Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.21206singletonON27527514770.0
KLTH0F18502gsingletonON2672685591e-70
SAKL0D08272g1.389ON1491791095e-05
KLTH0G16082g3.190ON1351251018e-05
KAFR0I020901.389ON14661331051e-04
TDEL0B061701.389ON14701061042e-04
Kwal_56.231123.190ON135125963e-04
KLLA0F12166g1.389ON152858980.001
Kpol_1048.731.389ON154976970.002
AER016C3.190ON14765910.002
KLLA0F25740g2.542ON51786920.004
YKL034W (TUL1)2.545ON758107920.004
KLLA0E17711g3.190ON16266890.005
Kpol_1002.72.545ON75464910.006
KLLA0C05874g6.45ON55350910.007
SAKL0C10516g3.190ON14462860.007
ZYRO0E05192g1.389ON152054910.007
CAGL0B05049g1.389ON147068910.008
Ecym_53123.190ON14861860.008
NDAI0B018202.542ON62598900.009
NDAI0A065203.190ON20677880.009
ZYRO0A04906g3.190ON16067860.009
TDEL0H033703.190ON15367860.009
NCAS0I019203.190ON12860850.010
KLTH0G18150g1.389ON155476900.010
Smik_15.1576.45ON550100870.017
NCAS0A04680singletonON27453860.017
TPHA0C042502.542ON55647870.019
Smik_11.2132.545ON75967870.020
Suva_11.1892.545ON758107860.024
TDEL0A031802.542ON56798860.025
KNAG0J012503.190ON20267840.025
NDAI0G052001.389ON158655870.026
Kpol_1045.683.190ON17667830.026
NCAS0A087801.389ON150297860.030
KLLA0C15697g3.405ON30457850.031
TBLA0H002303.22ON133335860.033
KAFR0A012403.190ON17391820.037
Ecym_72442.542ON53255840.040
YOL013C (HRD1)6.45ON55166840.049
NCAS0A125502.542ON57247840.049
TDEL0G042506.45ON51753840.049
Kpol_1014.163.28ON10754780.050
KLLA0E07151g3.28ON11054780.050
ACL019C6.45ON57557840.051
Suva_4.2393.190ON16574810.054
KNAG0C056602.542ON50786830.054
ZYRO0B02244g2.542ON56388830.057
Ecym_30486.45ON67051830.058
CAGL0K02563g2.542ON58653830.058
TDEL0B063402.545ON76264830.066
KNAG0J008503.279ON16248800.068
SAKL0C01760gsingletonON147454830.072
NDAI0G038603.28ON12354780.073
Skud_15.203.28ON12154780.073
TPHA0B036501.389ON157654830.073
SAKL0C03586gsingletonON147454830.074
Smik_15.203.28ON12154780.077
AGL079C2.542ON50655820.077
KNAG0I013801.389ON149374830.078
Skud_4.2433.190ON16567790.089
TBLA0I014902.545ON75064820.090
Skud_15.1486.45ON54867820.091
YOL133W (HRT1)3.28ON12154770.091
Suva_15.263.28ON12254770.097
CAGL0E01567g3.28ON102103760.099
TPHA0P014703.28ON11137760.11
Kpol_1002.82.542ON55847810.11
NCAS0C044803.28ON10932760.11
KAFR0A019902.542ON56047810.11
NDAI0K018102.545ON76293810.12
NCAS0D020106.45ON51064810.12
TDEL0A004703.28ON11842760.13
Suva_15.1596.45ON55066800.13
ZYRO0C03058g3.28ON11632760.13
KLTH0D07150g2.542ON54047800.14
Smik_4.2243.190ON16574770.14
Skud_11.1922.545ON758107800.15
SAKL0A09812g2.545ON75164800.15
Suva_8.422.542ON58547790.17
Ecym_20293.28ON11454740.19
TBLA0B087103.28ON12232750.19
YDL008W (APC11)3.190ON16563760.19
CAGL0L01947g2.545ON75785790.21
KAFR0C017803.28ON11832740.21
Kwal_26.80902.542ON52047780.23
Smik_8.322.542ON58547780.23
Kwal_14.12871.389ON151859790.23
TBLA0B005606.45ON49252780.23
CAGL0I04576g3.190ON14965750.25
YHL010C (ETP1)2.542ON58547780.25
Skud_8.352.542ON58547780.27
KAFR0B014602.545ON76125780.29
SAKL0E01958g6.45ON52462770.30
Kwal_55.220543.28ON11142730.30
ZYRO0C07194g6.45ON55827770.32
TPHA0C042602.545ON75725770.33
TBLA0F032803.405ON55549770.33
ADL181W3.28ON10832720.33
TBLA0A002603.190ON18465750.33
KLTH0D07216g2.545ON74764770.35
SAKL0A09746g2.542ON54847770.36
TPHA0I005908.799ON159156770.36
Kwal_55.220763.22ON128634770.40
KNAG0A070902.545ON76225760.44
AAL039C5.339ON283128750.45
KLTH0F19228g3.28ON11033710.45
KNAG0A012803.28ON11433710.50
Ecym_26583.279ON15949720.58
KAFR0F028406.332ON44547750.58
NCAS0A047602.545ON76163750.58
NDAI0G026308.317ON661104750.62
SAKL0H17116gsingletonON54427750.63
ZYRO0E05632g2.545ON76580750.64
KLLA0F18458g3.279ON14052710.71
Kwal_26.80992.545ON75064740.74
KNAG0I028806.332ON46147740.74
SAKL0D02354g8.808ON33141740.74
SAKL0D03058g3.279ON15546710.79
KNAG0A074303.405ON10251690.80
CAGL0K08052g3.405ON305106730.87
ZYRO0D05830g8.317ON78034740.90
TBLA0G023102.542ON67447730.98
NDAI0I004006.332ON48142731.0
KAFR0C004603.279ON15746701.0
SAKL0C13178g3.28ON13832701.1
Kwal_0.821.348ON64592731.1
CAGL0J03586g6.332ON41142721.1
KLTH0F19338g3.22ON129043731.2
NCAS0D045406.332ON46963721.2
TBLA0F042506.362ON40145721.2
KLLA0F25674g2.545ON75792721.4
YOL138C (RTC1)3.22ON134144721.4
NDAI0E018402.411ON115094721.4
KLTH0C10604g6.45ON51559721.5
Ecym_42508.317ON65768721.5
Kpol_1035.506.45ON60127721.5
CAGL0E02299g6.45ON54527711.6
NCAS0A113503.405ON42890711.6
Ecym_72412.545ON75855721.6
AFR275W2.545ON75356711.7
Kwal_56.225226.45ON51357711.8
Smik_12.3201.389ON155354711.8
KLLA0C08756g6.332ON42747711.9
Suva_10.3441.389ON156063712.0
CAGL0H10274g3.279ON17550682.1
Kpol_478.85.190ON2022203712.1
TPHA0H006403.190ON18060682.1
ZYRO0B12804g4.268ON67047702.2
YLR247C (IRC20)1.389ON155654712.3
KAFR0I028603.22ON136541702.5
AAR049C6.332ON44347692.6
Skud_2.1863.279ON17851682.6
KNAG0A012303.22ON132143702.6
KLLA0E18503gna 1ON65051702.7
TDEL0F02870na 2ON26068692.7
TPHA0C003505.628ON27851692.7
TPHA0F024806.45ON60529692.8
TDEL0A019802.423ON17733672.9
AGL217W8.808ON41455693.0
Kpol_463.71.272ON87382693.0
Kpol_538.53.405ON33544693.1
KLLA0C14344g8.799ON151856693.3
SAKL0G15818g4.268ON64747693.3
Suva_4.1754.268ON70047693.4
Smik_15.163.22ON132643693.4
KLTH0G12408g8.317ON60327693.4
Skud_4.1824.268ON70047693.4
YDL074C (BRE1)4.268ON70047693.4
KAFR0A052406.45ON55327683.6
ZYRO0C17424g3.405ON27349683.7
Smik_4.1624.268ON69847683.9
Skud_12.3281.389ON155754694.0
AER390W5.628ON31644674.1
KAFR0H007103.405ON22875674.3
KNAG0E027406.45ON55627684.3
NDAI0C042305.339ON33064674.4
ZYRO0E06996g3.279ON17228664.4
Kpol_1036.668.317ON66842684.4
TDEL0A074706.332ON40842675.1
Kwal_56.239008.317ON58927675.3
YMR228W (MTF1)8.755ON34141675.3
TDEL0A018502.411ON1138157675.3
CAGL0I01628g1.466ON774117676.1
KLTH0B03652g5.190ON192344676.1
ZYRO0C11176g5.628ON36845666.4
TDEL0F044408.317ON55429666.6
AGR034W3.279ON15948646.7
NCAS0D004002.71ON72343666.7
TBLA0I019603.279ON18429656.7
Kpol_1061.548.247ON84848666.8
CAGL0M08690g5.628ON32847666.9
SAKL0C13332g3.22ON135341676.9
Skud_3.1406.332ON48947667.1
KLTH0F07062g5.339ON28798657.5
YDR143C (SAN1)8.317ON61031667.9
NCAS0B069902.157ON52197667.9
TBLA0E031406.32ON87973668.7
TPHA0A033403.405ON38461659.2
NDAI0A074503.279ON17353639.2
SAKL0G07370g5.628ON32149659.2
SAKL0A01474g6.332ON46847659.4
NDAI0H008405.628ON34158659.6
KLLA0B02981g4.268ON66347659.7
ZYRO0A08932g2.411ON118849659.7
NCAS0C033108.317ON570276510.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21206
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...   573   0.0  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...   219   1e-70
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    47   5e-05
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...    44   8e-05
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    45   1e-04
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    45   2e-04
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    42   3e-04
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    42   0.001
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    42   0.002
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...    40   0.002
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    40   0.004
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    40   0.004
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    39   0.005
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    40   0.006
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    40   0.007
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...    38   0.007
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    40   0.007
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    40   0.008
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...    38   0.008
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     39   0.009
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....    39   0.009
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...    38   0.009
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...    38   0.009
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...    37   0.010
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    39   0.010
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    38   0.017
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      38   0.017
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    38   0.019
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    38   0.020
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    38   0.024
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    38   0.025
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...    37   0.025
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    38   0.026
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...    37   0.026
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    38   0.030
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    37   0.031
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    38   0.033
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...    36   0.037
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    37   0.040
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    37   0.049
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    37   0.049
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    37   0.049
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    35   0.050
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    35   0.050
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    37   0.051
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...    36   0.054
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    37   0.054
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.057
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    37   0.058
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    37   0.058
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    37   0.066
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    35   0.068
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    37   0.072
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    35   0.073
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    35   0.073
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    37   0.073
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    37   0.074
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    35   0.077
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    36   0.077
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    37   0.078
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...    35   0.089
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    36   0.090
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    36   0.091
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    34   0.091
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    34   0.097
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    34   0.099
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    34   0.11 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.11 
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       34   0.11 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    36   0.11 
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    36   0.12 
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    36   0.12 
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    34   0.13 
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    35   0.13 
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    34   0.13 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.14 
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...    34   0.14 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    35   0.15 
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    35   0.15 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.17 
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    33   0.19 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    33   0.19 
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...    34   0.19 
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    35   0.21 
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    33   0.21 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    35   0.23 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.23 
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    35   0.23 
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    35   0.23 
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    33   0.25 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.25 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.27 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    35   0.29 
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    34   0.30 
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    33   0.30 
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    34   0.32 
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    34   0.33 
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    34   0.33 
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    32   0.33 
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...    33   0.33 
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    34   0.35 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.36 
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    34   0.36 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    34   0.40 
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    34   0.44 
AAL039C Chr1 complement(273886..274737) [852 bp, 283 aa] {ON} Sy...    33   0.45 
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    32   0.45 
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    32   0.50 
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    32   0.58 
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   0.58 
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    33   0.58 
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     33   0.62 
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    33   0.63 
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    33   0.64 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    32   0.71 
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    33   0.74 
KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {O...    33   0.74 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    33   0.74 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    32   0.79 
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    31   0.80 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    33   0.87 
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    33   0.90 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    33   0.98 
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    33   1.0  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   1.0  
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    32   1.1  
Kwal_0.82 s0 complement(38098..40035) [1938 bp, 645 aa] {ON} YFR...    33   1.1  
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    32   1.1  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    33   1.2  
NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.3...    32   1.2  
TBLA0F04250 Chr6 complement(1046788..1047993) [1206 bp, 401 aa] ...    32   1.2  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    32   1.4  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    32   1.4  
NDAI0E01840 Chr5 complement(367943..371395) [3453 bp, 1150 aa] {...    32   1.4  
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...    32   1.5  
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    32   1.5  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    32   1.5  
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    32   1.6  
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    32   1.6  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    32   1.6  
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    32   1.7  
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    32   1.8  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    32   1.8  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    32   1.9  
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    32   2.0  
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    31   2.1  
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    32   2.1  
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...    31   2.1  
ZYRO0B12804g Chr2 (1035145..1037157) [2013 bp, 670 aa] {ON} simi...    32   2.2  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    32   2.3  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    32   2.5  
AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON} S...    31   2.6  
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    31   2.6  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    32   2.6  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    32   2.7  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      31   2.7  
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    31   2.7  
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...    31   2.8  
TDEL0A01980 Chr1 (360689..361222) [534 bp, 177 aa] {ON} Anc_2.42...    30   2.9  
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    31   3.0  
Kpol_463.7 s463 (15987..18608) [2622 bp, 873 aa] {ON} (15987..18...    31   3.0  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    31   3.1  
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    31   3.3  
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    31   3.3  
Suva_4.175 Chr4 complement(313538..315640) [2103 bp, 700 aa] {ON...    31   3.4  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    31   3.4  
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    31   3.4  
Skud_4.182 Chr4 complement(319563..321665) [2103 bp, 700 aa] {ON...    31   3.4  
YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}  ...    31   3.4  
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    31   3.6  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    31   3.7  
Smik_4.162 Chr4 complement(300502..302598) [2097 bp, 698 aa] {ON...    31   3.9  
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    31   4.0  
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    30   4.1  
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    30   4.3  
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    31   4.3  
NDAI0C04230 Chr3 (965070..966062) [993 bp, 330 aa] {ON} Anc_5.33...    30   4.4  
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    30   4.4  
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    31   4.4  
TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON} Anc_6...    30   5.1  
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    30   5.3  
YMR228W Chr13 (724626..725651) [1026 bp, 341 aa] {ON}  MTF1Mitoc...    30   5.3  
TDEL0A01850 Chr1 complement(337255..340671) [3417 bp, 1138 aa] {...    30   5.3  
CAGL0I01628g Chr9 complement(132246..134570) [2325 bp, 774 aa] {...    30   6.1  
KLTH0B03652g Chr2 (298170..303941) [5772 bp, 1923 aa] {ON} simil...    30   6.1  
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    30   6.4  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    30   6.6  
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    29   6.7  
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    30   6.7  
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    30   6.7  
Kpol_1061.54 s1061 (154211..156754) [2544 bp, 848 aa] {ON} (1542...    30   6.8  
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    30   6.9  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    30   6.9  
Skud_3.140 Chr3 (216311..217780) [1470 bp, 489 aa] {ON} YCR066W ...    30   7.1  
KLTH0F07062g Chr6 (616169..617032) [864 bp, 287 aa] {ON} similar...    30   7.5  
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    30   7.9  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    30   7.9  
TBLA0E03140 Chr5 complement(784998..787637) [2640 bp, 879 aa] {O...    30   8.7  
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    30   9.2  
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    29   9.2  
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    30   9.2  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    30   9.4  
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    30   9.6  
KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {...    30   9.7  
ZYRO0A08932g Chr1 complement(712694..716260) [3567 bp, 1188 aa] ...    30   9.7  
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     30   10.0 

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/275 (100%), Positives = 275/275 (100%)

Query: 1   MKLLSWHRNSMITGVVLGVFIPVLTIAFTMTTVFYWRSRLGFLDEYRLDIPIHRNSDTEM 60
           MKLLSWHRNSMITGVVLGVFIPVLTIAFTMTTVFYWRSRLGFLDEYRLDIPIHRNSDTEM
Sbjct: 1   MKLLSWHRNSMITGVVLGVFIPVLTIAFTMTTVFYWRSRLGFLDEYRLDIPIHRNSDTEM 60

Query: 61  DSAEFEKVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTC 120
           DSAEFEKVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTC
Sbjct: 61  DSAEFEKVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTC 120

Query: 121 AICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYIDD 180
           AICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYIDD
Sbjct: 121 AICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYIDD 180

Query: 181 KIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRNISTLRKLAMCVSFTNQRSIAEITI 240
           KIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRNISTLRKLAMCVSFTNQRSIAEITI
Sbjct: 181 KIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRNISTLRKLAMCVSFTNQRSIAEITI 240

Query: 241 IREGHRRYELLKRVDDVCLESLRDELRRPSIERRP 275
           IREGHRRYELLKRVDDVCLESLRDELRRPSIERRP
Sbjct: 241 IREGHRRYELLKRVDDVCLESLRDELRRPSIERRP 275

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score =  219 bits (559), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 114/268 (42%), Positives = 166/268 (61%), Gaps = 7/268 (2%)

Query: 11  MITGVVLGVFIPVLTIAFTMTTVFYWRSRLGFLDEYRLDIPIHRNSDTEMDSAEFEKVKS 70
           M + +   +F+PV+ ++  +T V   RS LGF + YRLD+P+++  D   D  E+    S
Sbjct: 1   MNSKIFAAIFVPVVIVSLLITAVCCLRSWLGFSESYRLDVPLYQQHDGP-DLEEYSHCVS 59

Query: 71  LIQVSEKYDTEDK---EELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
            +++S+    E +   +E PKTL L+ F  +FPT QY+        +D   +C ICQE F
Sbjct: 60  QLRISDDVKKEVEILFQEKPKTLNLNEFCEVFPTTQYASFRK--NVSDEEESCVICQEQF 117

Query: 128 NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYIDDKIGASYN 187
           N+LNN+ +LGC+H+FH++CID+WICRNSACCPLCKRSYSLP      + YI+ ++G  YN
Sbjct: 118 NELNNIRVLGCSHIFHSHCIDRWICRNSACCPLCKRSYSLPVGSCHVIAYIEKRLGPRYN 177

Query: 188 -SSSRAEQADMWLDLFPDLGEVMDQILKRNISTLRKLAMCVSFTNQRSIAEITIIREGHR 246
             SS   +   WLD++PDL E  D+ L R  S     A+      +  +  I IIREGHR
Sbjct: 178 LDSSITRKESAWLDVYPDLQEFADKKLIRYSSKAWSAALIFCLATKSKLRGIIIIREGHR 237

Query: 247 RYELLKRVDDVCLESLRDELRRPSIERR 274
           RY+L+  V+++ +E LR+ELR PS E+R
Sbjct: 238 RYDLMMSVEELQMEILRNELRMPSHEQR 265

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 117  RTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVR 176
            + TC IC   F+++    ++ C H F   CI  W+ RN   CPLCK   ++  V+  +++
Sbjct: 1161 KFTCTIC---FSEIYMGSIIKCGHFFCKSCIHSWL-RNKNACPLCKMETNITEVYSFKLQ 1216

Query: 177  YIDDKIGASYNSSSRAEQA 195
              D K   + N SS  E  
Sbjct: 1217 DEDRKTEDTSNESSMGENG 1235

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 19/125 (15%)

Query: 95  FHRIFPTQQYSKVESLGPGADSRTT----CAICQEDFNKLNNVC---------LLG-CNH 140
           F +++P   +S        AD        C IC+  +N     C         ++G CNH
Sbjct: 5   FKKVYPVFSWSWDIPGDDDADREIGDEDLCGICRVSYNGTCPGCKYPGDNCPLVIGECNH 64

Query: 141 VFHTYCIDQWICRNSA--CCPLCKRSYSLPR---VFHPQVRYIDDKIGASYNSSSRAEQA 195
            FH +CI QW+   +A   CP+C++ +SL R   +   QV  + + +     ++  A+  
Sbjct: 65  NFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLLLQPRPAALAADDQ 124

Query: 196 DMWLD 200
           DM +D
Sbjct: 125 DMMMD 129

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 8/133 (6%)

Query: 52   IHRNSDTEMDSAEFE-KVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESL 110
            + R SD+ +   + E  VK+ I  S K D + KE L K   ++   RI   +  SK++ L
Sbjct: 1085 LQRISDSLISIIQLEPNVKNSILRSIKDDKQYKENLTKISQIE--SRIKYLKNLSKIQDL 1142

Query: 111  GPGADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRV 170
                 S   C IC    N +    ++ C H F  +CI  W+ +N + CP+CK++ +   +
Sbjct: 1143 IEQNKS-FNCPIC---LNTIYMGSIIKCGHFFCKHCIFSWL-KNKSVCPICKKTTNKNEL 1197

Query: 171  FHPQVRYIDDKIG 183
            +H + +  ++++ 
Sbjct: 1198 YHFKFKNKEEEVN 1210

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYI 178
            +C IC     K+    ++ C H F   CI  W+ +N   CP+CK S S+  V++ + +  
Sbjct: 1153 SCPIC---LGKITMGAIIKCGHFFCRSCIHSWL-KNHNSCPMCKTSTSIMEVYNFKFQND 1208

Query: 179  DDKIGASYNSSSRA-EQADMWLDLFPDLGEVMDQILKRNISTLRKL 223
            D ++    N SS+  E+      L   +G+  D + K   S   ++
Sbjct: 1209 DAEVNEPQNESSQDFEKKPKSSALAKKVGDDYDSVFKERYSVFPQM 1254

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 19/125 (15%)

Query: 95  FHRIFPTQQYSKVESLGPGADSRTT----CAICQEDFNKLNNVC---------LLG-CNH 140
           F +++P   +S        AD        C IC+  +N     C         ++G CNH
Sbjct: 5   FKKVYPVFSWSWDIPGDDNADKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLVIGECNH 64

Query: 141 VFHTYCIDQWICRNSA--CCPLCKRSYSLPR---VFHPQVRYIDDKIGASYNSSSRAEQA 195
            FH +CI QW+   +A   CP+C++ +SL R   +   Q+  +   +  S  ++   E  
Sbjct: 65  NFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQPAALTTEDQ 124

Query: 196 DMWLD 200
           DM +D
Sbjct: 125 DMMMD 129

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVR 176
            +CA+C  D   +    +L C H F   C+  W  +N++ CP+CK   S   V+H + R
Sbjct: 1207 SCAVCYSD---IYTGSILKCGHFFCKDCVTHWFKKNTS-CPMCKNRMSSSEVYHFKFR 1260

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYI 178
             C IC    N++    ++ C H F   CI  W+ +N   CPLCK    L  +++ + +  
Sbjct: 1225 NCTIC---LNQIYTGSIIKCGHFFCKKCIQSWL-KNKNSCPLCKTETGLSEIYNFKFKE- 1279

Query: 179  DDKIGASYNSSSRAEQ 194
            +D   +SY S  ++++
Sbjct: 1280 EDTEYSSYGSQPKSKE 1295

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 115 DSRTTCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCK 162
           D    C IC+  +N     C L           C+H FH +CI QW+    +   CP+C+
Sbjct: 33  DEEDVCGICRGSYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92

Query: 163 RSYSL 167
           +++SL
Sbjct: 93  QAFSL 97

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 80  TEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFN-KLNNVCLLGC 138
           +EDK+ LP  L        +P  Q S  +S   G      C +C E  + ++  +    C
Sbjct: 184 SEDKDALPYMLK-------YPFTQSSSEQS--DGLIELPMCPVCLEKLDSEVTGLVTTPC 234

Query: 139 NHVFHTYCIDQWICRNSACCPLCKRS 164
            H FH  C+DQW   N   CP+C+ S
Sbjct: 235 QHTFHCKCLDQWKNGN---CPVCRYS 257

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 16/107 (14%)

Query: 71  LIQVSEKYDTE---DKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
           L Q+S  Y  +    +  LPK    D +    P       E  G  A+    CAIC  D 
Sbjct: 647 LFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDV 706

Query: 128 ----------NKLN--NVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
                     +K++  +  +  CNHVFHT C++ W+      CP+C+
Sbjct: 707 PIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWM-NYKLQCPVCR 752

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 119 TCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWICRNS--ACCPLCKRSYS 166
            C IC+  ++     C         +LG CNH FH +CI QW+   +    CPLC++ + 
Sbjct: 58  VCGICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQ 117

Query: 167 L-PRVF 171
           L P V 
Sbjct: 118 LRPNVL 123

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQEDFN------------KLNNVCLLGCNHVFHTYCIDQWICRNSACC 158
           G  +D    CAIC  +               L++  +  CNHVFHT C++ W+      C
Sbjct: 686 GASSDHTVDCAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGY-KLQC 744

Query: 159 PLCK 162
           P+C+
Sbjct: 745 PVCR 748

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 120 CAICQEDF-------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           C +C EDF       +    V +L C H  H  C+  WI R S  CP+C+
Sbjct: 353 CIVCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIAR-SPTCPICR 401

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYSL 167
           C IC+  +N     C         ++G CNH FH +CI QW+    +   CP+C++ +SL
Sbjct: 36  CGICRVSYNGTCPSCKYPGDECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSL 95

Query: 168 PR 169
            R
Sbjct: 96  KR 97

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +CAIC      ++   ++ C H F   CI  W+ +N+  CPLCK   +L  V++
Sbjct: 1200 SCAIC---LGTIHTGSIIKCGHFFCRKCIHSWL-KNNQSCPLCKTRATLLEVYN 1249

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 107  VESLGPGADSRTT--CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
            + +L   A   TT  C+IC      + N  ++ C H+F T CI  W+ +N   CPLCK  
Sbjct: 1149 LSTLTYEAQKNTTMECSIC---LQPITNGAMVNCGHLFCTSCIFSWL-KNRKTCPLCKHP 1204

Query: 165  YSLPRVFH 172
             S   V++
Sbjct: 1205 TSNCEVYN 1212

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 12/61 (19%)

Query: 119 TCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166
            C IC+  +N     C L           C+H FH +CI QW+    +   CP+C++++S
Sbjct: 37  VCGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96

Query: 167 L 167
           L
Sbjct: 97  L 97

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 13/98 (13%)

Query: 68  VKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
           +K ++  S+ +   D +ELP  +T    ++  PT    KVE          TC +C E  
Sbjct: 225 IKEIVFKSKLFRRVDLQELPYLMTDPFTNKDSPTT-LKKVE--------LPTCPVCLERM 275

Query: 128 N-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           + +   +  + C H FH  C+D+W   N + CP+C+ S
Sbjct: 276 DSETTGLITIPCQHTFHCSCLDKW---NDSRCPVCRYS 310

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 16/77 (20%)

Query: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYSL 167
           C IC+  +N     C         +LG CNH FH +CI QW+    +   CP+C++ + L
Sbjct: 53  CGICRASYNGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRL 112

Query: 168 PRVFHPQVRYIDDKIGA 184
                P      D +GA
Sbjct: 113 ----KPNATVNTDHLGA 125

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162
           D    C IC+  +N     C         ++G CNH FH +CI +W+    +   CP+C+
Sbjct: 31  DDDDVCGICRASYNATCPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCR 90

Query: 163 RSYSLPR 169
           + + L R
Sbjct: 91  QLFQLKR 97

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162
           D    C IC+  +N     C         ++G CNH FH +CI +W+    +   CP+C+
Sbjct: 34  DGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93

Query: 163 RSYSLPR 169
           +++ L +
Sbjct: 94  QTFQLKK 100

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 12/60 (20%)

Query: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWICRNSA--CCPLCKRSYSL 167
           C IC+  +N +   C         ++G C H FH +C+  W+   +A   CP+C++ ++L
Sbjct: 46  CGICRAGYNAVCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFAL 105

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYI 178
             C IC     ++    ++ C H F   CI  W+ +N A CPLCK   S+  V+    ++ 
Sbjct: 1222 NCTIC---LGEIYMGSVIKCGHFFCQSCIFSWL-KNHASCPLCKMQTSMSEVY--SFKFQ 1275

Query: 179  DDKIGASYNSSSRAEQ 194
            D +  A     S A+Q
Sbjct: 1276 DAQPEADSEQDSAAQQ 1291

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 16/100 (16%)

Query: 107 VESLGPGADSRTTCAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSA 156
           VE L   A+    C IC ++           NK      L C H+ H  C+  W+ R S 
Sbjct: 335 VEQLQNSANEDNICIICMDELIHSTNQQTWKNKNKKPKRLPCGHILHLSCLKNWMER-SQ 393

Query: 157 CCPLCKRSYSLPRVFHPQVRYIDDKIGASYNSSSRAEQAD 196
            CP+C+    LP VF  +   +     +  NSS      D
Sbjct: 394 TCPICR----LP-VFDDKGNVVQTTFTSETNSSITMAATD 428

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 114 ADSRTTCAICQ----EDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           ++S   C IC+    +DF +    CL  C+H FH  CI  W+ +NS  CPLC+
Sbjct: 204 SNSSDECPICRIAYSDDF-ETEITCLPNCSHHFHFECIKLWLQKNSL-CPLCR 254

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFNKL-NNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + L   +  + C+H FH  C+D+W  +NS  CP+C+ +
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKW--KNSK-CPVCRHT 283

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%)

Query: 108 ESLGPGADSRTTCAICQEDF----------NKLN--NVCLLGCNHVFHTYCIDQWICRNS 155
           E  G  A++   CAIC  D           +K++  +  +  CNHVFHT C++ W+    
Sbjct: 688 EHGGGTAENTVDCAICMSDVPIYIEEVPETHKVDQHSYMVTPCNHVFHTPCLENWMSY-K 746

Query: 156 ACCPLCK 162
             CP+C+
Sbjct: 747 LQCPVCR 753

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 16/107 (14%)

Query: 71  LIQVSEKYDTE---DKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
           L Q+S  Y  +    +  LP+    + +    P      +E  G   ++   CAIC  D 
Sbjct: 647 LFQISILYSQDILGSRWFLPQHTIPEGYSYFKPLSNQYILEHGGGTVENTVDCAICMSDV 706

Query: 128 ----------NKLN--NVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
                     +K++  +  +  CNHVFHT C++ W+      CP+C+
Sbjct: 707 PIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSY-KLQCPVCR 752

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 12/98 (12%)

Query: 68  VKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
           +K ++     ++ +++ ++P  LT       F T+++ K +SL        TC +C E  
Sbjct: 190 IKEVVFNKAVFNGKERAKIPYLLT-----DPFTTKKHEKSQSLEV---ELPTCPVCLERM 241

Query: 128 NK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           +     +  + C H FH  C+D+W  +NS  CP+C+ S
Sbjct: 242 DSDTTGLITIPCQHTFHCQCLDKW--KNSR-CPVCRYS 276

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 113 GADSRTTCAICQEDFNKLNNVCLLG----------CNHVFHTYCIDQWICRNS--ACCPL 160
           G +    C IC+  +N     C +           C+H FH +CI +W+  N+    CP+
Sbjct: 53  GDEDEDVCGICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPM 112

Query: 161 CKRSYSL 167
           C++ + L
Sbjct: 113 CRQQFQL 119

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 4/55 (7%)

Query: 113  GADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSL 167
            G +    C IC    + +   C+L C H F   CI  W+ +    CP+CK   SL
Sbjct: 1260 GQNKEFQCTIC---LDAITKGCMLKCGHFFCEDCIYDWL-QTRTICPICKHKASL 1310

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162
           D    C IC+  FN+    C         ++G C H FH +CI +W+    +   CP+C+
Sbjct: 45  DEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104

Query: 163 RSYSLPR 169
           + + L +
Sbjct: 105 QLFQLKK 111

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query: 120  CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYID 179
            C+IC +D   ++   +L C H F   CI  W+ +N   CP+CK   +   +++   ++ +
Sbjct: 1191 CSICLQD---ISLGSMLKCGHFFCKRCITSWL-KNKKNCPMCKMVTTASEIYN--FKFKE 1244

Query: 180  DKIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRN 216
            +K+    ++S   E  +  +D+      + D++L  N
Sbjct: 1245 EKLEG--DTSQMNEDLNNNIDMQKRNANMPDKVLSEN 1279

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQW-ICRNSACCPLCKRSYSLPRVFHPQV 175
           C IC E  N+ +   LL C H +H  CI +W +  N   CP C++     R  H  +
Sbjct: 5   CGICLESMNETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCRKESKSLRRKHDDI 61

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 117  RTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI 151
             T C IC++   KL  +CLL C H FH  C  QW 
Sbjct: 1282 NTLCVICEQPMKKLA-ICLLECGHEFHFECGQQWF 1315

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 13/91 (14%)

Query: 119 TCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166
            C IC+  +N     C +           CNH FH +CI +W+    +   CP+C++ + 
Sbjct: 43  VCGICRASYNGTCPSCKIPGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFK 102

Query: 167 LPRVFHPQVRYIDD-KIGASYNSSSRAEQAD 196
           L +       Y+   ++ A  N   RA   D
Sbjct: 103 LDKKLVINSDYLQKFEVLARKNRERRALNVD 133

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 111 GPGADSRTTCAICQEDFNK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           G G     TC +C E  +     +    C H FH  C+DQW       CP+C+ S
Sbjct: 226 GSGMVELPTCPVCLERMDSDTTGLITTACQHTFHCQCLDQW---KGGRCPVCRYS 277

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 11/66 (16%)

Query: 107 VESLGPGADSRTTCAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSA 156
           VE L   A+    C IC ++           NK      L C H+ H  C+  W+ R S 
Sbjct: 336 VEQLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMER-SQ 394

Query: 157 CCPLCK 162
            CP+C+
Sbjct: 395 TCPICR 400

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + +   +  + C H FH  C+D+W  +NS  CP+C+ S
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKW--KNSR-CPVCRYS 280

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 11/53 (20%)

Query: 120 CAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           C IC ++           N  N    L C HV H YC+  W+ R S  CP+C+
Sbjct: 319 CIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMER-SQTCPICR 370

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 120 CAICQED-FNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +   + +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 52  CIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 104

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 120 CAICQED--FNKLNN-VCLLG-CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ++  FN  +  V   G CNH FH +CI QWI ++   CPL  + + L R
Sbjct: 55  CVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWI-KSRNVCPLDNKPWKLAR 107

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 115 DSRTTCAICQEDF------NKLNN-VCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           D+ + C IC +D        K+N    +L C H+ H  C+  W+ R S  CP+C+ S
Sbjct: 315 DTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER-SQTCPICRLS 370

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 12/74 (16%)

Query: 108 ESLGPGADSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNS 155
           E      D    C IC+  +N     C         ++G C+H FH +CI +W+    + 
Sbjct: 29  EVTNENDDDEDVCGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSK 88

Query: 156 ACCPLCKRSYSLPR 169
             CP+C++ + L +
Sbjct: 89  GLCPMCRQVFQLQK 102

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 14/86 (16%)

Query: 80  TEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFN-KLNNVCLLGC 138
           T+D E LP  LT            ++++E  G        C +C E  + +   +  + C
Sbjct: 141 TDDDERLPYLLT----------DPFTQLEKPGGRLVELPACPVCLERMDSETTGLITIPC 190

Query: 139 NHVFHTYCIDQWICRNSACCPLCKRS 164
            H FH  C+++W  +NS  CP+C+ S
Sbjct: 191 QHTFHCQCLNRW--KNSK-CPVCRYS 213

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 14/88 (15%)

Query: 78  YDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFNK-LNNVCLL 136
           +D ++ ++LP  LT D F    P    S+VE          TC +C E  +     +  +
Sbjct: 202 FDKKEGQKLPYLLT-DPF-TTSPQPLQSQVE--------LPTCPVCLERMDSDTTGLITI 251

Query: 137 GCNHVFHTYCIDQWICRNSACCPLCKRS 164
            C H FH  C+D+W  +NS  CP+C+ S
Sbjct: 252 PCQHTFHCQCLDKW--KNSK-CPVCRYS 276

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 119 TCAICQEDF-----NKLNN--VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           TC IC +D       K+NN    +L C H+ H  C+  W+ R +  CP+C+
Sbjct: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR-AQTCPICR 386

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK-RSYSLPR 169
           TC +C E  + +   +  + C H FH  C+D+W  +NS  CP+C+  S+ L R
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKW--KNSK-CPVCRLSSFRLSR 295

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQ-------EDFNKLNNVCL-----LGCNHVFHTYCIDQWICRNSACC 158
           G   D    CAIC        ED  + + V L       C HVFHT C++ W+      C
Sbjct: 694 GSSVDHTVDCAICMSEVPVYVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSY-KLQC 752

Query: 159 PLCK 162
           P+C+
Sbjct: 753 PVCR 756

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 119 TCAICQEDFNKLNNVCLLG----CNHVFHTYCIDQWICRNSACCPLCK 162
           TC+IC E F   +N  LL     C H+F   CI  W+  N   CP+C+
Sbjct: 91  TCSICFERFGN-DNYPLLAQLPHCGHIFDLQCISMWL-SNQVTCPMCR 136

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +CA+C   FN++    ++ C H F   CI  W+ +    CPLCK + +   V++
Sbjct: 1163 SCAVC---FNEIFVGSVVKCGHFFCYSCIHTWL-KEHNTCPLCKTNVTPSEVYN 1212

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 120 CAICQ-EDFNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++WI    A CPL  + + L R
Sbjct: 68  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQTRDA-CPLDNQPWQLAR 120

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 120 CAICQ-EDFNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 118

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            TC IC      ++   ++ C H F   CI  W+  NS  CPLCKR  +  ++++
Sbjct: 1270 TCPIC---LGLIHTGSMISCGHFFCNNCIFSWLKLNSN-CPLCKRDTTQSQLYN 1319

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +CA+C   FN++    ++ C H F   CI  W+ +    CPLCK + +   V++
Sbjct: 1163 SCAVC---FNEIFVGSVVKCGHFFCYSCIHTWL-KEHNTCPLCKTNVTPSEVYN 1212

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 120 CAICQ-EDFNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 118

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 111 GPGADSRTTCAICQEDFNK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           G G     TC +C E  +     +    C H FH  C+D+W       CP+C+ S
Sbjct: 203 GSGMVELPTCPVCLERMDSDTTGLITTACQHTFHCQCLDKW---KDGRCPVCRYS 254

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYI 178
             C+IC      +++  ++ C H F   CI  W+ +N   CP+CKR  +   +++ + +  
Sbjct: 1176 NCSIC---LGIIHHGSIMKCGHFFCRDCIHSWL-KNQRTCPICKREATSTELYNFKFKNH 1231

Query: 179  D--DKIGASYNSSS 190
            D  D  G + NS +
Sbjct: 1232 DNIDVPGPNINSKA 1245

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162
           +    C IC+  +N     C         ++G C+H FH +CI +W+    +   CP+C+
Sbjct: 36  EDEDVCGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95

Query: 163 RSYSLPR 169
           +++ L +
Sbjct: 96  QTFQLQK 102

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQ-------EDFNKLNNV-----CLLGCNHVFHTYCIDQWICRNSACC 158
           G   +    C IC        +D  + +N+      +  CNH+FHT C++ W+      C
Sbjct: 682 GTNKNHTVDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSY-KLQC 740

Query: 159 PLCK 162
           P+C+
Sbjct: 741 PVCR 744

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 11/67 (16%)

Query: 108 ESLGPGADSRTTCAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSAC 157
           E L   A+    C IC ++           NK      L C H+ H  C+  W+ R S  
Sbjct: 332 EQLQNSANEDNICIICMDELMHSQADQTWKNKNKKPKRLPCGHILHLSCLKNWMER-SQT 390

Query: 158 CPLCKRS 164
           CP+C+ S
Sbjct: 391 CPICRLS 397

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 34.3 bits (77), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 120 CAICQ-EDFNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 118

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 34.3 bits (77), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 120 CAICQ-EDFNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 67  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 119

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 33.9 bits (76), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 25/103 (24%)

Query: 82  DKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQ------------EDFNK 129
           D EE+PK        + F  ++++ V +      +   CAIC+            +    
Sbjct: 7   DSEEVPK--------KKFQIKKWTAV-AFWSWDIAVDNCAICRNHIMEPCIECQPKAMTD 57

Query: 130 LNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
            +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 58  TDNECVAAWGTCNHAFHLHCINKWI-KTRDACPLDNQPWHLAR 99

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 133 VCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           V    CNH FH +CI++WI +    CPL  + + L R
Sbjct: 73  VAWAACNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 108

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFNK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  +     +  + C H FH  C+D+W  +NS  CP+C+ S
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKW--KNSK-CPVCRYS 277

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++WI +    CPL  + + L R
Sbjct: 76  CNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 106

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + +   +  + C H FH  C+D+W  +NS  CP+C+ S
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKW--KNSQ-CPVCRYS 283

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 86  LPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTT--CAICQ----------EDFNK--LN 131
           LP+    + +    P      +E  G   D   T  CAIC           E  +K  ++
Sbjct: 667 LPQHSIPEGYTYFKPISLQHSIEHGGGSKDEPYTVDCAICMSPVPVYIEEVEGTHKVDIH 726

Query: 132 NVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           +  +  CNH+FHT C++ W+      CP+C+ S
Sbjct: 727 SYMVTPCNHIFHTECLENWMGY-KLQCPVCRSS 758

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (10%)

Query: 105 SKVESLGPG--ADSRTTCAICQEDF----NKLNNVCLLGCNHVFHTYCIDQWICRNSACC 158
           SK+  + P    DS   C +C +D     +K      L C H  H  C+  W+ R S  C
Sbjct: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMER-SQTC 394

Query: 159 PLCK 162
           P+C+
Sbjct: 395 PICR 398

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 131 NNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           +N C+     CNH FH +CI++WI +    CPL  + + L R
Sbjct: 75  DNECVAAWGTCNHAFHLHCINKWI-KTRDACPLDNQPWHLAR 115

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 11/66 (16%)

Query: 107 VESLGPGADSRTTCAICQEDF----------NKLNNVCLLGCNHVFHTYCIDQWICRNSA 156
           +E +   A+    C IC ++           NK      L C H+ H  C+  W+ R S 
Sbjct: 334 IEQMQNSANEDNICIICMDELIHSANQQAWKNKNKKPKRLPCGHILHLSCLKNWMER-SQ 392

Query: 157 CCPLCK 162
            CP+C+
Sbjct: 393 TCPICR 398

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++WI +    CPL  + + L R
Sbjct: 83  CNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 113

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + ++  +  + C H FH  C+++W     + CP+C+ S
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKW---KDSRCPVCRYS 289

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query: 108 ESLGPGADSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNS 155
           + L    ++   C IC+  +N     C         ++G C+H FH +CI +W+    + 
Sbjct: 29  DKLNDNDENEDVCGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSK 88

Query: 156 ACCPLCKRSYSLPR 169
             CP+C++ + L +
Sbjct: 89  GLCPMCRQRFQLQK 102

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 16/107 (14%)

Query: 71  LIQVSEKYDTE---DKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDF 127
           L Q+S  Y  +    +  LPK    D +    P       E     A++   C IC  D 
Sbjct: 647 LFQISILYSQDILGSRWFLPKHTIPDGYTYFKPLSNEYISEHGSGAAENTVDCTICMSDV 706

Query: 128 ----------NKLN--NVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
                     +K++  +  +  C+HVFHT C++ W+      CP+C+
Sbjct: 707 PIYIEEIPETHKVDQHSYMVTPCDHVFHTSCLENWMSY-KLQCPVCR 752

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQEDFN------------KLNNVCLLGCNHVFHTYCIDQWICRNSACC 158
           G  +D    CAIC  D               +N+  +  C H+FHT C++ W+      C
Sbjct: 683 GCSSDYCIDCAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQ-C 741

Query: 159 PLCK 162
           P+C+
Sbjct: 742 PVCR 745

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + + + +  + C H FH  C+++W  +NS  CP+C+ S
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKW--KNSR-CPVCRHS 282

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 120 CAICQED-FNKLNNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           C  CQ +     +N C+     CNH FH +CI++W+   +A CPL  +++   +
Sbjct: 59  CIQCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLTRNA-CPLDNKTWQFAK 111

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++WI +    CPL  + + L R
Sbjct: 89  CNHAFHLHCINKWI-KTREACPLDNQPWQLAR 119

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 119 TCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166
            C IC+  +N     C         ++G C+H FH +CI +W+    +   CP+C++++ 
Sbjct: 40  VCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQ 99

Query: 167 LPR 169
           L +
Sbjct: 100 LQK 102

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 19/85 (22%)

Query: 96  HRIFPTQQYSKVESL------GPGADSRTTCAICQEDFNKL------------NNVCLLG 137
           H I     Y +V SL      G   +    CAIC  +F               ++  +  
Sbjct: 668 HSIPEEYSYHRVVSLQHLMEHGGSENHTVDCAICMAEFPVYVEELPETHQVDKDSYMITP 727

Query: 138 CNHVFHTYCIDQWICRNSACCPLCK 162
           C+H+FHT C++ W+      CP+C+
Sbjct: 728 CDHMFHTSCLESWMSY-KLQCPVCR 751

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++WI +    CPL  + + L R
Sbjct: 85  CNHAFHLHCINKWI-KTRDACPLDNQPWQLAR 115

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + ++  +  + C H FH  C+++W       CP+C+ S
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKW---GDNRCPVCRYS 269

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + +   +  + C H FH  C+++W  +NS  CP+C+ S
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW--KNSR-CPVCRHS 282

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 113  GADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVF 171
              + + +C IC     ++    ++ C H F   CI  W+ +N + CPLCK   ++  V+
Sbjct: 1182 NGEHKFSCTIC---LGEIYMGSVIKCGHFFCQDCICSWL-KNHSSCPLCKMQTTMSGVY 1236

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 120 CAICQEDFNKLNNVC---------LLGCNHVFHTYCIDQWICRNSACCPLCK 162
           C IC +D + +N++          +L C H+ H  C+  W+ R S  CP+C+
Sbjct: 326 CIICMDDLS-INSIQKNFEKRKPKMLPCGHILHMNCLKNWMER-SQTCPMCR 375

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162
           +    C IC+  ++     C         +LG C H FH +CI +W+    +   CP+C+
Sbjct: 32  EDEDVCGICRASYHAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

Query: 163 RSYSL 167
           + + L
Sbjct: 92  QKFQL 96

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + +   +  + C H FH  C+++W  +NS  CP+C+ S
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW--KNSR-CPVCRHS 282

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFN-KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           TC +C E  + +   +  + C H FH  C+++W  +NS  CP+C+ S
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW--KNSR-CPVCRHS 282

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCK 162
           CNH+FHT C++ W+      CP+C+
Sbjct: 732 CNHIFHTSCLENWMSY-KLQCPVCR 755

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 22/62 (35%)

Query: 122 ICQEDFNKLNNVCL---------------------LGCNHVFHTYCIDQWICRNSACCPL 160
           + +E+ N+ NN+C+                     L C H+ H  C+  W+ R S  CP+
Sbjct: 300 VTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMER-SQTCPI 358

Query: 161 CK 162
           C+
Sbjct: 359 CR 360

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 131 NNVCLLG---CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           +N C+     CNH FH +CI++W+   +A CPL  + +S  +
Sbjct: 68  DNECVAAWGTCNHAFHLHCINKWLQTRNA-CPLDNQPWSFAK 108

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C HV H +C+  W+ R S  CP+C+
Sbjct: 365 LPCGHVLHLFCLKNWMER-SQTCPICR 390

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCK 162
           CNH+FHT C++ W+      CP+C+
Sbjct: 728 CNHIFHTACLENWMGY-KLQCPVCR 751

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 10/49 (20%)

Query: 120 CAICQEDFNKLNNVCLLG----CNHVFHTYCIDQW-ICRNSACCPLCKR 163
           C IC ED   +     LG    C H FH  CI QW +   S  CP+C+R
Sbjct: 5   CPICLEDITDI-----LGSLKVCQHNFHFNCIRQWHLTSKSLECPVCRR 48

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++W+   +A CPL  +++   +
Sbjct: 75  CNHAFHLHCINKWLLTRNA-CPLDNKTWQFAK 105

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 115 DSRTTCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCK 162
           +    C IC+ ++N+    C +           C H FH +CI +W+    +   CP+C+
Sbjct: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104

Query: 163 RSYSL 167
           + + L
Sbjct: 105 QEFKL 109

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQ-------EDFNKLNNV-----CLLGCNHVFHTYCIDQWICRNSACC 158
           G   +    CAIC        +D  K + V      +  C+H+FHT C++ W+      C
Sbjct: 679 GSSPNYSIDCAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQ-C 737

Query: 159 PLCK 162
           P+C+
Sbjct: 738 PVCR 741

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFNK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           +C +C E  +  +  +  + C H FH  C+D+W     + CP+C+ S
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKW---KDSRCPVCRYS 279

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 120  CAICQEDFNKLN-----NVCLLGCNHVFHTYCIDQWI-CRNSACCPLCKRSYSLPR 169
            CAIC    + ++      VC   CN+ FH  C+ +W    N+  CPLC+   +L R
Sbjct: 1537 CAICYSTLHAVDRKLPTKVCP-TCNNKFHGSCLYKWFRSSNNNTCPLCRSEIALRR 1591

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 118  TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI 151
            T CA+C+    KL  +C+L C H  H  C  +W 
Sbjct: 1236 TLCALCERPLKKLT-MCILSCGHEGHPECFQRWF 1268

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCK 162
           CNH+FHT C++ W+      CP+C+
Sbjct: 733 CNHIFHTECLENWMSY-KLQCPVCR 756

>AAL039C Chr1 complement(273886..274737) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR313C
           (PIB1)
          Length = 283

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 41/128 (32%), Gaps = 26/128 (20%)

Query: 54  RNSDTEMDSAEFEKVKSLIQVSEKYD---------TEDKEELPKTLTLDVFHRIFPTQQY 104
           R +  E  S       S+    E+YD         + D E+       +   R    QQ+
Sbjct: 132 RETVAEHGSEHSSTAVSVRARPEEYDHCPLCNADLSGDPEDTAAEHVQNCIARATSVQQH 191

Query: 105 SKVESLGP-----------------GADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCI 147
              ES GP                 G      C IC ED      V  L C  VFH  CI
Sbjct: 192 LVCESPGPMSYQNRILVSIVPGYTEGGGRLPECPICFEDMEPGQKVGRLECLCVFHNECI 251

Query: 148 DQWICRNS 155
             W+ R S
Sbjct: 252 QMWLERKS 259

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 137 GCNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
            CNH FH +CI++W+   +A CPL  +++   +
Sbjct: 76  ACNHAFHLHCINKWLQTRNA-CPLDNQTWQFAK 107

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 137 GCNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
            C H FH +CI++WI +    CPL  + + L R
Sbjct: 80  ACGHAFHLHCINKWI-KTRDACPLDNQPWQLAR 111

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 119 TCAIC----QEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKR 163
           TCAIC     ED   L  V L  CNH F   CI  W+ ++S  CP+C+ 
Sbjct: 89  TCAICCCVYLEDSYPLV-VKLPNCNHKFDLQCITLWLSKSST-CPMCRN 135

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           D+   C IC+ DF K+    L  C H F + CI ++I R S  CPLC
Sbjct: 23  DALLRCHICK-DFLKV--PVLTPCGHTFCSICIREYINRQSK-CPLC 65

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 14/63 (22%)

Query: 113 GADSRTT-CAICQ-------EDFNKLNNV-----CLLGCNHVFHTYCIDQWICRNSACCP 159
           GA   T  CAIC        E+  + +N+      +  C+H+FHT C++ W+      CP
Sbjct: 694 GASKHTADCAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGY-KLQCP 752

Query: 160 LCK 162
           +C+
Sbjct: 753 VCR 755

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 1/104 (0%)

Query: 59  EMDSAEFEKVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRT 118
           E D  + ++ ++    +E+   +D ++  K  T    +   P    S  E+   G +S +
Sbjct: 167 EPDPIDNKRKRAAGDGTEEDSNDDNKKKRKLATAGAANDTAPLASTSTTENTDTGNNSSS 226

Query: 119 TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           T     E+   L++   L C+H+F   C+ +W  +    CPLC+
Sbjct: 227 TNIEEAEEPVYLHSPVKLPCDHIFGRECLYKW-SKLENSCPLCR 269

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C HVF   CI QW   N++ CP+C+
Sbjct: 229 LKCGHVFGRVCIYQWTKENNS-CPICR 254

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 95  FHRIFPTQQYSKVESLGPGADSRTTCAICQ-------EDFNKLNNV-----CLLGCNHVF 142
           +H+  P Q    +   G  A     CAIC        E+  + + V      +  C H+F
Sbjct: 684 YHKAMPAQD---LLEHGSTAGYTIDCAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIF 740

Query: 143 HTYCIDQWICRNSACCPLCK 162
           HT C++ W+      CP+C+
Sbjct: 741 HTQCLENWMSYKLQ-CPVCR 759

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 116 SRTTCAICQEDFNKLNNVCLL-----GCNHVFHTYCIDQWICRNSACCPLCK 162
           +  TCAICQ +F  L++   L      CNH F   C+  W+ +N+  CP+C+
Sbjct: 67  AEDTCAICQCNF--LDDPYPLVAKVPRCNHKFDLECLSIWL-QNNHTCPMCR 115

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 111 GPGADSRTTCAICQ-------EDFNKLNNV-----CLLGCNHVFHTYCIDQWICRNSACC 158
           G  +     CAIC        +D  + + V      +  C+H+FHT C++ W+      C
Sbjct: 682 GSSSSYSVDCAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYK-LQC 740

Query: 159 PLCK 162
           P+C+
Sbjct: 741 PVCR 744

>KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {ON}
           Anc_6.332 YCR066W
          Length = 461

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           DS   C IC+ DF K+    L  C H F + CI + I + SA CPLC
Sbjct: 23  DSLLRCHICK-DFLKV--PVLTPCGHTFCSICIREAINK-SAKCPLC 65

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 135 LLGCNHVFHTYCIDQWICRNSA---CCPLCKRSYSLPRVFH 172
           +  C H +   CI  W+  N+A    CP C+ S S+P V +
Sbjct: 6   MTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLN 46

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 120 CAICQEDFNKLNN---VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           C+IC   +N+ +    V L  C+H F   C+  W+ +NS  CPLC+
Sbjct: 86  CSICCSKYNEDDYPLVVELPHCSHRFDLECLTPWLLKNST-CPLCR 130

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 6/51 (11%)

Query: 118 TTCAICQEDFNKLNNVC-LLGCNHVFHTYCIDQWICRNSA-----CCPLCK 162
           T C IC E+      +  LL C+H FH+ CI +W    +       CP C+
Sbjct: 8   TECPICMEEIGPHEPLGELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 7/106 (6%)

Query: 120 CAICQEDF-NKLNNVCLLGCNHVFHTYCIDQWICRNSAC-CPLCKRSYS--LPRVFHPQV 175
           CAIC ED   K +   L  C H +H+ CI +W        CP+C+      + +++    
Sbjct: 6   CAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCRIDAEELVVKLYGCAE 65

Query: 176 RYIDDKIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRNISTLR 221
           + ID + G + N        +   DL  +L E +D  L  +IS LR
Sbjct: 66  KIIDLQKGFAVNQVVN-HVINTEPDLIDELAEALDNNL--HISELR 108

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 130 LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKR 163
           L++   L C H+F   C+D+W  +    CPLC+R
Sbjct: 295 LHSPVQLPCAHIFGRECLDKW-SQIENSCPLCRR 327

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 119 TCAICQEDFNK-LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           +C +C E  +  +  +  + C H FH  C+++W  +NS  CP+C+ S
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKW--KNSK-CPICRFS 325

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           C IC+ DF  L    L  C H F + CI +++  NS  CPLC
Sbjct: 28  CHICK-DF--LKTPVLTPCGHTFCSVCIREYLQSNSK-CPLC 65

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 120 CAICQEDFNKLNN---VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           C+IC E+F +      + L  C+H F   CI  W+  NS  CP+C+
Sbjct: 87  CSICFENFREDEYPLVIELPHCSHKFDLQCISVWLSSNST-CPVCR 131

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 138 CNHVFHTYCIDQWICRNSACCPLCKRSYSLPR 169
           CNH FH +CI++W+   +A CPL  + +   +
Sbjct: 105 CNHAFHLHCINKWLQTRNA-CPLDNQPWQFAK 135

>Kwal_0.82 s0 complement(38098..40035) [1938 bp, 645 aa] {ON}
           YFR029W (PTR3) - regulator of peptide permease [contig
           76] FULL
          Length = 645

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 123 CQEDFNKLNNVCLLGC----NHVFHTYCIDQWICRNSACCPLCKRSYS------LP-RVF 171
           C   +  +++  +L C    +   H   I  W C N ACCP+C+ S S       P R  
Sbjct: 32  CTAKYEIVSDASMLNCGCIISQALHEALI--WRCENQACCPVCQYSPSSLIGPVKPLRTL 89

Query: 172 HPQVRYI--DDKIGASYNSSSRAEQADMWLDL 201
           + Q+++   ++      +SS R EQ+ +  +L
Sbjct: 90  YDQLQFFKREETTSPGTHSSLRQEQSMLQQNL 121

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           C IC+ DF  L N  L  C H F + CI  ++  N   CPLC
Sbjct: 27  CHICK-DF--LKNPVLTPCGHTFCSLCIRGYLS-NEPKCPLC 64

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1290

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 2/43 (4%)

Query: 118  TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSAC-CP 159
            T C +C++   KL   C+L C H  H  C  +W        CP
Sbjct: 1241 TLCVLCEQPLKKLT-FCVLNCGHEGHPECFKKWFMNEEMSECP 1282

>NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.332
           YCR066W
          Length = 469

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 99  FPTQQYSKVESLGPGADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACC 158
           F T +  K++ +    D+   C IC+ DF K+    L  C+H F + CI +++  NS  C
Sbjct: 11  FKTTKIPKLQEI----DTLLRCHICK-DFLKV--PVLTPCSHTFCSLCIREYLKDNSK-C 62

Query: 159 PLC 161
           PLC
Sbjct: 63  PLC 65

>TBLA0F04250 Chr6 complement(1046788..1047993) [1206 bp, 401 aa]
           {ON} Anc_6.362 YNR043W
          Length = 401

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 106 KVESLGPGADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQW 150
           +++S+ P    +   AIC +DF    N+ ++  N  FH  C+D +
Sbjct: 226 RIDSIVPDRFKKMQTAICSKDFETFANLTMMDSNS-FHAVCLDSF 269

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 21/92 (22%)

Query: 86  LPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAIC-------------QEDFNKLN- 131
           LP+ +  D +H   P  Q   +E       S+  C +C              E+ +K++ 
Sbjct: 666 LPQHVIPDGYHYHRPVPQSILME-----YGSQNNCFVCPICMVDVPVYVEETEETHKIDA 720

Query: 132 -NVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
            +  +  C+H+FHT C++ W+      CP+C+
Sbjct: 721 QSYMITPCSHIFHTECLENWMSYKLQ-CPVCR 751

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%)

Query: 117  RTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWIC-RNSACCP 159
             T+C +C+    KL  V +L C H  H  CI +W    N   CP
Sbjct: 1290 NTSCVLCERPLKKLTMV-ILPCGHEGHFQCIQEWFLDENEQECP 1332

>NDAI0E01840 Chr5 complement(367943..371395) [3453 bp, 1150 aa] {ON}
           Anc_2.411
          Length = 1150

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 17/94 (18%)

Query: 83  KEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFNKLNNVCLLGCNHVF 142
           +EEL K +  D+  +   ++++  +E           C+IC  +   + NV    C H F
Sbjct: 872 EEELAKAIA-DIQQKYENSEKFRSLE-----------CSICTTEPINVENVVFTECGHPF 919

Query: 143 HTYCIDQWICRNSA-----CCPLCKRSYSLPRVF 171
              C+D++    S       CP C+   S  R+ 
Sbjct: 920 CENCLDEYFAFQSQKKLDFNCPNCREGISPSRLL 953

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 113 GADSRTTCAICQEDF-------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
            A     C +C ED        +  +    L CNH  H  C+  W+ R S  CP+C+ S
Sbjct: 307 NASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMER-SQTCPICRVS 364

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 101 TQQYSKVESLGP---GADSRTTCAICQEDFNKLNN---VCLLGCNHVFHTYCIDQWICRN 154
           T + S+V + GP   GAD+  T A   E  N+++       L C H+F   CI +W   +
Sbjct: 240 TNEVSEVSASGPFAPGADAPDTPA--PETSNQMDYKHCPTELPCGHIFGRDCIFKWTKEH 297

Query: 155 SACCPLCK 162
           ++ CP+C+
Sbjct: 298 NS-CPICR 304

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C H+ H  C+  W+ R S  CP+C+
Sbjct: 369 LPCGHILHLNCLKNWMER-SQTCPICR 394

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C HV H  C+  W+ R S  CP+C+
Sbjct: 375 LPCGHVLHLSCLKNWMER-SQTCPICR 400

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 12/90 (13%)

Query: 120 CAICQEDFNKLN--NVCLLGCNHVFHTYCIDQWIC-RNSACCPLCK---RSYSLPRVFHP 173
           C IC +D N  +     L  CNH +H  CI +W    +++ CPLC+   ++  +    H 
Sbjct: 12  CPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCRCQPKTMIVLSRNHN 71

Query: 174 QVRYIDD----KIGASYNSSSRAEQADMWL 199
            V  ID     +IG   N S+R   AD+ L
Sbjct: 72  GVETIDHTINFEIGVLANLSAR--MADLIL 99

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 13/55 (23%)

Query: 120 CAICQEDF------------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           CAIC  +                N   +  C HVFHT C++ W+      CP+C+
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKLQ-CPVCR 752

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 13/56 (23%)

Query: 119 TCAICQEDFN------------KLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           +CAIC  +               +++  +  C+H+FHT C++ W+      CP+C+
Sbjct: 693 SCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQ-CPVCR 747

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 8/57 (14%)

Query: 113 GADSRTTCAICQEDF-------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
            A     C +C +D        N       L CNH  H  C+  W+ R S  CP+C+
Sbjct: 309 AASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMER-SQTCPICR 364

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +C+IC     ++    ++ C H F   CI  W+ R  + CP+CK   S+  V++
Sbjct: 1235 SCSIC---LGEVEIGAIIKCGHYFCKNCILTWL-RAHSKCPICKSVCSVSEVYN 1284

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           DS   C IC+ DF  L    L  C H F + CI +++ + S  CPLC
Sbjct: 27  DSLLRCHICK-DF--LKASVLTPCGHSFCSICIRKYLQKESK-CPLC 69

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHPQVRYI 178
            +C+IC     ++    ++ C H F   CI  W+ R+ + CP+CK       V++ + +  
Sbjct: 1242 SCSIC---LGEVEVGAIIKCGHYFCKSCILTWL-RSHSKCPICKSFCRTSEVYNFKFKNT 1297

Query: 179  DDK 181
            ++K
Sbjct: 1298 NEK 1300

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 116 SRTTCAICQEDFNKLNN---VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           S  TC IC  +F        V L  C H F   C+  W+ +N+  CP+C+
Sbjct: 100 SDDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTT-CPMCR 148

>Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, 2022
            aa] {ON} complement(33393..38306,38308..39462) [6069 nt,
            2023 aa]
          Length = 2022

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 81/203 (39%), Gaps = 52/203 (25%)

Query: 113  GADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI-----CRNSACCPLCKRSYSL 167
              D  T   I +E   K+     + CNH FH  C+D+++        +  CPLC ++YS 
Sbjct: 1316 AGDLGTDWEIVKEQGKKV----FVSCNHKFHLKCVDRYLAKKKFKFAAFICPLC-QTYS- 1369

Query: 168  PRVFHPQVRYIDDKIGASYNSSSRAEQADMWLDLFPDLGEV----MDQILKRNISTLRK- 222
               + P  + ID+   +S+   +  ++     D    LGE      ++    +IS + K 
Sbjct: 1370 -NCYLPVPKTIDE---SSFTVETILDEDFQIEDQVGLLGEFSVSDYEKFYNASISVIEKS 1425

Query: 223  -------------------LAMCVSFTNQRSIAEI----------TIIREGHRRYELLKR 253
                               L +  ++ N  S+ EI          T++   H++YE LK 
Sbjct: 1426 KNFDKNFDVELLTGKQDSILVLLTNWINTISMMEIAGRMDLEYNKTLLHGKHQKYETLKN 1485

Query: 254  -VDDVCLESLRDELRRPSIERRP 275
             +  +CL +L   L  P+ E  P
Sbjct: 1486 MLISICLMTLT--LGAPNDELTP 1506

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWICRNS--ACCPLCKRSYSL 167
           C IC+  F +    C         ++G C H FH +CI +W+   +    CP+C++ + L
Sbjct: 56  CGICRASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFEL 115

>ZYRO0B12804g Chr2 (1035145..1037157) [2013 bp, 670 aa] {ON} similar
           to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
           E3 ubiquitin ligase for Rad6p required for the
           ubiquitination of histone H2B recruitment of Rad6p to
           promoter chromatin and subsequent methylation of histone
           H3 (on L4 and L79) contains RING finger domain
          Length = 670

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N+ +  C HVF   C  + +      CP C +++S
Sbjct: 618 CSLCSKNWK---NMAIKSCGHVFCENCCKERLASRMRKCPTCNKAFS 661

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +C+IC     ++    ++ C H F   CI  W+ R  + CP+CK   S+  V++
Sbjct: 1238 SCSIC---LGEVEIGAIIKCGHYFCKSCILTWL-RAHSKCPICKGFCSISEVYN 1287

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
            YOL138C
          Length = 1365

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 120  CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSA-CCP 159
            C +C+E   K+  + LL C H  H  C  +W  + +   CP
Sbjct: 1317 CVLCEEPMKKMT-ISLLACGHEGHFDCFKKWFIQEAMDSCP 1356

>AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR066W
           (RAD18)
          Length = 443

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           DS   C IC+   + L    L  C H F + CI +++ + S  CPLC
Sbjct: 27  DSLLRCHICK---DMLQTPVLTQCGHTFCSLCIREYLNKESR-CPLC 69

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 115 DSRTTCAICQEDFNKLNN---VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           +S   C+IC  ++ +      V L  CNH F   C+  W+ R S  CPLC+
Sbjct: 102 NSTDNCSICYTNYLEDEYPLVVELPHCNHRFDLECLSVWLSR-STTCPLCR 151

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1321

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 118  TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQW-ICRNSACCP 159
            T C  C++    L  + LL C H  H  C+ +W I  N+  CP
Sbjct: 1270 TLCVYCEKPMKGLT-MGLLSCGHEGHFACLREWFITENADTCP 1311

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 116 SRTTCAICQEDF--NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           +R+ C IC+E    + +  V +  C H  H +C D++I ++S  CP C  S
Sbjct: 367 TRSNCPICREYMFTSTMAVVYMDPCGHAIHQHCFDEYI-KHSYKCPNCNVS 416

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 6/68 (8%)

Query: 129 KLNNVCLLGCNHVFHTYCIDQWIC------RNSACCPLCKRSYSLPRVFHPQVRYIDDKI 182
           K  ++ ++ C H FH  C+ +W        R    CPLC+      + F  ++  +  ++
Sbjct: 176 KDTDIVMIPCQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSEL 235

Query: 183 GASYNSSS 190
             + NS +
Sbjct: 236 KVTLNSHT 243

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRV 170
           CA+C    +K+ +  +  C H+F   CI  W CR    CP C++   + ++
Sbjct: 228 CALC---LSKITDPSVGPCGHIFCWDCIVDW-CRERPECPFCRKKCEIQQI 274

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCKRS 164
           L C H+ H  C+  W+ R S  CP+C+ S
Sbjct: 369 LPCCHILHLGCLKNWMER-SQTCPICRLS 396

>TDEL0A01980 Chr1 (360689..361222) [534 bp, 177 aa] {ON} Anc_2.423
          YMR118C
          Length = 177

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%)

Query: 4  LSWHRNSM--ITGVVLGVFIPVLTIAFTMTTVF 34
          L+W+ +S+  ITGV+LG     +TIAF ++T+F
Sbjct: 67 LTWYLSSLHRITGVILGSGFFAVTIAFGISTLF 99

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 118 TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSAC---CPLCKRS-YSLP 168
           T C IC +    +    + GC H +  +CI  W+   S+    CP C+ S  S+P
Sbjct: 36  TICTICHD---YMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMP 87

>Kpol_463.7 s463 (15987..18608) [2622 bp, 873 aa] {ON}
           (15987..18608) [2622 nt, 874 aa]
          Length = 873

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 46/82 (56%), Gaps = 5/82 (6%)

Query: 7   HRNSMITGVVLGVFIPVLTIAFTMTTVFYWRSRLGFLDEYRLDI--PIHRNSDTEMDSAE 64
           +   +I+  + G+FI +  ++  +TT     ++L + DEYR  I   I++N+D++ + + 
Sbjct: 396 YNAGIISRKIFGMFILMALVSTFVTTPL---TQLVYTDEYRKKIQQKINKNTDSDNEKSL 452

Query: 65  FEKVKSLIQVSEKYDTEDKEEL 86
           FE    +I+ SE +  E  E++
Sbjct: 453 FESEDVIIEDSEVHSLEKFEQI 474

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWIC-RNSACCPLCK 162
           CAIC E+F K +   L  C+H FH  CI  W    +   CP C+
Sbjct: 6   CAICFEEF-KEDRCALNPCHHTFHLECIRIWHSYADDLKCPTCR 48

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 120  CAICQEDFNKLN-----NVCLLGCNHVFHTYCIDQWI-CRNSACCPLCKRSYSLPR 169
            CAIC    + ++      VC   CN+ FH  C+ +W     +  CPLC+  ++L +
Sbjct: 1464 CAICYYVLHAIDRKLPTKVCP-TCNNRFHGACLYKWFKSSGNNTCPLCRGEFNLRK 1518

>SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} similar
           to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
           E3 ubiquitin ligase for Rad6p required for the
           ubiquitination of histone H2B recruitment of Rad6p to
           promoter chromatin and subsequent methylation of histone
           H3 (on L4 and L79) contains RING finger domain
          Length = 647

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N  +  C HVF   C  + +      CP C + +S
Sbjct: 595 CSLCSKNWK---NTAIKSCGHVFCEECCKERLAARMRKCPTCNKGFS 638

>Suva_4.175 Chr4 complement(313538..315640) [2103 bp, 700 aa] {ON}
           YDL074C (REAL)
          Length = 700

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N+ +  C HVF   C  + +      CP C +++S
Sbjct: 648 CSLCSKNWK---NMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFS 691

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 118  TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQW-ICRNSACCP 159
            T C +C+    KL  V +L C H  H  CI +W +  N   CP
Sbjct: 1276 TLCVLCERPLKKLTMV-ILPCGHEGHFQCIQEWFLNENEHECP 1317

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C H+F   CI QW   ++  CP+C+
Sbjct: 229 LPCGHIFGRECIRQWTNEHN-TCPICR 254

>Skud_4.182 Chr4 complement(319563..321665) [2103 bp, 700 aa] {ON}
           YDL074C (REAL)
          Length = 700

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N+ +  C HVF   C  + +      CP C +++S
Sbjct: 648 CSLCSKNWK---NMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFS 691

>YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}
           BRE1E3 ubiquitin ligase, forms heterodimer with Rad6p to
           monoubiquinate histone H2B-K123, which is required for
           the subsequent methylation of histone H3-K4 and H3-K79;
           required for DSBR, transcription, silencing, and
           checkpoint control
          Length = 700

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N+ +  C HVF   C  + +      CP C +++S
Sbjct: 648 CSLCSKNWK---NMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFS 691

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C H+ H  C+  W+ R S  CP+C+
Sbjct: 390 LPCGHMLHLSCLKNWMER-SQTCPICR 415

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 119 TCAICQEDFNKLNNVCLLG----CNHVFHTYCIDQW-ICRNSACCPLCK 162
           TC IC +D     N+  +G    CNH FH  C+ +W +  +   CP+C+
Sbjct: 4   TCPICLDD--DRTNIESIGTLQPCNHKFHRDCLRRWHLYAHDLVCPICR 50

>Smik_4.162 Chr4 complement(300502..302598) [2097 bp, 698 aa] {ON}
           YDL074C (REAL)
          Length = 698

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N+ +  C HVF   C  + +      CP C +++S
Sbjct: 646 CSLCSKNWK---NMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFS 689

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 119  TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFH 172
            +C+IC  D   +    ++ C H F   CI  W+ R    CP+CK   S+  V++
Sbjct: 1239 SCSICLGD---VEIGAIIKCGHYFCKNCILTWL-RAHNKCPICKSFCSVSEVYN 1288

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKR 163
           C +C  D   + +   L C H+F   C+ QW C     CPLC++
Sbjct: 266 CILCLAD---MTDPSCLPCGHMFCWACVMQW-CNERNECPLCRQ 305

>KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.405
           YPR093C
          Length = 228

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 13/75 (17%)

Query: 119 TCAICQEDFNKLNNVCLLG-CNHVFHTYCIDQW-ICRNSACCPLCK-----------RSY 165
           +C IC ED    + +  L  CNH +H  CI +W +  N   CP C+           +  
Sbjct: 2   SCPICLEDLAANDIISELKPCNHKYHLVCIRKWQLDSNQLKCPYCQCKTGKMNLKLNKLN 61

Query: 166 SLPRVFHPQVRYIDD 180
           S+ R+ +   + IDD
Sbjct: 62  SVVRIVYDTKKSIDD 76

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C H+ H  C+  W+ R S  CP+C+
Sbjct: 398 LPCGHMLHFSCLKNWMER-SQTCPICR 423

>NDAI0C04230 Chr3 (965070..966062) [993 bp, 330 aa] {ON} Anc_5.339
           YDR313C
          Length = 330

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 23/64 (35%)

Query: 88  KTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCI 147
           K   LD  H I    +            +   C IC ED      V  L C  VFH +CI
Sbjct: 236 KNHILDTDHTIPDNNKVGNRNEAERTEGNLQECPICFEDIEIGEKVARLECLCVFHYHCI 295

Query: 148 DQWI 151
             WI
Sbjct: 296 KSWI 299

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 135 LLGCNHVFHTYCIDQWICRNSACCPLCK 162
           L  CNH F   CI  W+ ++++ CPLC+
Sbjct: 121 LPHCNHKFDLECISVWLSKSTS-CPLCR 147

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 124 QEDFNK---LNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
           QE+ N+   L +   L C+H+F   C+ +W  R+   CPLC+
Sbjct: 247 QEESNEPVYLESPVELPCHHIFGRECLYKW-TRHENTCPLCR 287

>TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON}
           Anc_6.332 YCR066W
          Length = 408

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           C IC+E F  L    L  C H F + CI Q++ R    CPLC
Sbjct: 28  CHICKE-F--LRVPVLTPCGHTFCSLCIRQYL-RQDPKCPLC 65

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C+HVF   CI QW   ++  CP+C+
Sbjct: 225 LPCSHVFGRECIRQWTNLHN-TCPICR 250

>YMR228W Chr13 (724626..725651) [1026 bp, 341 aa] {ON}
           MTF1Mitochondrial RNA polymerase specificity factor; has
           structural similarity to S-adenosylmethionine-dependent
           methyltransferases and functional similarity to
           bacterial sigma-factors; Mtf1p interacts with and
           stabilizes the Rpo41p-promoter complex, enhancing DNA
           bending and melting to facilitate pre-initiation open
           complex formation
          Length = 341

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 112 PGADSRTTCAICQEDFNKLNNVCLLGCNHV--FHTYCIDQW 150
           PG  SR+ C++ +E F     + +   N +  F + CI++W
Sbjct: 184 PGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEW 224

>TDEL0A01850 Chr1 complement(337255..340671) [3417 bp, 1138 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1138

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 61/157 (38%), Gaps = 22/157 (14%)

Query: 40  LGFLDEYRLDIPIHRNSDTEMDSAEFEKVKSLIQVSEKYDTEDKEELPKTLTLDVFHRIF 99
           LG  DE   D+   RNS+ + +    E +     + E      K E      L    R +
Sbjct: 822 LGTQDENDEDL---RNSNQQFN----ESIDVANILGESKTNATKAETDMKAILANVQRKY 874

Query: 100 PTQQYSKVESLGPGADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI-----CRN 154
           P+++  K             C+IC  +   L ++  +GC H F   C+++++      + 
Sbjct: 875 PSEESFK----------NLECSICTTEPINLQSIMFIGCGHCFCGPCLEEFMDFQKQKKL 924

Query: 155 SACCPLCKRSYSLPRVFHPQVRYIDDKIGASYNSSSR 191
              CP C+  +    +   +++   D     YN SS+
Sbjct: 925 ELRCPNCRELFDSQCLLSLRLQEEGDPTLVPYNQSSK 961

>CAGL0I01628g Chr9 complement(132246..134570) [2325 bp, 774 aa] {ON}
           similar to uniprot|P37020 Saccharomyces cerevisiae
           YJR040w GEF1 voltage-gated chloride channel protein
          Length = 774

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 42/117 (35%), Gaps = 34/117 (29%)

Query: 76  EKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGADSRTTCAIC---QEDFNKLNN 132
           +++ T+D E   K + +  F+ I  TQ + K  ++   AD+R    +    +E FNK  N
Sbjct: 9   DRHSTDDPETAAKYIDISKFNNIDETQSFDKFITIDRVADNRNVILLPNAEREFFNKKYN 68

Query: 133 -----------------------VCLLGCNHVF--------HTYCIDQWICRNSACC 158
                                   CL G   VF          YC   W+   S CC
Sbjct: 69  GYINWLWNRGKIFITLTAIAITIGCLAGFIQVFTETLVNWKTGYCTSNWLLNKSFCC 125

>KLTH0B03652g Chr2 (298170..303941) [5772 bp, 1923 aa] {ON} similar to
            uniprot|P19812 Saccharomyces cerevisiae YGR184C UBR1
            Ubiquitin-protein ligase (E3) that interacts with
            Rad6p/Ubc2p to ubiquitinate substrates of the N-end rule
            pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
            the 19S particle of the 26S proteasome
          Length = 1923

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 124  QEDFNKLNNVCLLGCNHVFHTYCIDQWICR-----NSACCPLCK 162
            +ED +K +    + CNH  H  C  ++  +     NS  CPLC+
Sbjct: 1248 REDGSKGSRKVFVSCNHYIHYKCFKRYAQKKRFSTNSFICPLCQ 1291

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 119 TCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKR 163
            C +C    N++ +     C H+F   CI  W C+    CPLC++
Sbjct: 317 NCILC---LNEMTDPSCPPCGHLFCWACIMNW-CKEREECPLCRQ 357

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 3/29 (10%)

Query: 135 LLGCNHVFHTYCIDQWI-CRNSACCPLCK 162
           +L CNHVF   C+ +W    NS  CPLC+
Sbjct: 215 VLPCNHVFGRECLFKWSQLENS--CPLCR 241

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 119 TCAIC----QEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK 162
            CAIC     ED   L  V L  C H F   C+  W+ R++  CP+C+
Sbjct: 89  NCAICCCGYLEDEYPLV-VELPNCGHTFDLQCVSVWLSRSTT-CPMCR 134

>NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}
           Anc_2.71
          Length = 723

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 72  IQVSEKYDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPGA 114
           ++ S K+ T  K  LP    +D FH  F  Q+Y+++ +LG GA
Sbjct: 331 VESSTKFSTSLKRFLPNYNKIDEFHVPF-KQRYNEIGTLGSGA 372

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 135 LLGCNHVFHTYCIDQWICRNSACCPLCKR 163
           L  C H F   CI  W+ +NS+ CP+C+ 
Sbjct: 133 LPNCKHYFDLECITLWLQKNSS-CPICRN 160

>Kpol_1061.54 s1061 (154211..156754) [2544 bp, 848 aa] {ON}
           (154211..156754) [2544 nt, 848 aa]
          Length = 848

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 103 QYSKVESLGPGADSRTTCAICQEDFNKLNN---VCLLGCNHVFHTYCI 147
           QY+K+ +L   +    +C +C+E  +   N   V  L C HV H  C+
Sbjct: 153 QYTKLTNLAKKSFLNESCTLCEESISNRTNGERVIQLECGHVTHQECL 200

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCK-RSY 165
           C +C     ++ +   L C HVF   CI  W   N   CPLC+ RSY
Sbjct: 277 CILC---LMEMTDPSCLPCGHVFCWDCITDWTKENPE-CPLCRQRSY 319

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1353

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 2/41 (4%)

Query: 120  CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWIC-RNSACCP 159
            C  C+    KL  +C+L C H  H  C  +W    N   CP
Sbjct: 1306 CVFCERPIKKLA-MCVLNCGHEGHFECFKKWFLEENMQECP 1345

>Skud_3.140 Chr3 (216311..217780) [1470 bp, 489 aa] {ON} YCR066W
           (REAL)
          Length = 489

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           D+   C IC+ DF K+    L  C H F + CI + +  N   CPLC
Sbjct: 23  DTLLRCHICK-DFLKV--PVLTPCGHTFCSLCIREHL-NNQPSCPLC 65

>KLTH0F07062g Chr6 (616169..617032) [864 bp, 287 aa] {ON} similar to
           uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 287

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 11/98 (11%)

Query: 58  TEMDSAEFEKVKSLIQVSEK----YDTEDKEELPKTLTLDVFHRIFPTQQYSKVESLGPG 113
           +E+DSA    +++ I+ +E     +D     E P      + + I P Q     ++  P 
Sbjct: 170 SEIDSAM--HIQNCIERAESTQQHHDQSSPGESPAQRNRMLVYVIPPDQ-----DTPDPT 222

Query: 114 ADSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI 151
           +     C IC E+    + V  L C  VFH  CI  W 
Sbjct: 223 SQGDPECPICFEEMKPGDKVGRLECLCVFHYDCIKSWF 260

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           L C H+F   CI +W  R    CPLC++  S
Sbjct: 255 LPCGHIFGRECIYKW-SRLENSCPLCRQKIS 284

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 39/97 (40%), Gaps = 9/97 (9%)

Query: 74  VSEKYDTEDKEELPKT-LTLDVFHRIFPTQQYSKVESLGPGADSRTTCAICQEDFNKLNN 132
           V  K +  D  +LPKT  + + F  +       KV   G   ++   C++C     +   
Sbjct: 304 VKMKIELNDSWKLPKTQFSTNAFKNV------KKVLFSGDEPNATDNCSLCLSKITEGKP 357

Query: 133 VCLLGCNHVFHTYCIDQWICRNSA--CCPLCKRSYSL 167
           + +  C+H +H  C+   I        CP CK  + L
Sbjct: 358 IFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDL 394

>TBLA0E03140 Chr5 complement(784998..787637) [2640 bp, 879 aa] {ON}
           Anc_6.32 YOL006C
          Length = 879

 Score = 30.0 bits (66), Expect = 8.7,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 181 KIGASYNSSSRAEQADMWLDLFPDLGEVMDQILKRNISTLRKLAMCVSFTNQRSIAE--- 237
           K+  +YN+S   +     LDL P+ G + ++ILK N +      +C    +QRS+ +   
Sbjct: 624 KVFRTYNASKTMQDQ---LDLIPNEGTIAEKILKYNAANRTVAILC---NHQRSVGKNHA 677

Query: 238 ITIIREGHRRYEL 250
           +++ + G +  EL
Sbjct: 678 VSVQKSGEKIREL 690

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 118 TTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQW-ICRNSACCPLCK-RSYSLPRVFHPQV 175
           + CAIC +  +K +   L  CNH +H  CI  W    N   CP C+  +  L    +P++
Sbjct: 17  SICAICLDAIDK-SIAKLEPCNHKYHIDCIRTWHNYSNDLNCPTCRIETNQLSVNIYPEI 75

Query: 176 R 176
           +
Sbjct: 76  Q 76

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 115 DSRTTCAICQEDF--NKLNNVCLL-GCNHVFHTYCIDQWICRNSACCPLCKRS 164
           D    CAIC   F  +K   V  L  C H F   CI  W+ + S  CPLC+ S
Sbjct: 99  DKNAECAICFCKFLEDKYPLVAELPHCGHRFDLECISVWLSK-SDTCPLCRDS 150

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKR 163
           +S   C +C     ++ +     C H+F   CI  W C+  + CPLC++
Sbjct: 266 ESSRKCILC---LTEMKDPSCAPCGHIFCWNCIINW-CKERSECPLCRQ 310

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 115 DSRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLC 161
           D+   C +C+ DF  L    L  C H F + CI +++ R    CPLC
Sbjct: 39  DTLLRCHVCK-DF--LKTPVLTPCGHTFCSLCIREYLNR-ELKCPLC 81

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 116 SRTTCAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYSLPRVFHP 173
           S   C +C    N + +     C H+F   C+  W C+  A CPLC R   LP+   P
Sbjct: 286 SSRNCILC---LNDMVDPSCSPCGHIFCWRCLMDW-CQERAECPLC-RQPCLPQQILP 338

>KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {ON}
           similar to uniprot|Q07457 Saccharomyces cerevisiae
           YDL074C BRE1 E3 ubiquitin ligase for Rad6p required for
           the ubiquitination of histone H2B recruitment of Rad6p
           to promoter chromatin and subsequent methylation of
           histone H3 (on L4 and L79) contains RING finger domain
          Length = 663

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 120 CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRSYS 166
           C++C +++    N  L  C HVF   C  + +      CP C + +S
Sbjct: 611 CSLCSKNWK---NTALKTCGHVFCDVCCKERLAARMRKCPTCNKPFS 654

>ZYRO0A08932g Chr1 complement(712694..716260) [3567 bp, 1188 aa]
           {ON} similar to uniprot|P32849 Saccharomyces cerevisiae
           YLR032W RAD5 Single-stranded DNA-dependent ATPase
           involved in postreplication repair contains RING finger
           domain
          Length = 1188

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 105 SKVESLGPGADSRTT--CAICQEDFNKLNNVCLLGCNHVFHTYCIDQWI 151
           S+++   P ADS  T  C+IC  D  +L+ V    C H F   C+ +++
Sbjct: 918 SRIQEKYPTADSLKTLECSICTADPIELHKVLFTECCHSFCEECLKEYL 966

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 29.6 bits (65), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 136 LGCNHVFHTYCIDQWICRNSACCPLCK 162
           L C H+F   C+ +W C+    CPLC+
Sbjct: 233 LPCGHIFGRECLYRW-CKLENTCPLCR 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,964,043
Number of extensions: 1222611
Number of successful extensions: 5732
Number of sequences better than 10.0: 283
Number of HSP's gapped: 5875
Number of HSP's successfully gapped: 283
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)