Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212173.487ON30330316310.0
KLTH0F14718g3.487ON3003029271e-125
SAKL0F02882g3.487ON2982987214e-94
NCAS0E008403.487ON3363216161e-77
Kpol_1017.93.487ON3103145947e-75
Suva_7.4153.487ON3133095913e-74
Smik_6.2233.487ON3133085817e-73
YGR127W3.487ON3123135703e-71
CAGL0I10582g3.487ON3193175704e-71
KLLA0E04687g3.487ON3063115685e-71
KAFR0C019303.487ON3133075661e-70
NDAI0G009703.487ON3323285575e-69
Skud_7.4383.487ON3133085557e-69
TDEL0D055503.487ON3103085356e-66
Ecym_12423.487ON3113115261e-64
AFR305W3.487ON3093095252e-64
TPHA0D032603.487ON3143135252e-64
KNAG0B008403.487ON3133105079e-62
TBLA0D029903.487ON3183114591e-54
ZYRO0D10098g3.487ON2762534412e-52
CAGL0B02761g4.200ON57892721.7
NCAS0J012204.200ON583119693.3
KAFR0A062104.200ON581116693.9
SAKL0E05764g2.361ON42076676.5
KAFR0D002901.30ON408133666.9
KNAG0I015201.371ON57363668.4
Skud_12.1338.19ON15155639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21217
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   632   0.0  
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   361   e-125
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   282   4e-94
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   241   1e-77
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   233   7e-75
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   232   3e-74
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   228   7e-73
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   224   3e-71
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   224   4e-71
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   223   5e-71
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   222   1e-70
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   219   5e-69
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   218   7e-69
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   210   6e-66
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   207   1e-64
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   206   2e-64
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   206   2e-64
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   199   9e-62
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   181   1e-54
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   174   2e-52
CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} simila...    32   1.7  
NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {...    31   3.3  
KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON} Anc_4...    31   3.9  
SAKL0E05764g Chr5 (474594..475856) [1263 bp, 420 aa] {ON} highly...    30   6.5  
KAFR0D00290 Chr4 complement(39701..40927) [1227 bp, 408 aa] {ON}...    30   6.9  
KNAG0I01520 Chr9 complement(293083..294804) [1722 bp, 573 aa] {O...    30   8.4  
Skud_12.133 Chr12 (255859..256314) [456 bp, 151 aa] {ON} YLR068W...    29   9.3  

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRIVSRGNVTMRYLTDKQPASDWNSYAKFASKCPDI 120
           GANRNGRIAVILNLRTGNTNQTKTKRIVSRGNVTMRYLTDKQPASDWNSYAKFASKCPDI
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRIVSRGNVTMRYLTDKQPASDWNSYAKFASKCPDI 120

Query: 121 KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIELAEKLM 180
           KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIELAEKLM
Sbjct: 121 KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIELAEKLM 180

Query: 181 RDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDLGAS 240
           RDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDLGAS
Sbjct: 181 RDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDLGAS 240

Query: 241 VPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKINPDLQT 300
           VPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKINPDLQT
Sbjct: 241 VPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKINPDLQT 300

Query: 301 VTS 303
           VTS
Sbjct: 301 VTS 303

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 229/302 (75%), Gaps = 9/302 (2%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+AS AHP+YSLI ISNRDEF ER+T  TCLNHDDY++SPLD  L+ NN+P LGTWC
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-----VSRGNVTMRYLTDKQPASDWNSYAKFAS 115
           G NR GR+AVILNLR    N+   KRI     +SRG+V M+YL D+ P++DWNS+ KF S
Sbjct: 61  GVNRKGRVAVILNLR----NKEPAKRIPVKSPISRGSVPMKYLMDRGPSTDWNSFEKFVS 116

Query: 116 KCPDIKSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIEL 175
           K P I  CEFNMFYGDC +G+YT IDS G+S E L +  P LV+SND I+S+++WPK++ 
Sbjct: 117 KYPQITECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQK 176

Query: 176 AEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSE 235
           A+ L+++LV+ S +DSE++L+ +CF+LAS+ +   +D+ DKE+ T S+IF+PP+E+P+  
Sbjct: 177 ADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKV 236

Query: 236 DLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKIN 295
           D+GAS+PCGRFYGTRSQIV+LV + +++I F E VL+DSD E       +PK+ + + ++
Sbjct: 237 DVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLH 296

Query: 296 PD 297
            D
Sbjct: 297 VD 298

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  282 bits (721), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCILL ++AHPRYSLILISNRDEF ER+T  TC++ DD++VSP DM++      N GTWC
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGR-NFGTWC 59

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-VSRGNVTMRYLTDKQ-PASDWNSYAKFASKCP 118
           G N++G++AVILNLR  +    K      SRG V M++L  K    ++W+SY KF+   P
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 119 DI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIELAE 177
            I K+  FN+FYGDC  G+Y  I S   + +  ++ + Y+V+SND I S  KW KI LA+
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAK 179

Query: 178 KLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDL 237
            L+R+LV  SV+D++D +L +CF LASH        +  E VT+  I+VPPL V   +DL
Sbjct: 180 NLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDL 239

Query: 238 GASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKIN 295
             S+PCG++YGTRSQIV+LVSK+ K + FVE VLY  D +   +   NPK+ + ++ +
Sbjct: 240 DVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFD 297

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  241 bits (616), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 202/321 (62%), Gaps = 25/321 (7%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDM--TLKDNNEPNLGT 58
           MCILLA++AHP+Y LILISNRDEF ER+T  +C ++DD+++SP DM  + + + +   GT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTDKQP-ASDWNSYAKFA 114
           W G NR+ +IA ILNL+    +Q   K++V   SRG +   +L++     + W++Y KF 
Sbjct: 77  WIGINRDAKIATILNLKL--ESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFD 134

Query: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND-------SIES 166
            K   + K+ +FN FYGD  + +Y  IDS G++F+VL S +PYL +SND       ++E 
Sbjct: 135 GKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-SGDPYLTVSNDMFATGGITVER 193

Query: 167 AT-----KWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH---KQDYNVDHMDKEK 218
           A+     +W KI+  + L++DLV +S +  ED L+ +CF LAS    +   N        
Sbjct: 194 ASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNST 253

Query: 219 VTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPET 278
           +    IFVPPLE   ++D+G S+  G++YGTRSQIV+L+SK  + ++ VEH+LY SD + 
Sbjct: 254 LPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDI 313

Query: 279 THFCAANPKKCVSYKINPDLQ 299
            H+ + NPK+  S++  P++Q
Sbjct: 314 QHYSSTNPKEVKSFEFKPNIQ 334

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  233 bits (594), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 199/314 (63%), Gaps = 30/314 (9%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDY--VVSPLDMTLKDNNEPN--- 55
           MCILLAS  HP Y LILISNRDEF++R+T  TC N  +Y  ++ P DM+   +NE N   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMS--KSNEKNVNK 58

Query: 56  LGTWCGANRNGRIAVILNLRTGNTNQTK---TKRIVSRGNVTMRYLTDKQPAS--DWNSY 110
           +GTWCG N  GR++ ILNL+  ++ Q+    TK+  SRG + +++L +K+  S  +W+SY
Sbjct: 59  IGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKK--SRGALPIKFLDNKETDSLLNWDSY 116

Query: 111 AKFASKCPDIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSI----- 164
            KF  + P +K + +FN FYGD + G Y  IDS G + EVL   NPYLVISND       
Sbjct: 117 EKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNG 176

Query: 165 ESATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHK---QDYNVDHMDKEKVTS 221
           +S  +W KI LA+ L++ L    + ++EDDL+ +CF +AS     +D  +  +D  ++ +
Sbjct: 177 KSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDL-IKDVDVRELMT 232

Query: 222 SNIFVPPLEV---PKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPET 278
             I VPPL V    + E +GAS+P G++YGTRSQIV+LV+K    ++F+E +LY+SD + 
Sbjct: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292

Query: 279 THFCAANPKKCVSY 292
           T    ++P + ++Y
Sbjct: 293 TTQKLSSPIQDLTY 306

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  232 bits (591), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 182/309 (58%), Gaps = 25/309 (8%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+A+ AHP Y LILISNRDEF+ER+T  TC ++DD+++SP D+      +   GTW 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GANRNGRIAVILNLRTGNTNQ-TKTKRIVSRGNVTMRYLTD-KQPASDWNSYAKFASKCP 118
           G N+ G++A ILNL+  +    TK+K   SRG +   +LT  K    DW+ Y KF     
Sbjct: 61  GINKEGKLATILNLKMDDQRSCTKSK---SRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117

Query: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVL-----RSQNPYLVISNDSIE-----SA 167
            +++  +FN FYGD     Y  IDS GH+F+VL     R  + Y+VISN         S 
Sbjct: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177

Query: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--------KQDYNVDHMDKEKV 219
             W K+++A   +  L+ D++   E+ L++ CF LAS         K D  +  +    V
Sbjct: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDL-LQMLVDPNV 236

Query: 220 TSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETT 279
           T + I+VPPL  P  +DLGAS+P G +YGTRSQIV+LVSK+   + F+E VLY SD + +
Sbjct: 237 TMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVS 296

Query: 280 HFCAANPKK 288
           H+ A+ PK+
Sbjct: 297 HYSASAPKE 305

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  228 bits (581), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 180/308 (58%), Gaps = 23/308 (7%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC ++DD+++SP D+          GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRIVSRGNVTMRYLTDKQP-ASDWNSYAKFASKCPD 119
           G N+ G++A ILNL+ G+   T   +  SRG +   +L++ +    DW+SY+KF +    
Sbjct: 61  GINKEGKLATILNLKLGSERSTIKSK--SRGLLPYIFLSNHEANFKDWDSYSKFGNHYDG 118

Query: 120 IKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIESATK---- 169
           +K+  +FN FYGD     Y  IDS G +F+VL S      + Y+VISN    + +     
Sbjct: 119 LKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEK 178

Query: 170 -WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--------KQDYNVDHMDKEKVT 220
            W K++LA   + DLV D++   E+ +++ CF LAS         K D  +  +    VT
Sbjct: 179 AWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDV-LQMLVDPNVT 237

Query: 221 SSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTH 280
            S I+VPPL  P  +DLGAS+P G FYGTRSQIV+L+SK+     F+E ++Y SD +   
Sbjct: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297

Query: 281 FCAANPKK 288
           +  + PK+
Sbjct: 298 YSVSAPKE 305

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  224 bits (570), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 183/313 (58%), Gaps = 22/313 (7%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC +++D+++SP D+      +   GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GANRNGRIAVILNLRTGN-TNQTKTKRIVSRGNVTMRYLT-DKQPASDWNSYAKFASKCP 118
           G N+ G++A ILNL+  N  N TK++   SRG +   +L+  K    DW++Y KF     
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSR---SRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117

Query: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIESATK--- 169
            +KS  +FN FYGD     Y  IDS G +F+VL S      + Y+V+SN     ++    
Sbjct: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177

Query: 170 --WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHK------QDYNVDHMDKEKVTS 221
             W K+++A   + +LV +++   E+ +++ CF LAS         + +V  M    VT 
Sbjct: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237

Query: 222 SNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHF 281
           + I+VPPL  P  +DLGAS+P G +YGTRSQIV+LVSK+   + F+E VLY SD +   +
Sbjct: 238 NTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297

Query: 282 CAANPKKCVSYKI 294
              +PK+   +K 
Sbjct: 298 SVTSPKEEKRFKF 310

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  224 bits (570), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 183/317 (57%), Gaps = 26/317 (8%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPN--LGT 58
           MCIL A+  HP Y LI+ISNRDEF+ER+T  TC ++DD+++SP D+      + N   GT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTDKQP-ASDWNSYAKFA 114
           W G NR GR+A +LNLR    ++   KR++   SRG +   +L D+Q    DW++YAKF 
Sbjct: 61  WTGVNRKGRVATVLNLRI--CDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFC 118

Query: 115 SKCPDIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVL-RSQNPYLVISN----------- 161
              PDIK + +FN+FYGD K G Y  IDS G++  +  +    YLVISN           
Sbjct: 119 KCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQ 178

Query: 162 DSIESATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLAS-----HKQDYNVDHMDK 216
           D      +W KI+  +++M + V+ + N  ++D++  CF LAS      K     D +  
Sbjct: 179 DINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKS 238

Query: 217 EKVTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDP 276
             VT   I+V PL  P  E++G+ +  G++YGTRSQIV+LV K      F+E ++Y SD 
Sbjct: 239 LGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQ 298

Query: 277 ETTHFCAANPKKCVSYK 293
           + + +  +NPK+ + Y+
Sbjct: 299 DISLYSTSNPKEELRYE 315

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  223 bits (568), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 189/311 (60%), Gaps = 24/311 (7%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL A+ AHP Y LIL+SNRDEF ER+T  TC NHD +++SP DM ++   +   GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQ-GYGTWL 59

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRI----VSRGNVTMRYLT--DKQPASDWNSYAKFA 114
           G NR GRIAVILNL+  +   +++  +     SRG V +++L   D  P  +W+S+ KF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHS---FEVLRSQNPYLVISNDSI-----E 165
            +  ++ ++  F +FYGD KS +Y  ID   HS   FE +     ++VISND       E
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME----HMVISNDIFHCAVGE 175

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIF 225
             ++W K E    L+  L +++   ++++LL +CF L S+   +N +  D + VT+S+I+
Sbjct: 176 HTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSN-HTFN-EGEDVDSVTTSSIY 233

Query: 226 VPPLEVPKSED-LGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAA 284
           VPPL + K  D +G S+P G +YGTRSQIV+LV K D  + + EHV+Y+SD +   +   
Sbjct: 234 VPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDK-DNRVTYEEHVIYESDEDCETYSFM 292

Query: 285 NPKKCVSYKIN 295
           +PK+ + ++ N
Sbjct: 293 DPKEVIQFQFN 303

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  222 bits (566), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 188/307 (61%), Gaps = 20/307 (6%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNL-GTW 59
           MCIL A+ +H  Y LILISNRDE++ R+T  TC ++D++++SP DM+ ++N+   + GTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  CGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYL----TDKQPASDWNSYAK 112
            G N+ G+IA ILNLR  ++     K +V   SRG +   +L    T++    +W ++ K
Sbjct: 61  LGMNKKGKIATILNLRRFSS--IDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEK 118

Query: 113 FASKCPDIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND------SIE 165
           F SK P ++S  +FN FYGD K G+Y  IDS G++F+VL + N  ++ISND        E
Sbjct: 119 FKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYE 178

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH---KQDYNVDHMDKEKVTSS 222
               W KI++  + +   ++++   +ED++LA+CF LAS+         +    +++ + 
Sbjct: 179 GKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAE 238

Query: 223 NIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282
            I+VPPL+V   ED+G +   G++YGTR+QIVVLV K+ K +  VEH +++SD E   + 
Sbjct: 239 TIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYS 298

Query: 283 AANPKKC 289
             NPK+ 
Sbjct: 299 GLNPKEV 305

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  219 bits (557), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 124/328 (37%), Positives = 186/328 (56%), Gaps = 38/328 (11%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMT--LKDNNEPNLGT 58
           MCILLA++AHP Y LILISNRDEF++R+T  +C ++DD+++SP DM    K N++   GT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTD--KQPASDWNSYAKF 113
           W G N++G+IA +LNL+   +     K++V   SRG +   YL+D  +   ++W+ Y  F
Sbjct: 61  WLGINKDGKIATVLNLKLNKS--LSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118

Query: 114 ASKCPDIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND---------S 163
             K P ++S  +FN+FYGD K   Y  +DS G++   L S   YLV+SND          
Sbjct: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178

Query: 164 IESATK--------------WPKIELAEKLMRDLVRDSV--NDSEDDLLARCFSLASHKQ 207
           ++S  K              W K++L   L++ LV  S+     ED +++ CF L+S   
Sbjct: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238

Query: 208 DYNVDH---MDKEKVTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSI 264
               DH        + +  I VPPL    ++D+G S+P G +YGTRSQIV+L+ +    +
Sbjct: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298

Query: 265 RFVEHVLYDSDPETTHFCAANPKKCVSY 292
           +F EHV+Y SD +   F  ANPK+ V +
Sbjct: 299 KFAEHVIYTSDSDIKTFSPANPKETVRF 326

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  218 bits (555), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 173/308 (56%), Gaps = 23/308 (7%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC ++DD+++SP D+      +   GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GANRNGRIAVILNLRT-GNTNQTKTKRIVSRGNVTMRYL-TDKQPASDWNSYAKFASKCP 118
           G NR G++A ILNL+  G  +  K+K   SRG +   +L T K    +W++Y KF     
Sbjct: 61  GINREGKLATILNLKLDGQRDTIKSK---SRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117

Query: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIE-----SA 167
            + +  +FN FYGD     Y  IDS G +F VL S      N Y+ +SN         S 
Sbjct: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177

Query: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH-------KQDYNVDHMDKEKVT 220
             W K+++A   +  LV  +++  E+ +++ CF LAS         +   +  +    V 
Sbjct: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237

Query: 221 SSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTH 280
            + I+VPPL  P  +DLGAS+P G +YGTRSQIV+LVSK    + F+E +LY SD +  H
Sbjct: 238 MNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297

Query: 281 FCAANPKK 288
           +  A PK+
Sbjct: 298 YSVATPKE 305

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  210 bits (535), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 181/308 (58%), Gaps = 14/308 (4%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60
           MCIL+A+S HP+Y L+L+SNRDE+  R+        D++++ PLD  L  + E +LGTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGE-DLGTWI 59

Query: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-VSRGNVTMRYLTDKQP-ASDWNSYAKFASKCP 118
           GANR+G+I  +LNL+  +  + +      SRG + + +L+ +     DW++Y KF  +  
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 119 DIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNP-YLVISNDSIESATK----WPK 172
            ++ + +FN FYGDC  GDY  IDS G++ +VL   N  Y+V+SND  +  +     W K
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDK 179

Query: 173 IELAEKLMRDLVRDSVNDSEDDLLARCFSLAS-----HKQDYNVDHMDKEKVTSSNIFVP 227
           I LA++ +  LVR+  +  ED  +  CF +AS      K D+   +M   +++   +FVP
Sbjct: 180 ISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVP 239

Query: 228 PLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPK 287
           PL+    + LGASVP G +YGTRSQ V+LVSK+   I +VE +++DSD +   +   + K
Sbjct: 240 PLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYK 299

Query: 288 KCVSYKIN 295
           +   Y  +
Sbjct: 300 EQKRYDFD 307

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  207 bits (526), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 178/311 (57%), Gaps = 18/311 (5%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDN------NEP 54
           MCILLA++ HP Y LILISNRDEF ER+T  TC + D  +++P D++  +N       E 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  NLGTWCGANRNGRIAVILNLR--TGNTNQTKTKRIVSRGNVTMRYLTDKQPAS--DWNSY 110
           + GTW G NR G ++V+LNL+  +   N     R  SRGNVT+ +L D    +   WN+Y
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNR-KSRGNVTVAFLRDLSNGNWDKWNNY 119

Query: 111 AKFASKCPDIKSCE-FNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSI---ES 166
            KF+     +   + F +FYGD K+GD+  IDS   S     S+ PY+VISN  +   + 
Sbjct: 120 EKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDE 179

Query: 167 ATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ-DYN-VDHMDKEKVTSSNI 224
             +W K+   E+L+++LV+ ++N S++ LL +CF LA   Q D N V  +    +    I
Sbjct: 180 GPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTI 239

Query: 225 FVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAA 284
           FVP L+   +  +G S   G +YGTR+ IV+LV   +  +   EHV++DSD +     A 
Sbjct: 240 FVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNH-VTMHEHVIHDSDKDIGLSSAM 298

Query: 285 NPKKCVSYKIN 295
           NPK  V+Y+ +
Sbjct: 299 NPKTKVAYEFD 309

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 184/309 (59%), Gaps = 18/309 (5%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKD----NNEPNL 56
           MCIL A++AHP+Y L+LISNRDE+  R+T  TC +H+D +++P DM L+D    ++    
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWCGANRNGRIAVILNL--RTGNTNQTKTKRIVSRGNVTMRYLT--DKQPASDWNSYAK 112
           GTW G NR G ++V+LNL  +  + +   + R  SRG VTM YL   D      WN+Y K
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHR-HSRGAVTMEYLKDFDHNNWDSWNTYEK 119

Query: 113 FASKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISN---DSIESAT 168
           F +  P + K+  F  FYGD  +  ++ I+S G + +   SQ+PY V+SN   D  ++  
Sbjct: 120 FGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKALG 178

Query: 169 KWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVD--HMDKEKVTSSNIFV 226
           +WPK+    +L + ++++S++ SE++LL RCF+LAS+ Q  +     +  + +    IFV
Sbjct: 179 QWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIFV 238

Query: 227 PPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANP 286
           P L    S     S   G +YGTRS IV+LVS ED ++   EHV++DSD +   +   NP
Sbjct: 239 PAL-YNLSGQANLSFAAGMYYGTRSTIVMLVS-EDGNVVTREHVIHDSDQDLDSYSILNP 296

Query: 287 KKCVSYKIN 295
           K+ V+++ +
Sbjct: 297 KEQVTHRFS 305

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/313 (38%), Positives = 184/313 (58%), Gaps = 19/313 (6%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDD--YVVSPLDMTLKDNNEPNLGT 58
           MCIL  + +HP Y LILISNRDEF++R+T  +C N      V+ P D++  + +    GT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WCGANRNGRIAVILNLRTG-NTNQTKTKRIVSRGNVTMRYLTDKQPAS--DWNSYAKFAS 115
           WCG N  GR++ +LNL+   N  + K  R  SRG + +++L +++  S  DWNSY+KF  
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 116 KCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNP----YLVISNDSIESATK- 169
           + PD+ K+  FN+F GD K  +Y  IDS G +  +L  ++      +VISN    S  K 
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKE 180

Query: 170 -WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ---DYNVDHMDKEKVTSSNIF 225
            W KI   EKLM + +   + D E+ ++  CF +AS  +   +Y   H D   + +  +F
Sbjct: 181 RWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTETVF 239

Query: 226 VPP--LEVPKSED-LGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282
           VPP  LE P  +D +GAS+P G+FYGTRSQIV+LV+KE  ++R++E VLY+ D + +   
Sbjct: 240 VPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKAG 299

Query: 283 AANPKKCVSYKIN 295
              P   ++++ N
Sbjct: 300 IEKPINELNFEYN 312

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  199 bits (507), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 177/310 (57%), Gaps = 15/310 (4%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMT--LKDNNEPNLGT 58
           MCILL +  HP Y L+LISNRDEF ER T  T  +  DY++SP DMT  L D  +   GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WCGANRNGRIAVILNLR-TGNTNQTKTKRIV---SRGNVTMRYLTDKQPASDWNSYAKFA 114
           W G NR GR++ +LNL+  G   +  +K  V   SRG +   +L+D+     W+S+ KF 
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120

Query: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVL-RSQNPYLVISNDSIES-----A 167
            + PD+ KS +FN+F GD +  DY  +DSSG++F VL  +    +V+SND+ +       
Sbjct: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180

Query: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--KQDYNVDHMDKEKVTSSNIF 225
           ++W K++L +  + +LV  +VN  +   + +CF  AS    +  + D     +V S+ IF
Sbjct: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240

Query: 226 VPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAAN 285
           VPPL+    +D+G +   G ++GTRSQ+V LVSK+ + +   E +L+ SD +       N
Sbjct: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300

Query: 286 PKKCVSYKIN 295
           PK+   +  +
Sbjct: 301 PKEVKQFTFD 310

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  181 bits (459), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 168/311 (54%), Gaps = 46/311 (14%)

Query: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTL--------KDNN 52
           MCILL ++AHP Y LILISNRDE  ER+T  TC NH+  ++ P DM+          +  
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  EPNLGTWCGANRNGRIAVILNL-------RTGNTNQTKTKRIVSRGNVTMRYLTD-KQPA 104
           +   GTWCG N++G+I  +LNL       R G+ N +    + SRG + ++YL D     
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS----LQSRGLIPIKYLCDFDHGF 116

Query: 105 SDWNSYAKFASKCPDI--KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND 162
            DWN+Y KF  +   I  K   FN+F GD KS +Y+ I+S G S  VL  +NPY+V+SN 
Sbjct: 117 QDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNI 176

Query: 163 SIESATK---WPKIELAEKLMRDLVRDSVNDSEDD---LLARCFSLAS------HKQDYN 210
           +     K   W KI+   KL+  L+ D +++S  D   +L  CF ++S       K D N
Sbjct: 177 NWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGN 236

Query: 211 VDHMDKEKVTSSNIFVPPLEVPKSE---------DLGASVPCGRFYGTRSQIVVLVSKED 261
           ++ +++   T   IFVPPL+  + E            A     ++YGTRSQIVVL  ++ 
Sbjct: 237 IERLEQ---TKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKS 293

Query: 262 KSIRFVEHVLY 272
             + FVE +L+
Sbjct: 294 NKVTFVERILH 304

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  174 bits (441), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 150/253 (59%), Gaps = 14/253 (5%)

Query: 56  LGTWCGANRNGRIAVILNLRTGNTNQTKTK-RIVSRGNVTMRYLTDKQ-PASDWNSYAKF 113
            GTWCG N++GR+  +LNL+     Q      + SRG V   +L+        WNSY KF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 114 ASKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVL-----RSQNPYLVISND--SIE 165
           A++  ++  + +FN FYGDCK+G Y  IDS   + +VL     +  + Y+V+SND    +
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ--DYNVDHMDKEK-VTSS 222
               WPK++LA+K +R L+ D+VN+ +D  +++CF +AS     D+  + + K   VT  
Sbjct: 143 GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSDVTKQ 202

Query: 223 NIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282
           +IFVPPL+ P   +LG +   G FYGTRSQIV+LVSK+ + + FVE VL++SD + +   
Sbjct: 203 SIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQRS 261

Query: 283 AANPKKCVSYKIN 295
             +P + + ++ +
Sbjct: 262 PDHPAEQLKFQFD 274

>CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361c
          Length = 578

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 112 KFASKCPDIKSCEFNMFYGDCKSGDYTAIDSSGHSFE----VLRSQNPYLVI--SNDSIE 165
           KF  +  DI+   F +F GD   GD +  DS    ++    V+R + P+ ++  ++D   
Sbjct: 283 KFVEEVLDIEKPGFVVFSGDQIMGDRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDDEG 342

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLA 197
           S ++W   +LA KL     + S +D++D+   
Sbjct: 343 SLSRWELSKLAMKLPYSRFQISPHDTKDNTFG 374

>NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {ON}
           Anc_4.200
          Length = 583

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 24/119 (20%)

Query: 112 KFASKCPDIKSCEFNMFYGDCKSGDYTAIDSSGHSFE----VLRSQNPYLVI--SNDSIE 165
           +F  K  +++  +  +F GD   GD +  DS     +    V++ + P+ ++  ++D   
Sbjct: 284 EFVKKVLELEDPQLVVFTGDQIMGDRSIQDSETTLLKAIAPVVKRKIPWAMVWGNHDDEG 343

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSE------------------DDLLARCFSLASHK 206
           S T+W   ELA  L   L +    D++                  DDL+A  + L SHK
Sbjct: 344 SLTRWELSELATNLPYSLFQIGTKDTKNNLFGVGNYYIQAQANDSDDLIATFYFLDSHK 402

>KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON}
           Anc_4.200 YLR361C
          Length = 581

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 11/116 (9%)

Query: 112 KFASKCPDIKSCEFNMFYGDCKSGDYTAIDSSGHSFE----VLRSQNPYLVI--SNDSIE 165
           +F  K  D +S +  +F GD   GD +  DS     +    V+R + P+ ++  ++D   
Sbjct: 289 EFIEKVLDNESPQLVVFTGDQIMGDRSIQDSETTLLKALDPVIRRKLPWAMVWGNHDDEG 348

Query: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH-KQDYNVDHMDKEKVT 220
           S ++W   ELA KL   L   S  D++++     F + ++ KQ +N D+ ++  +T
Sbjct: 349 SLSRWQLSELAAKLPYSLFEMSKYDTKNN----KFGVGNYAKQVFNGDNEEEGLIT 400

>SAKL0E05764g Chr5 (474594..475856) [1263 bp, 420 aa] {ON} highly
           similar to uniprot|Q759J7 Ashbya gossypii ADR280W
           ADR280Wp and similar to YDL097C uniprot|Q12377
           Saccharomyces cerevisiae YDL097C RPN6 Essential
           non-ATPase regulatory subunit of the 26S proteasome lid
           required for the assembly and activity of the 26S
           proteasome the human homolog (S9 protein) partially
           rescues Rpn6p depletion
          Length = 420

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 114 ASKCPDIKSCEFNMFYG--DCKSGDY-TAIDSSGHSFEVLRSQNPYLVISNDSIESATKW 170
           A  CP +   E ++  G   C+  DY TA      SFE   + N      N+S E A + 
Sbjct: 194 AIYCPTLTMAELDLMSGILHCEDKDYKTAFSYFYESFESFHNSN------NNSYEKACQV 247

Query: 171 PKIELAEKLMRDLVRD 186
            K  L  K+M +L+ D
Sbjct: 248 LKYMLLSKIMLNLIDD 263

>KAFR0D00290 Chr4 complement(39701..40927) [1227 bp, 408 aa] {ON}
           Anc_1.30 YCL044C
          Length = 408

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 17/133 (12%)

Query: 160 SNDSIESATKWPKIELAEKLMRDLVR------DSVNDSED------DLLARCFSLASHKQ 207
           SND IE   +  K +  + +M DL +      D+ ND+E+      D+     S+   K+
Sbjct: 271 SNDEIEKVIEKNK-QTRDVIMSDLSKEISLQQDNSNDAEEEPGLRQDITKSISSMMEQKR 329

Query: 208 DYNVDHMDKEKVTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFV 267
              V+H     V   N+ + P++V  SED+         +      + L      SI+F+
Sbjct: 330 KQKVEHSSNLLVPPRNVILDPIQVKTSEDID----LNEIWSLYDPWMNLGLDTSLSIKFI 385

Query: 268 EHVLYDSDPETTH 280
             V+  +D ++T 
Sbjct: 386 PTVITPNDAQSTE 398

>KNAG0I01520 Chr9 complement(293083..294804) [1722 bp, 573 aa] {ON}
           Anc_1.371 YFR012W
          Length = 573

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 137 YTAIDSSGHSFEVLRSQNPYLVISNDSIESAT-----KWPKIELAEKLMRDLVRDSVNDS 191
           Y+AIDS GH     R  NP L  +  SI+S+         K     KL+ D++RD  N+ 
Sbjct: 302 YSAIDSDGHGTHNSRKTNP-LNFNPPSIDSSNFSATGMIEKDNQPNKLLEDIMRDQTNNG 360

Query: 192 EDD 194
             D
Sbjct: 361 LPD 363

>Skud_12.133 Chr12 (255859..256314) [456 bp, 151 aa] {ON} YLR068W
           (REAL)
          Length = 151

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 183 LVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDL 237
           +VRD  N+  ++ L R   +   K+ Y +    K+K+T       PL  PK EDL
Sbjct: 88  MVRDEANNQRNEQLER---IRVSKEKYQMREDRKKKLTQRTRTGQPLMGPKIEDL 139

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,382,079
Number of extensions: 1526903
Number of successful extensions: 4062
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4103
Number of HSP's successfully gapped: 38
Length of query: 303
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 194
Effective length of database: 40,982,805
Effective search space: 7950664170
Effective search space used: 7950664170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)