6  

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MKSIQNCVDPLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWE 60
           MKSIQNCVDPLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWE
Sbjct: 1   MKSIQNCVDPLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWE 60

Query: 61  ILGISHAGMNSCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITT 120
           ILGISHAGMNSCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITT
Sbjct: 61  ILGISHAGMNSCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITT 120

Query: 121 SRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKI 180
           SRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKI
Sbjct: 121 SRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKI 180

Query: 181 TKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQE 240
           TKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQE
Sbjct: 181 TKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQE 240

Query: 241 NDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQ 300
           NDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQ
Sbjct: 241 NDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQ 300

Query: 301 YF 302
           YF
Sbjct: 301 YF 302

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 230/302 (76%)

Query: 1   MKSIQNCVDPLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWE 60
           MK   + V   P S+ H  +G++S G +A LFVFIPGNPGLIE+Y PFL Q+HEKNP WE
Sbjct: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60

Query: 61  ILGISHAGMNSCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITT 120
           ILGISHAGMNSC++   PVY+L++QI+HK+++IN Y    K I IMGHSVGAF+ QK+ T
Sbjct: 61  ILGISHAGMNSCNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVT 120

Query: 121 SRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKI 180
           S  L  +V RVGLLTPTVIDIHKSEKG+KLT+IT   P FH +VS L+W  FEKL P  +
Sbjct: 121 SGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFL 180

Query: 181 TKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQE 240
           T  IIS   DDP++CLGA T LL+TNSRFVKQALGLA EE++VIRSDW YQK+FL  C+ 
Sbjct: 181 TSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCET 240

Query: 241 NDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQ 300
              KIWWLFS+ DHWVS  TR D+I FY +HSSP L  IDVS+ IEHAFVRRHA +V++ 
Sbjct: 241 KGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQH 300

Query: 301 YF 302
           YF
Sbjct: 301 YF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  287 bits (735), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 142/291 (48%), Positives = 187/291 (64%), Gaps = 3/291 (1%)

Query: 14  SLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGM-NSC 72
           SLYH          + PLFVFIPGNPGLIEFY+ FL QI +K+  WEILGISHAGM   C
Sbjct: 14  SLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKC 73

Query: 73  SEEVSP--VYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130
                P  VYSL+ Q+ HKI +IN +C   +P+II GHS+GA++VQKI     L   V +
Sbjct: 74  KGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKK 133

Query: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190
           + LLTPTVIDIH SEKG KL  I  WCP+FH+ V+T +W +FEK+LP  IT+ I+SL V 
Sbjct: 134 IMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVG 193

Query: 191 DPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFS 250
             Q+C+    +LLVTN  FV+Q+LGLA EE++ +R DW +Q  FL  C+  + ++ +LF+
Sbjct: 194 SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFA 253

Query: 251 EKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQY 301
            KDHWV+  TR D+ +FY  +       ID    I H+FV      V+ +Y
Sbjct: 254 FKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  268 bits (685), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 187/298 (62%), Gaps = 8/298 (2%)

Query: 12  PCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNS 71
           P S+ H  +       E PLFV+IPGNPGLIE+YE FL  IH ++P WE+LGISHAGM++
Sbjct: 12  PTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMST 71

Query: 72  CS------EEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLK 125
            S       E + VYSL+QQIDHK+EII  +    +P+IIMGHSVGA+MVQ I  S +L 
Sbjct: 72  ASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYMVQHIVLSDKLV 131

Query: 126 SKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSII 185
            KV ++GLLTPT++DIH S+KGV LT +  W      +    +  LF   LP+ I + ++
Sbjct: 132 GKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFFLPSFILRILL 191

Query: 186 SLLVDDPQSCLGA-TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTK 244
           S  +   ++  G  TT +L+ N  FVKQALGL+  E+  IRSDWA+Q+  ++ C E    
Sbjct: 192 SFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGIS 251

Query: 245 IWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
            W LFS+ DHWV+ TTR D+I FYR H      +I  +  I H+FV  H+  +I +YF
Sbjct: 252 TWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLNHSKYLISEYF 308

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  267 bits (683), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 191/294 (64%), Gaps = 2/294 (0%)

Query: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70
           LPCS+ +    +  SG +APL V+IPGNPGL+ +Y+  L  +H K+P WEILGISHAGM 
Sbjct: 11  LPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMT 70

Query: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130
             +   +P++SL+ Q+DH++E+IN +    + IIIMGHSVGA++VQK+  S +L   V +
Sbjct: 71  LNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQK 130

Query: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190
           VGL+TPTV+DIH SE G+K+T+  R+ P   +VVS  ++  F  +L    ++ II   + 
Sbjct: 131 VGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMG 190

Query: 191 DPQSCLGA--TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248
              +   A  +T + +T+ +FV+Q+LGLAA+E+  I ++W +Q  F+  C+EN   IW+L
Sbjct: 191 CGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL 250

Query: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           FS  DHWVS  TR+ + D+Y+        +IDV+  I H+FV +HA+  I  +F
Sbjct: 251 FSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAINAFF 304

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  266 bits (680), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 196/304 (64%), Gaps = 16/304 (5%)

Query: 12  PCSLYHRNAGLNS-SGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70
           P S+ H +      S  ++PLFV+IPGNPGL+E+Y  FLA +H+KNP WE+LGISHAGM+
Sbjct: 13  PTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMS 72

Query: 71  ---------SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTS 121
                    + S +   V+ LE+Q+ HK++IIN++    +P+IIMGHSVGA++ Q++  +
Sbjct: 73  YDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMT 132

Query: 122 RRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKIT 181
            +L  K+I+VG LTPTV+DIH S+KG+K+T +  W  +  + V  ++  +F KLLP    
Sbjct: 133 NKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFV 192

Query: 182 KSIISLLV---DDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLC 238
           K  IS ++   +D  + L + T  L+ N+  ++QALGLA  E+  I  DW + K+ +  C
Sbjct: 193 KFFISKMIKCSEDSNAVLASGT--LLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYC 250

Query: 239 QENDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVI 298
            E   K W+LF+E DHWV+ +TR ++IDFY+ H+ P   +ID+  TI HAFV + +  ++
Sbjct: 251 NETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFVIKKSKYIV 309

Query: 299 KQYF 302
            QYF
Sbjct: 310 DQYF 313

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  266 bits (679), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 196/294 (66%), Gaps = 2/294 (0%)

Query: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70
           LPCS+ +    + +   +APL V+IPGNPGL+ +Y+  L  +H K+P WEILG+SHAGM 
Sbjct: 11  LPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMT 70

Query: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130
             +   +P++SL+ Q+DH++E+IN +  + + IIIMGHSVGA+++QK+  S +L   V +
Sbjct: 71  LNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRK 130

Query: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190
           +GL+TPTV+DIH SE GVK+T++  + P   +VVS L++  F  +L   +++ +I   + 
Sbjct: 131 IGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMG 190

Query: 191 DPQSCLGA--TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248
              +   A  +T +L+T+ +FV+Q+LGLA++E++ I ++W +Q EF+  CQEN+  IW+L
Sbjct: 191 CGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFL 250

Query: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           FS KDHWV+  TR  +  +Y+        +IDV+  I H+FV +HA+  +  +F
Sbjct: 251 FSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  262 bits (670), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 186/279 (66%), Gaps = 5/279 (1%)

Query: 29  APLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS----EEVSPVYSLEQ 84
           +PLFV+IPGNPGL+E+YE FL  +H KNP W+ILGISHAGM+S +    E    VY+L++
Sbjct: 38  SPLFVWIPGNPGLLEYYEEFLKLLHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDE 97

Query: 85  QIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKS 144
           QI HKIEIIN++   G+ +I+MGHSVGAFM QK+  S +L+ KV ++GLL PTVIDIH S
Sbjct: 98  QIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLS 157

Query: 145 EKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD-DPQSCLGATTELL 203
           EKG ++++I  W P+   +   ++  +F   LP  + K IIS  ++ + ++     T   
Sbjct: 158 EKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTF 217

Query: 204 VTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRND 263
           + +S FV+Q+LGLA  E+++IR DW +Q+E + +C  N  ++W LF+E DHWVS  TR++
Sbjct: 218 LKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSE 277

Query: 264 IIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           +I+ YR   +       ++  + HAFV +++  V+  YF
Sbjct: 278 LIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHVVDNYF 316

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  257 bits (657), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 193/298 (64%), Gaps = 10/298 (3%)

Query: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70
           LPCS+ +    + +   +APL V+IPGNPGL+ +Y+  +  +H K+P WEILGISHAGM+
Sbjct: 11  LPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMS 70

Query: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130
           S +   +P++SL+ Q+DH++++IN +  D + IIIMGHSVGA++VQK+  S  L   V +
Sbjct: 71  SNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVGSVTK 130

Query: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190
           VGL+TPTV+DIH SE GVK+T+   + P+  +V+S +++  F  +L   ++K    L++D
Sbjct: 131 VGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGLSK----LIID 186

Query: 191 DPQSCLGA------TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTK 244
               C  A      +T L +T+ +FV+Q+LGLA++E++ I ++W +Q +F+  C+E    
Sbjct: 187 KFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIF 246

Query: 245 IWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
            W+LFS KDHWV+  TR  +  +Y         +IDV+  + H+FV +HA+  I  +F
Sbjct: 247 TWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAINAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  256 bits (654), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 187/294 (63%), Gaps = 2/294 (0%)

Query: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70
            PCS+ +    +  S  +A L V+IPGNPGL+ +Y+  L  +H K+P WEILGISHAGM 
Sbjct: 11  FPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWEILGISHAGMT 70

Query: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130
             +   +PVYSL+ Q+DH++E+IN +  + + IIIMGHSVGA+++QK+  S  L   V +
Sbjct: 71  LNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSHNLVGTVQK 130

Query: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190
           VGL+TPTV+DIH SE GVKLT+   + P   +VVS  ++  F  +L    ++ II   + 
Sbjct: 131 VGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMG 190

Query: 191 -DPQSCLGA-TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248
               SC    +T + +T+ +FV+Q+LGLA++E+  I ++W +Q +F+  C++N T IW+L
Sbjct: 191 CGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFL 250

Query: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           FS  DHWVS  TR+ +  +Y+        +IDV+  I H+FV +HA   I  +F
Sbjct: 251 FSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  248 bits (633), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 196/313 (62%), Gaps = 15/313 (4%)

Query: 3   SIQNCVD-PLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEI 61
           S+Q   D  LP  + H    + ++   +PLFV+IPGNPGL+E+Y+ FLA++H+KNP WEI
Sbjct: 2   SVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEI 61

Query: 62  LGISHAGMNSCSEEVS-------PVYSLEQQIDHKIEIINRYCLD-GKPIIIMGHSVGAF 113
           LGISHAG    S ++        P+Y L+QQ  HKI+IIN+   D  + ++IMGHSVGA+
Sbjct: 62  LGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGAY 121

Query: 114 MVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFE 173
           + Q + +S  L  +V ++GL+TPT+ DIHKS  G+  T +  +  + +  +S ++  +F 
Sbjct: 122 IAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFN 181

Query: 174 KLLPTKITKSIISLLV----DDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWA 229
           KL+P   TK +IS  +    D+    LG  T LL+T    ++Q LGLAA E+  IR DWA
Sbjct: 182 KLIPAYWTKLLISFAMGCSFDEYHIILG--TFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239

Query: 230 YQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAF 289
           +Q+  L  C++N TK+W LFS+ DHWVS  T+ ++I F +      L ++DV   I+H+F
Sbjct: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299

Query: 290 VRRHADLVIKQYF 302
           V +  DLV ++YF
Sbjct: 300 VVKDVDLVTRRYF 312

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 184/285 (64%), Gaps = 14/285 (4%)

Query: 28  EAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSE----EVSPVYSLE 83
           + PLF++IPGNPGL+E+Y   L  +H+K P WEILG+SHAGM++ ++      + VY+L+
Sbjct: 29  DTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLD 88

Query: 84  QQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHK 143
           +Q+ HK+E+IN +    + IIIMGHSVGA+M Q++     L   VI++GL+TPTV+DIH+
Sbjct: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHR 148

Query: 144 SEKGVKLT---SITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLV---DDPQSCLG 197
           S KG+K+T   ++ R  P F  ++STL    F KL P   T+ ++++++   ++      
Sbjct: 149 SVKGIKMTRAFNLFRELPIFLGLLSTL---AFSKLFPAIFTRWLLTIIMGCKNNDNHAAD 205

Query: 198 ATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVS 257
           A+T  L TN  FVKQ LGLA+ E++ IR DW +QK  +  C + +   W+LFS  DHWVS
Sbjct: 206 ASTVFL-TNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVS 264

Query: 258 PTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
             TRN++I+FYR +    +  + VS+ I H+FV   +D  +  YF
Sbjct: 265 DDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  244 bits (622), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 184/288 (63%), Gaps = 17/288 (5%)

Query: 30  PLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS--------EEVSPVYS 81
           P+FV+IPGNPG++E+Y+  L  +HEK+P WEIL ISH GMN+ +        ++ S V++
Sbjct: 28  PVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNSRVFT 87

Query: 82  LEQQIDHKIEIINRYCLDGK-PIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVID 140
           L++QI HKI+IIN +  D   PI I GHSVGA+MVQKI  S  L  +V+++GL+TPT+ID
Sbjct: 88  LKEQIQHKIKIINNFVKDSNVPIYISGHSVGAYMVQKIVASDELIGQVLKMGLITPTIID 147

Query: 141 IHKSEKGVKLTSITRW-CPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD---DPQSCL 196
           IH SEKG  +T   RW C    +++S L + +F  L+P  +   II  ++    D Q+ +
Sbjct: 148 IHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGILRSYIIGYVMGCHHDSQAAI 207

Query: 197 GATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWV 256
             +TEL +T   FV+Q+LGLA EE+  I  DW +Q E +  C +N  KI +LFS  DHWV
Sbjct: 208 --STELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWV 265

Query: 257 SPTTRNDIIDFYRQH--SSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
              TR +II FY++    + AL +IDVS    H+FV R +  V++ YF
Sbjct: 266 REATRKEIIQFYQERCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 124/282 (43%), Positives = 173/282 (61%), Gaps = 8/282 (2%)

Query: 29  APLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS---PVYSLEQQ 85
            PL +FIPGNPGLI FYE FL  IHE+NP WE++GI H GM+S  E  S    V++L++Q
Sbjct: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGRVHTLDEQ 83

Query: 86  IDHKIEIINRYCLDG--KPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHK 143
           I+ K+++IN +   G  + I ++GHS+GA+MVQKI   + L+ K+  V LLTPT+IDIH+
Sbjct: 84  IEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIHR 143

Query: 144 SEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVDDPQSCLGATTELL 203
           S KGV+LT I+ W P F+     ++  LF+ +LPT   + I   L+     C+  + + L
Sbjct: 144 SSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECVLQSAQKL 203

Query: 204 VTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRND 263
           V+   FVKQALGLA  E+  +R+ W +Q EF+  CQ N  K+ +LFS  DHWV P T  D
Sbjct: 204 VSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVHPDTMKD 263

Query: 264 IIDFYRQHSS---PALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           II+ Y    S     L  I +   I H+FV +    V+  YF
Sbjct: 264 IIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  234 bits (597), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 173/279 (62%), Gaps = 7/279 (2%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS--EEVSPVYSLEQQIDH 88
           + +F+PGNPGLI FY  FL  IHEKNP WEI+GISH GM++ +  E++  VY+L +Q++H
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100

Query: 89  KIEIINRYCLD--GKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEK 146
           K++ IN +  +     + ++GHS+GA+M QK+     L+  V  VGLLTPT+IDIH+S K
Sbjct: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160

Query: 147 GVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVDDPQSCLGATTELLVTN 206
           GV+LT I+ W P F+  VS ++  L E LLP      +   ++     C+  + E LV N
Sbjct: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVKN 220

Query: 207 SRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIID 266
             +V+QALG+A  E+  +R+ W +Q+EF+  CQE  + +W LFS  DHWV   T  DI++
Sbjct: 221 PSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIVE 280

Query: 267 FYRQH---SSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
           FY      ++ +L +I +   I H+FV +    V+  YF
Sbjct: 281 FYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  232 bits (592), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 180/277 (64%), Gaps = 5/277 (1%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEV----SPVYSLEQQI 86
           LFV+IPGNPG++++YE FL  +HEK  ++EIL ISHAGM +   ++    + +Y+L+ QI
Sbjct: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88

Query: 87  DHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEK 146
            HK+EIIN++    +P+I+MGHSVGA+M Q +  + +L  +V+++GL+TPTV+DIH+S+K
Sbjct: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQK 148

Query: 147 GVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD-DPQSCLGATTELLVT 205
           G +LT    W     ++ + ++  LF KL     T  +ISL +  D +S   AT++ LV 
Sbjct: 149 GTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQ 208

Query: 206 NSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDII 265
           N   ++QALGLAA E++ IR  W +QK+ +  C  N+ +  ++FS  D WVS  TR  ++
Sbjct: 209 NPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALM 268

Query: 266 DFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302
            FYR++      +I VS  + H+F+ +H+  ++ +YF
Sbjct: 269 VFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  211 bits (538), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 192/318 (60%), Gaps = 27/318 (8%)

Query: 12  PCSLYHRNAG--LNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGM 69
           P S+ H  A   + +     PLF++IPGNPG++++Y+ FL  +H+K+P WEIL I HAGM
Sbjct: 12  PTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGM 71

Query: 70  NSC----SEEVSPVYSLEQQIDHKIEIINRYCL-----DG----KPIIIMGHSVGAFMVQ 116
           ++           +Y L +QI+HKIE+I  +       DG    +P++IMGHSVG +M+Q
Sbjct: 72  DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQ 131

Query: 117 KITTSRRLKSKVI-------RVGLLTPTVIDIHKSEKGVKLTSITRWCPSF-HNVVSTLN 168
           ++  ++  +  ++       ++G +TPT+IDI+ S KG+ ++   +    +   ++S L+
Sbjct: 132 RMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTHGYLPYILSYLS 191

Query: 169 WALFEKLLP--TKITKSIISLLVDDPQSCLGAT-TELLVTNSRFVKQALGLAAEEVRVIR 225
           + +F  +L     I + +I+ ++    +   A  TE+L+TNS  VKQ+LGLA+ E++ IR
Sbjct: 192 YFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIR 251

Query: 226 SDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIIDFYR-QHSSPALSQIDVSST 284
            +W  QK+F+  C  ND ++W LF E DHWV+  TR D+I FY+  +   +  QI+VSS 
Sbjct: 252 KNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISRLQIEVSSE 311

Query: 285 IEHAFVRRHADLVIKQYF 302
             H+FV  H+D V++++F
Sbjct: 312 FPHSFVVNHSDWVVERFF 329

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 52/108 (48%), Gaps = 2/108 (1%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPV-YSLEQQIDH- 88
           +++FI G  G +E + P L      N ++  + +   G +  ++E +   YS+   I   
Sbjct: 91  IYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQSEFNDEYNIANYSMSSIIGFL 150

Query: 89  KIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTP 136
           K ++ +RY      II+ GHS+G ++        + + ++ ++ LL P
Sbjct: 151 KSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 79/199 (39%), Gaps = 47/199 (23%)

Query: 22  LNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSE-EVSPVY 80
           L  S G   LF+FI G  G +E +EP L ++ ++N ++  L     G     E +  P+ 
Sbjct: 71  LRQSKGGGELFLFIHGLGGTLEQFEPVLRELDQRNKSF--LAFDLPGFGKSDEWDQYPML 128

Query: 81  SLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFM-------------------------- 114
            + + ID  I  +    L  + + ++GHS+G ++                          
Sbjct: 129 DVVKSIDWLIHQLTN-NLKFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLLAPPKPN 187

Query: 115 VQKITTSRRLKSKVIRVGLLTPTVIDIHK---------SEKGVK--------LTSITRWC 157
           V +++ S+ L    ++ G   P + DI++         S  G+K        +T   R  
Sbjct: 188 VDQLSKSKYLIQFGLQTGFRFPWMFDIYRTRFDQSKGLSSSGIKQFFYRDGDITDKYRKL 247

Query: 158 PSFHNVVSTLNWALFEKLL 176
             FHN V   + ++F   L
Sbjct: 248 WQFHNNVQIKSRSIFGYFL 266

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 13/143 (9%)

Query: 21  GLNSSGGEAP-LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPV 79
            LN  G  +  +FVF+PG  G +E +EP L  +     A+  L +   G +S   +   +
Sbjct: 77  NLNDKGIRSDTVFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPML 136

Query: 80  YSLEQQIDHKIEII-----------NRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKV 128
             +E       +++           N    +G  ++++GHS+G F+   +     + +KV
Sbjct: 137 KVVELIFILLCDVLKGRPAVLSKDDNLNFFNGHKLVLVGHSMGCFLACHLYEQHLVDAKV 196

Query: 129 IR-VGLLTPTVIDIHKSEKGVKL 150
           ++ + LLTP    I +  K  ++
Sbjct: 197 VKTLVLLTPPKAHIEQLSKDKRI 219

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQIDHKI 90
           +FVF+PG  G +E +EP L  +     A+  L +   G +S   +   +  +E       
Sbjct: 88  VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVC 147

Query: 91  EIINRYC-----------LDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR-VGLLTPTV 138
           +++ ++             +G  I+++GHS+G F+   +       +K ++ + LLTP  
Sbjct: 148 DVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTPPK 207

Query: 139 IDIHKSEK 146
             I +  K
Sbjct: 208 AHIEQLSK 215

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 16/134 (11%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSE-EVSPVYSLEQQIDHK 89
           +FVF+PG  G +E +EP L  +  +  A+  L     G    SE    P+  + + I   
Sbjct: 88  VFVFVPGLGGNLEQFEPLLKLLDSERKAF--LAFDSPGFGQSSEWNDYPMLKVVELIFVL 145

Query: 90  I-EIINRY-----------CLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVI-RVGLLTP 136
           + +++ ++            L+G+ I+++GHS+G F+   +         V+ R  LLTP
Sbjct: 146 VCDVLKKWPTAVSKDDDTNLLNGRKIVLVGHSMGCFLACHLYEQHLAILNVVKRFVLLTP 205

Query: 137 TVIDIHKSEKGVKL 150
               I +  K  +L
Sbjct: 206 PKAHIEQLSKDRRL 219

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 27  GEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQI 86
           GE P+++F  G  G +  +EP L  + E N  +  + +   G+   SEE      L  Q+
Sbjct: 76  GEGPIYLFFHGLGGNLTQFEPLLRLLGELNEGFVAMDLPGFGL---SEEQDGYQML--QV 130

Query: 87  DHKIEIINRYCLDGKPIIIMGHSVGAFMV 115
              I        D K II++GHS+G  +V
Sbjct: 131 TQVIHDAFLQITDHKKIILVGHSMGCHLV 159

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 12/128 (9%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQIDHKI 90
           +F+F+PG  G +E +EP L  I     A+  L +   G +S   +   +  +E       
Sbjct: 89  VFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVLVC 148

Query: 91  EIINRY-----------CLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVI-RVGLLTPTV 138
           +++ ++             D + I++ GHS+G F+   +        KV+ ++ LLTP  
Sbjct: 149 DVLKKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTPPK 208

Query: 139 IDIHKSEK 146
             I +  K
Sbjct: 209 AHIEQLSK 216

>NDAI0J01480 Chr10 (343226..344968) [1743 bp, 580 aa] {ON} Anc_8.245
           YDR101C
          Length = 580

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 125 KSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSI 184
           K+KV   G+  PT ID+ +   G        WCP   +V +  NW  F  L  +  T SI
Sbjct: 81  KNKVNERGIAIPTCIDVDQIASG--------WCPEIDDVENIKNWNKFANLETSPFTSSI 132

Query: 185 ISLL 188
             +L
Sbjct: 133 TGVL 136

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 15/142 (10%)

Query: 23  NSSGGEA----PLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS- 77
           N+ G E     P++VF+PG  G ++ YEP L  +   N  +  +G    G     E+ S 
Sbjct: 84  NNVGSEVLTNKPIYVFLPGLGGSLDQYEPLLRLMDILNEKF--IGFDLPGFGGSEEDTSE 141

Query: 78  ------PVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKS--KVI 129
                  V  +  +    I   N    D   + ++GHS+G ++V     S + K+  K+ 
Sbjct: 142 GGYNMIKVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKIS 201

Query: 130 RVGLLTPTVIDIHKSEKGVKLT 151
           ++ L +P    I   +K  +L 
Sbjct: 202 QLILTSPPKKKIEPLDKNNRLN 223

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQIDHKI 90
           LF+FI G  G +E +EP L  +   +  +  L +   G +   +E    Y + + ++   
Sbjct: 85  LFLFIHGLGGELEQFEPLLRLVDAMDQRFLALDLPGFGKSDEWDE----YPMLKVVETIE 140

Query: 91  EIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTP 136
           EI  ++  +   I+++GHS+G ++      +      + R+ LL+P
Sbjct: 141 EIAAKF--NAAKIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQ---QID 87
           LF+ IPG  G +E +EP +  I   N  +  L I   G    SE+ S  YS+      ID
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNF--LAIDLPGFGK-SEDYSN-YSMTHIATLID 137

Query: 88  HKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTP 136
             +E +     D   I +MGHS+G  +          K  V ++ L++P
Sbjct: 138 QMLETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 61/135 (45%), Gaps = 10/135 (7%)

Query: 18  RNAGLNSSGGEA----PLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS 73
           RN G + S G+     PL++FI G  G++E +EP L  +      +  L +   G +   
Sbjct: 74  RNFGTSDSEGDGNHNEPLYLFIHGLGGVLEQFEPLLRLLDLNENKFLALDLPGFGKSDEY 133

Query: 74  EEVSPVYSLEQQIDHKIEIINRYCLD--GKPIIIMGHSVGAFMVQKITTSRRLKSKVIRV 131
           E+    Y++   I     I++R   +     I+++GHS+G ++   +      +    ++
Sbjct: 134 ED----YNMFDVISIIHTIVDRLIPERTTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKL 189

Query: 132 GLLTPTVIDIHKSEK 146
             L+P    + + EK
Sbjct: 190 VFLSPPKPQLDQLEK 204

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSE-EVSPVYSLEQQIDHK 89
           +++FI G  G  E +EP L  +   +  +  L +   G     E E   ++ + + I++ 
Sbjct: 84  VYLFIHGLGGNFEQFEPLLRLVDASDKKF--LTMDLPGFGKSDELESYGMFDIIEVINY- 140

Query: 90  IEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTP 136
             +  ++  DGK I ++GHS+G  +          +  + ++ LLTP
Sbjct: 141 --VAKKFIKDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>KLLA0E23035g Chr5 (2051146..2052123) [978 bp, 325 aa] {ON} weakly
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 325

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 11/111 (9%)

Query: 18  RNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQ-IHEKNP--AWEILGISHAGMNSCSE 74
            N G   S     L + I G  G +  YEP +++ +H+  P  A+++ G         S+
Sbjct: 67  HNLGSYKSKSVDKLVLMIHGLGGNLTHYEPLISKYVHDHTPFLAFDLPGFGD------SD 120

Query: 75  EVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLK 125
           E+   Y++   I    E++++ C   K I I+GHS+GA +  ++  +  +K
Sbjct: 121 ELDQ-YNMGDVISLICELVHKMC-QCKTISIIGHSMGALLSVQVANTISVK 169

>SAKL0E02662g Chr5 complement(213396..213938) [543 bp, 180 aa] {ON}
           some similarities with uniprot|P28321 Saccharomyces
           cerevisiae YKL094W YJU3 Protein of unknown function
           localizes to lipid particles
          Length = 180

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 29/54 (53%)

Query: 86  IDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVI 139
           +DH I++  + C DG+ + + GHS+G  ++     S + K ++  +    P ++
Sbjct: 112 LDHFIDLNLKECGDGEKLFLFGHSMGGGIILNYGCSGKYKQQIAGIVCTGPLIV 165

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

Query: 24  SSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS-PVYSL 82
           S+     L +FI G  G ++ + P L  +      +  + I   G     E    P+  +
Sbjct: 77  STANGKTLSIFIHGLGGSLDQFFPLLKLLDLSEKYF--VAIDLPGFGKSDEHTDYPMIQV 134

Query: 83  EQQIDHKI-EIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLT---PTV 138
            + ID  I E++N   L    + ++GHS+G ++     T    K ++ +V LL    P +
Sbjct: 135 VKHIDAVISELLNEARLAFDTVRLIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAPPKPEM 194

Query: 139 IDIHKSEKGVKLT 151
           I+++K ++ V++ 
Sbjct: 195 IELNKDKRLVQVA 207

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 66/144 (45%), Gaps = 14/144 (9%)

Query: 19  NAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSP 78
           N  L ++  ++ ++VFI G  G +  +EP L  +   N  +  + +   G    S+EV  
Sbjct: 119 NLNLRNAKSDSVVYVFIHGLGGTLAQFEPLLKLLSLLNKGFFSMDLPGFG---SSDEVES 175

Query: 79  VYSLEQQIDHKIEIINRYCLDGKP---IIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLT 135
              LE      + I+ +      P   ++++GHS+G ++     ++ + +     + LL 
Sbjct: 176 YGMLE-----IVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLA 230

Query: 136 PTVIDIHKSEKG---VKLTSITRW 156
           P  +D+ + E+    V ++ + RW
Sbjct: 231 PPSLDLPQVERTSTRVLMSLLFRW 254

>SAKL0E02596g Chr5 complement(208748..209704) [957 bp, 318 aa] {ON}
           similar to uniprot|P28321 Saccharomyces cerevisiae
           YKL094W YJU3 Protein of unknown function localizes to
           lipid particles
          Length = 318

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 29/54 (53%)

Query: 86  IDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVI 139
           +DH I++  + C DG+ + + GHS+G  ++     S + K ++  +    P ++
Sbjct: 112 LDHFIDLNLKECGDGEKLFLFGHSMGGGIILNYGCSGKYKQQIAGIVCTGPLIV 165

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 30  PLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQIDHK 89
           PL +FI G  G +  +EP L   H K   +  L +   G    S+E+   YS++  I+  
Sbjct: 82  PLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQ---SDELES-YSMKSVIETI 137

Query: 90  IEIINRYCLDGK--------PIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTP 136
             +++    + K         +I+ GHS+G ++      +      + ++ LL+P
Sbjct: 138 RSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 15  LYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEIL 62
           L +   GLN    E  +   + G P ++++Y+    + H  NP +E+L
Sbjct: 98  LVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVL 145

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 21  GLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEIL 62
           GLN    E  +   + G P ++++Y+   ++ H+ NP +E+L
Sbjct: 96  GLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVL 137

>Skud_4.360 Chr4 complement(627265..629046) [1782 bp, 593 aa] {ON}
           YDR101C (REAL)
          Length = 593

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 8/45 (17%)

Query: 125 KSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNW 169
           K+KV   G+  PT IDI +   G        WCP   +  + LNW
Sbjct: 81  KNKVNERGIAVPTTIDIDQISGG--------WCPEIDDTQNLLNW 117

>KLTH0D10318g Chr4 complement(853996..856611) [2616 bp, 871 aa] {ON}
           similar to uniprot|P33894 Saccharomyces cerevisiae
           YOR219C STE13 Dipeptidyl aminopeptidase Golgi integral
           membrane protein that cleaves on the carboxyl side of
           repeating -X-Ala- sequences required for maturation of
           alpha factor transcription is induced by a- factor
          Length = 871

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 204 VTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWW 247
            TNS+  ++     +E+V+  R DW Y++E L     +D  +WW
Sbjct: 271 ATNSQGFRRLTADGSEDVKNGRPDWVYEEEVLA----SDQAVWW 310

>Smik_4.345 Chr4 complement(616569..618326) [1758 bp, 585 aa] {ON}
           YDR101C (REAL)
          Length = 585

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 8/45 (17%)

Query: 125 KSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNW 169
           K+KV   G+  PT IDI +   G        WCP   +  + LNW
Sbjct: 81  KNKVNERGIAIPTTIDIDQISGG--------WCPEIDDTQNLLNW 117

>YDR101C Chr4 complement(655686..657467) [1782 bp, 593 aa] {ON}
           ARX1Shuttling pre-60S factor; involved in the biogenesis
           of ribosomal large subunit biogenesis; interacts
           directly with Alb1; responsible for Tif6 recycling
           defects in absence of Rei1; associated with the
           ribosomal export complex
          Length = 593

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 8/45 (17%)

Query: 125 KSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNW 169
           K+KV   G+  PT IDI +   G        WCP   +  + LNW
Sbjct: 81  KNKVNERGIAIPTTIDIDQISGG--------WCPEIDDTQNLLNW 117

>KLTH0E15092g Chr5 complement(1341132..1341998) [867 bp, 288 aa]
           {ON} similar to uniprot|P38260 Saccharomyces cerevisiae
           YBR101C FES1 Hsp70 (Ssa1p) nucleotide exchange factor
           cytosolic homolog of Sls1p which is the nucleotide
           exchange factor for BiP (Kar2p) in the endoplasmic
           reticulum
          Length = 288

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 166 TLNWALFEKLLPTKITKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIR 225
           +L  +  EKL   KI +S +  L  DP+S +     +L   S+ +   L L   E+R +R
Sbjct: 206 SLTESFLEKLRERKIIESTLKFL--DPESSVYVVDRVLNFLSQLITSGLRLNEAEMRQLR 263

Query: 226 SDWAYQKEFLLLCQEND 242
           S +   KE      E+D
Sbjct: 264 SGFPSIKELEERLNEDD 280

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 27  GEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVSPVYSLEQQI 86
           G  P++VFI G  G +  +EP L  +   N  +  L I   G     E  S  YS+   I
Sbjct: 76  GTGPVYVFIHGLGGTLTQFEPLLRVLDVLNEGF--LTIDLPGFGHSDELDS--YSM-LDI 130

Query: 87  DHKIEIINRYCLDGKPIIIMGHSVG 111
              I  +       K +I++GHS+G
Sbjct: 131 AKIIREVLVETTKNKKVIVVGHSMG 155

>TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.114
           YGL014W
          Length = 794

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 83  EQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIH 142
           EQ  +   E I  +C++     +M  S G +++QK+     L+ ++I + +  P  IDI 
Sbjct: 497 EQAANTIFEEIKNHCIE-----LMTDSFGNYLIQKLLERITLEQRLIIINISAPYFIDIA 551

Query: 143 KSEKGVK 149
            +  G +
Sbjct: 552 LNPHGTR 558

>Skud_15.385 Chr15 complement(691276..694071) [2796 bp, 931 aa] {ON}
           YOR219C (REAL)
          Length = 931

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 202 LLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWW 247
           L   ++R+ K+     +EEV   + DW Y++E L     +D  IWW
Sbjct: 323 LQSVSARYAKKLTEDGSEEVFNAKPDWIYEEEVLA----SDKAIWW 364

>TPHA0D03870 Chr4 complement(808388..812176) [3789 bp, 1262 aa] {ON}
            Anc_1.100 YNL257C
          Length = 1262

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 61/134 (45%), Gaps = 6/134 (4%)

Query: 110  VGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEKGVKL-TSITRWCPSFHNVVSTLN 168
            +G  ++ K   S    + +I + LL  ++  I    +G+K+  S+ +     HN +S+ +
Sbjct: 1080 IGCILLAKQLLSLMSVNVLIYITLLFSSLTSIFYIGRGIKVHVSMKKSHNILHNFISSSD 1139

Query: 169  -WALFEKLLPTKITKSIISLLVDDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSD 227
             W +  +L  T + + I ++ V+DP    G   ++   NSR          +E+ + R++
Sbjct: 1140 SWKMQRELNITTVKELIHNITVEDPDLAFGTFNKIDKANSR----TYAETKKELNIKRNE 1195

Query: 228  WAYQKEFLLLCQEN 241
              +    L   ++N
Sbjct: 1196 LLFDLNMLESLEQN 1209

>Suva_8.271 Chr8 complement(491197..493989) [2793 bp, 930 aa] {ON}
           YOR219C (REAL)
          Length = 930

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 206 NSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWW 247
           NSR+ K+     ++++   + DW Y++E L     +D  IWW
Sbjct: 328 NSRYAKKLTHDGSKDIFNAKPDWIYEEEVLA----SDQAIWW 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,267,653
Number of extensions: 1392937
Number of successful extensions: 3497
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3528
Number of HSP's successfully gapped: 49
Length of query: 302
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 193
Effective length of database: 40,982,805
Effective search space: 7909681365
Effective search space used: 7909681365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)