Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.212013.485ON1011101147290.0
KLTH0F14674g3.485ON1010100939120.0
SAKL0F02926g3.485ON1050105430040.0
Suva_7.4133.485ON103797626810.0
Smik_6.2213.485ON103697726640.0
YGR125W3.485ON103698126470.0
Skud_7.4363.485ON103697626390.0
NDAI0G009903.485ON1054105925690.0
NCAS0E009503.485ON1052107225600.0
KAFR0C019103.485ON102094825550.0
ZYRO0C07986g3.485ON1024105925380.0
CAGL0I10626g3.485ON107097625150.0
TDEL0D055303.485ON1031104125100.0
Kpol_480.183.485ON1057106124390.0
KLLA0E04731g3.485ON106099224290.0
KNAG0B008603.485ON1088109223850.0
TBLA0C044403.485ON115091323790.0
TPHA0D042103.485ON104997923300.0
AFR304W3.485ON1015104022800.0
Skud_16.2868.99ON7452861202e-05
Smik_16.2418.99ON7442841149e-05
TDEL0C012808.99ON7272921040.001
Suva_16.3228.99ON7422851030.001
YPR003C8.99ON7542841030.002
SAKL0B03124g8.99ON7443011000.004
KLLA0E14059g8.99ON706242960.010
ZYRO0F04796g8.99ON735292930.028
Ecym_7084na 1ON689271890.070
SAKL0H08800gna 1ON620222840.29
NCAS0B048008.99ON724292830.40
TBLA0C052708.99ON776307830.42
KLTH0G16764g8.99ON710322744.1
KNAG0D023908.99ON716134744.5
Kpol_467.118.99ON744281745.0
CAGL0L09207g8.99ON725285727.0
YMR004W (MVP1)6.38ON51146718.6
Kpol_309.98.877ON578967110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21201
         (1011 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1826   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1511   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1161   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1037   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1030   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1024   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1021   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...   994   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...   990   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....   988   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...   982   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...   973   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...   971   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...   944   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   940   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...   923   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   920   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   902   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   882   0.0  
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    51   2e-05
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    49   9e-05
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    45   0.001
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    44   0.001
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    44   0.002
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    43   0.004
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    42   0.010
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    40   0.028
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    39   0.070
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    37   0.29 
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    37   0.40 
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    37   0.42 
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    33   4.1  
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    33   4.5  
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    33   5.0  
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    32   7.0  
YMR004W Chr13 (274017..275552) [1536 bp, 511 aa] {ON}  MVP1Prote...    32   8.6  
Kpol_309.9 s309 (18180..19916) [1737 bp, 578 aa] {ON} (18180..19...    32   10.0 

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1826 bits (4729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/1011 (89%), Positives = 907/1011 (89%)

Query: 1    MVSNRPKNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDGSPHYYLGRSYVAN 60
            MVSNRPKNKPSISEAISVSLGL           YIPRANPFSHTGDGSPHYYLGRSYVAN
Sbjct: 1    MVSNRPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDGSPHYYLGRSYVAN 60

Query: 61   XXXXXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVS 120
                               SYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVS
Sbjct: 61   LSPPPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVS 120

Query: 121  EDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQY 180
            EDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQY
Sbjct: 121  EDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQY 180

Query: 181  VSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPI 240
            VSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVI           SYGMIIFPI
Sbjct: 181  VSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPI 240

Query: 241  TEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGL 300
            TEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGL
Sbjct: 241  TEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGL 300

Query: 301  PGEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLIT 360
            PGEKDRVLSTTIVCYALSSIIT             KIVGFFPRHILIGCIGGVGYFLLIT
Sbjct: 301  PGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLIT 360

Query: 361  GLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIA 420
            GLEVTTRVAK            TNIEVLGKWG            QHAFGNSLVLPAFYIA
Sbjct: 361  GLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIA 420

Query: 421  ALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTM 480
            ALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTM
Sbjct: 421  ALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTM 480

Query: 481  LALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVL 540
            LALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVL
Sbjct: 481  LALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVL 540

Query: 541  FIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGK 600
            FIR               TFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGK
Sbjct: 541  FIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGK 600

Query: 601  LNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVS 660
            LNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVS
Sbjct: 601  LNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVS 660

Query: 661  RDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDF 720
            RDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDF
Sbjct: 661  RDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDF 720

Query: 721  KNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDL 780
            KNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDL
Sbjct: 721  KNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDL 780

Query: 781  NSALEWCENEFLIQFKDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDE 840
            NSALEWCENEFLIQFKDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDE
Sbjct: 781  NSALEWCENEFLIQFKDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDE 840

Query: 841  QSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAA 900
            QSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAA
Sbjct: 841  QSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAA 900

Query: 901  HSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEM 960
            HSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRM           CVEVEM
Sbjct: 901  HSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEM 960

Query: 961  ETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
            ETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS
Sbjct: 961  ETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1009 (73%), Positives = 833/1009 (82%), Gaps = 3/1009 (0%)

Query: 4    NRPKNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDGSPHYYLGRSYVANXXX 63
            +RP+NK S+SEAISVSLGL            +PR NPFS+  DGSPHYYLGRSYVAN   
Sbjct: 4    SRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANLSP 63

Query: 64   XXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVSEDD 123
                            S RPEQSQSIHQS+SLRRQTAALSNEF+ TFEFEDQL  ++E+ 
Sbjct: 64   PPLAIKERFSGDPTSSS-RPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAEN- 121

Query: 124  GHSTTAEEPSMNGTLISPVSSVPDTPI-DINEPSNALLPPNAEHDLEYGSIDGYEHQYVS 182
            G++   +E  M G+ ISP SS P+  + D  + SN LLPPN + DLEYGSID ++HQYVS
Sbjct: 122  GNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVS 181

Query: 183  LQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITE 242
            LQS+R+G+N+  I P+AS+R+K +FT RR+ NY+PAVI           SYGMIIFPITE
Sbjct: 182  LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMIIFPITE 241

Query: 243  PLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPG 302
            PLFSHLGP+G+SMFY+SS++SQL+YS GFSAFGNAVGSEMIEITPFYH+MAASI+A +PG
Sbjct: 242  PLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPG 301

Query: 303  EKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGL 362
            EKDRVL+TTIVCYA+SSI+T             KIVGFFPRHILIGCIGGVGYFL+ITG 
Sbjct: 302  EKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGF 361

Query: 363  EVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAAL 422
            EVTTR +K            T+ E+LGKWG            Q A  NSLVLP FYIAAL
Sbjct: 362  EVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAAL 421

Query: 423  LLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLA 482
            LLFHFIVALIPSLSL  LRDSGW+FPAT +TEHWFDFY LYNFKLVSWP++LKQ+PTMLA
Sbjct: 422  LLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLA 481

Query: 483  LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFI 542
            LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSG++GSVQNYLVYTNS+LFI
Sbjct: 482  LTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFI 541

Query: 543  RXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLN 602
            +               TFGIM++GPVIVAYIPVCIVGSLIFLLGYELLKEAL DTWGKLN
Sbjct: 542  KAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLN 601

Query: 603  NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRD 662
            NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQT+NGEFDGQVARSTV RD
Sbjct: 602  NFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRD 661

Query: 663  YIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKN 722
            YIQTQFLNKIGEQIHVLKLQNLLFFGTI+SIEEKIDKLLELSDKD+SKKRIKYLILDFKN
Sbjct: 662  YIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKN 721

Query: 723  INADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNS 782
            INADNIDYSAAEGFNRIKRFT SKRIHLIISSIKT+DRIYRAFNKVG L+GVELFDDLNS
Sbjct: 722  INADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNS 781

Query: 783  ALEWCENEFLIQFKDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDEQS 842
            ALEWCENEFL QF+DLRNKTKLKA +KQ+R++SK  LPFNTPRNN FVSVAQKLFTDEQS
Sbjct: 782  ALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQS 841

Query: 843  MTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHS 902
            M HLK+ Y+E+ PVL LLLSALQR+RP+IMS +K VKE EE++WS+L K+F+K+RLAA S
Sbjct: 842  MPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQS 901

Query: 903  LLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEMET 962
            LL HK+NIF V+E+GMVKVTYNLRQGQLYE +SGKTCYGR+            VE++MET
Sbjct: 902  LLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMET 961

Query: 963  DCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
            DC+LWI+D+A LAKLK+ENL LYTE+LLVTLC+NQDRLKELLGHCLVSS
Sbjct: 962  DCALWILDEANLAKLKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1054 (58%), Positives = 737/1054 (69%), Gaps = 57/1054 (5%)

Query: 7    KNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTG-DGSPHYYLGRSYVANXXXXX 65
            KN+ SISEAI++SLGL              +AN  S    + S +YYLGRSYV +     
Sbjct: 5    KNRKSISEAITISLGLHSDNIKQP-----SQANRRSSMNPENSSNYYLGRSYVGSFSSPS 59

Query: 66   XXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEF---EDQLAGVSED 122
                          S   + S+SIH+SV L RQTAALSN F+D+ +    E  +A   E 
Sbjct: 60   FLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEF 119

Query: 123  DGHSTTAEEPSMNGT-------------LISPVSSVPDTPIDINEPSNALLPPNAEH-DL 168
               +   E    NG+             +     ++      +NE +  L P +A   DL
Sbjct: 120  QNEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSPTSAAATDL 179

Query: 169  EYGSI--------DGYEH-QYVSL------------QSRRSGANTHNIGPDASLREKMMF 207
            EYG+           YE  QYVSL            Q+   G N  N     SLR+ ++ 
Sbjct: 180  EYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTY--HSLRQPVVR 237

Query: 208  T--------ARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVS 259
            +        + + +NYMPAVI           SYGMIIFPITEP+FSHLGPTG+SMFYVS
Sbjct: 238  SYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVS 297

Query: 260  SIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSS 319
            +I+SQL+YS GFSAFGN +GSEMIEITPF+H MA SI+  LPG  D ++STTIVCYALSS
Sbjct: 298  TILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSS 357

Query: 320  IITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXX 379
            I T             KIVGFFPRHILIGC+GGVGYFLLITG+EV TRV+K         
Sbjct: 358  IFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLR 417

Query: 380  XXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDI 439
                N EVLGKW             QH F NSLVLP+FYI  L LFHF+VA++P+LSL+ 
Sbjct: 418  ELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNS 477

Query: 440  LRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALA 499
            LR+SGWIFP   S+ HW+DFY LY+F+ V W ++LKQ+PTMLALTFFGILHVPINVPALA
Sbjct: 478  LRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALA 537

Query: 500  MSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXT 559
            MSIG+DK DVDKELIAHGYSN LSG  GS+QNYLVYTNS LFIR               T
Sbjct: 538  MSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGT 597

Query: 560  FGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAF 619
            F +MI+GPVI+++IP+CIVGSLIFLLGYEL+KEAL+DTWGKLN FEY T+V IVFTMG F
Sbjct: 598  FVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVF 657

Query: 620  DFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVL 679
            DFVLGIIVGILIACFSFLVDSTKLQT+NGEF+GQVARSTV RDYIQT+FLNK+GEQIHVL
Sbjct: 658  DFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVL 717

Query: 680  KLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRI 739
            KLQNLLFFGTI+SIEEKID LLE+SDKDSS++RIKYLILDFKNINADNIDYSAAEGFNRI
Sbjct: 718  KLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRI 777

Query: 740  KRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLR 799
            KRFT +KRI LIISSI   DRIY AFNKVG+L+ VELF DLNSALEWCENEFL+Q+K +R
Sbjct: 778  KRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIR 837

Query: 800  NKT--KLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDEQSMTHLKSSYRERPPVL 857
             +T  KL+A KKQ++ +SK  LP NTPRNNQ V+VAQK+F DEQ++THL++ Y++R PVL
Sbjct: 838  TRTKAKLQAQKKQEKHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKREPVL 897

Query: 858  PLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETG 917
            PLLL AL++FRPQIMS DK VK+ EE  WS LC YF +KR A  SLLLH +N+FF++E+G
Sbjct: 898  PLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFFLVESG 957

Query: 918  MVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKL 977
            M+K+TY+L QGQ YETMS KTCYGR+            V ++ ETDC++WIID   LA L
Sbjct: 958  MLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLY-VNIKTETDCAVWIIDATNLANL 1016

Query: 978  KRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
            K +NL LY E+LLV + INQ R KELLG+ LVSS
Sbjct: 1017 KEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/976 (55%), Positives = 655/976 (67%), Gaps = 63/976 (6%)

Query: 84   EQSQSIHQSVSLRRQTAALSNEF------EDTFEFEDQLAGVSEDDGHST----TAEE-- 131
            +  + IH S +L RQTA LSNEF      E++   +D +  +  DD        T EE  
Sbjct: 77   QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMRTIEENI 136

Query: 132  -----PSMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSR 186
                    +  L+SP SS      ++++  N  L  +   DLE G   GY+  + S   R
Sbjct: 137  DEEYADEYSRLLLSPASS------NVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLR 190

Query: 187  RSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFS 246
                     GP +  +    F ++    Y+PA +           SYGMIIFPITEP+FS
Sbjct: 191  --------FGPRSVWQWFTSFPSK-FAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 241

Query: 247  HLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDR 306
            HLGPTG+SMFY+S+IISQ +YSGG+S+F + VGSEMIEITPFYH MA  I   L G  D 
Sbjct: 242  HLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDE 301

Query: 307  VLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTT 366
            +++TTI CY +SS++T             KIVGFFPRHILIGCIGGVGYFL+ITG+EVTT
Sbjct: 302  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 361

Query: 367  RVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFH 426
            RVAK            TN + L KW             Q  F NSLVLP FYI  L+LFH
Sbjct: 362  RVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFH 421

Query: 427  FIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFF 486
            FIVA+IP+LSLD LRDSGWIFP   S   W+D Y L+N   V W ++L+QIPTM+ALTFF
Sbjct: 422  FIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFF 481

Query: 487  GILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXX 546
            GILHVPINVPALAMS+ +DK DVDKELIAHGYSNF SG++GSVQNYLVYTNSVLFIR   
Sbjct: 482  GILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 541

Query: 547  XXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEY 606
                        T  IM++GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KLN FEY
Sbjct: 542  DSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEY 601

Query: 607  ATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQT 666
             TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTVNGE++G VA+STV RDY+QT
Sbjct: 602  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQT 661

Query: 667  QFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINAD 726
            +FL+ IGEQI+VLKLQN+LFFGTI+SIEEKI++LLE+S+KDS+K+RIKYLILDFKNINAD
Sbjct: 662  KFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINAD 721

Query: 727  NIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEW 786
            NIDYSAAEGFNRIKRFT +KRI LIISSIK  D IY AFN VG+L  VELF DLN ALEW
Sbjct: 722  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEW 781

Query: 787  CENEFLIQFKDLRNKTK------------------------------LKAGKKQDRRMSK 816
            CENEFL Q+K LR K K                              L  G  +D+    
Sbjct: 782  CENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHL 841

Query: 817  VPLPFNTPRNNQFVSVAQKLFT-DEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSD 875
            + LP NTPRN+Q +SVAQ +F  DEQ++ +LK  Y+E  PVLP+LL AL+++RP I+S  
Sbjct: 842  MSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEV 901

Query: 876  KSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMS 935
            + V+E E + W+ LC YF ++RLA+ SLLLH DN+FF+IETGM+K  Y L QG LYE MS
Sbjct: 902  QKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMS 961

Query: 936  GKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCI 995
              TC+G++            + +E ETD  LW+ID + L K+K ENL LY EV L+ +CI
Sbjct: 962  NGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCI 1021

Query: 996  NQDRLKELLGHCLVSS 1011
               R KELLG+ LVS+
Sbjct: 1022 KDTRFKELLGYTLVSA 1037

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/977 (54%), Positives = 660/977 (67%), Gaps = 65/977 (6%)

Query: 84   EQSQSIHQSVSLRRQTAALSNEF------EDTFEFEDQL----AGVSEDDGHSTTAEEP- 132
            +  + IH S +L RQTA LSNEF      E++   +D +    +G  +DD    T EE  
Sbjct: 76   QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRKDDQSMRTIEEDI 135

Query: 133  ------SMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSR 186
                    +  L+SP SS      +IN+  N  L      +LE    D YE  Y SL+S 
Sbjct: 136  DEEYSDEYSRLLLSPASS------NINDDRNRGLQNGLTSELE----DDYEGGYQSLRS- 184

Query: 187  RSGANTHNI-GPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLF 245
                 +HN+     + R        + ++Y+PA +           SYGMIIFPITEP+F
Sbjct: 185  -----SHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVF 239

Query: 246  SHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKD 305
            SHLGPTG+SMFY+S+IISQ +YSGG S+F + +GSEMIEITPFYH MA ++   L G+ D
Sbjct: 240  SHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDD 299

Query: 306  RVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVT 365
             +++TTI CY +SS++T             KIVGFFPRHILIGCIGGVGYFL+ITG+EVT
Sbjct: 300  EIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 359

Query: 366  TRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLF 425
            TRVAK            TN + L KW             Q  F NSLVLP+FYI  L+LF
Sbjct: 360  TRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLF 419

Query: 426  HFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTF 485
            HFIVA+IP+LSLD LR +GWIFP  +S   W+D Y L+N   V W ++L+QIPTM+ALTF
Sbjct: 420  HFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTF 479

Query: 486  FGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXX 545
            FGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYTNSVLFIR  
Sbjct: 480  FGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 539

Query: 546  XXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFE 605
                         T  IM++GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KLN FE
Sbjct: 540  ADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFE 599

Query: 606  YATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQ 665
            Y TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQT+NGE++G VA+STV RDY+Q
Sbjct: 600  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQ 659

Query: 666  TQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINA 725
            T+FL+ IGEQI+VLKLQNLLFFGTILSIEEKI+KLL++S+KD++K+RIKYLILDFKNINA
Sbjct: 660  TKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINA 719

Query: 726  DNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALE 785
            DNIDYSAAEGFNRIKRFT +K+I LIISSI+  DRIY AFN VG+L  VELF DLNSALE
Sbjct: 720  DNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALE 779

Query: 786  WCENEFLIQFKDLRNKTK------------------------------LKAGKKQDRRMS 815
            WCENEFL Q+K LR K K                              L  G   D   +
Sbjct: 780  WCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRN 839

Query: 816  KVPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSS 874
             + LP NTPRN Q +SVAQ +F  DEQ++ + K  Y++  PVLP+LL AL+++RP I+S 
Sbjct: 840  LMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE 899

Query: 875  DKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETM 934
             + V+E E + W+ LC YF ++RLA+ SLLLH DN+FF++ETGM+K TY L QG LYE  
Sbjct: 900  IQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIF 959

Query: 935  SGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLC 994
            S  TC+G++            + +E ETD  LW+ID + L K+K ENL LY EV L+ +C
Sbjct: 960  SNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMC 1019

Query: 995  INQDRLKELLGHCLVSS 1011
            I   R KELLG+ LVS+
Sbjct: 1020 IKDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/981 (54%), Positives = 660/981 (67%), Gaps = 73/981 (7%)

Query: 84   EQSQSIHQSVSLRRQTAALSNEF------EDTFEFEDQL----AGVSEDDGHSTTAEE-- 131
            +  + IH S +L RQTA LSNEF      E++   +D +     G  +DD    T EE  
Sbjct: 76   QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSMRTIEENI 135

Query: 132  -----PSMNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSR 186
                    +  L+SP SS      ++++  N  L  ++  +LE    DGY   Y SL+  
Sbjct: 136  DEEYSDEYSRLLLSPASS------NVDDDRNRGLQNSSLPELE----DGYAGGYQSLRP- 184

Query: 187  RSGANTHNIGPDASLREKMMFT-----ARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPIT 241
                 +HN+      R + ++        +  +Y+PA +           SYGMIIFPIT
Sbjct: 185  -----SHNL----RFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPIT 235

Query: 242  EPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLP 301
            EP+FSHLGPTG+SMFY+S+IISQ +YSGG+S+F + +GSEMIEITPFYH MA +I   L 
Sbjct: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALA 295

Query: 302  GEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITG 361
            G  D +++TTI CY +SS++T             KIVGFFPRHILIGCIGGVGYFL+ITG
Sbjct: 296  GNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 355

Query: 362  LEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAA 421
            +EVTTRVAK            T+ + L KW             Q  F NSLVLP+FYI  
Sbjct: 356  IEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILT 415

Query: 422  LLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTML 481
            L+LFHFIVA+IP+LSLD LR +GWIFP  +S   W+D Y L+N   V W ++L+QIPTM+
Sbjct: 416  LVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMM 475

Query: 482  ALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLF 541
            ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYTNSVLF
Sbjct: 476  ALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLF 535

Query: 542  IRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKL 601
            IR               T  IMI+GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KL
Sbjct: 536  IRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKL 595

Query: 602  NNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSR 661
            N FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQT+NGE++G VARSTV R
Sbjct: 596  NRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYR 655

Query: 662  DYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFK 721
            DY+QT+FL+ IGEQI+VLKLQNLLFFGTI+SIEEKI++LL++S+KD++K+RIKYLILDFK
Sbjct: 656  DYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFK 715

Query: 722  NINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLN 781
            NINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN VG+L  VELF DLN
Sbjct: 716  NINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLN 775

Query: 782  SALEWCENEFLIQFKDLRNKTK------------------------------LKAGKKQD 811
            SALEWCENEFL Q+K LR K K                              L  G   D
Sbjct: 776  SALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGD 835

Query: 812  RRMSKVPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQ 870
               + + LP NTPRN Q +SVAQ +F  DEQ++ + K  Y++  PVLP+LL AL+++RP 
Sbjct: 836  TARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPD 895

Query: 871  IMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQL 930
            I+S  + V+E E + W+ LC YF ++RLA+ S LLH DNIFF++ETGM+K TY L QG L
Sbjct: 896  IISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTL 955

Query: 931  YETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLL 990
            YE  S  TC+G++            + +E ETD  LW+ID + L KLK +NL LY EV L
Sbjct: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVAL 1015

Query: 991  VTLCINQDRLKELLGHCLVSS 1011
            + +CI   R KELLG+ LVS+
Sbjct: 1016 MVMCIKDTRFKELLGYTLVSA 1036

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/976 (54%), Positives = 657/976 (67%), Gaps = 73/976 (7%)

Query: 89   IHQSVSLRRQTAALSNEF------EDTFEFEDQLAGVSEDDGHSTTA---------EEPS 133
            IH S +L RQTA LSNEF      E++   +D +  +  DD     +         EE S
Sbjct: 81   IHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMRTIVENIDEEYS 140

Query: 134  --MNGTLISPVSSVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSRRSGAN 191
               +  L+SP SS      ++++  N  L      +LE    D Y   Y SL+       
Sbjct: 141  DEYSRLLLSPASS------NVDDERNRALQSGPISELE----DDYGGGYQSLRP------ 184

Query: 192  THNIGPDASLREKMMFT-----ARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFS 246
            +HN+      R + ++        +  +Y+PA +           SYGMIIFPITEP+FS
Sbjct: 185  SHNL----RFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 247  HLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDR 306
            HLGPTG+SMFY+S+IISQ +YSGG+S+F + +GSEMIEITPFYH MA ++   L G  D 
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300

Query: 307  VLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTT 366
            +++TTI CY +SS++T             KIVGFFPRHILIGCIGGVGYFL+ITG+EVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 367  RVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFH 426
            RVAK            TN + L KW             Q  F NSLVLP FYI  L+LFH
Sbjct: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420

Query: 427  FIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFF 486
            FIVA+IP+LSLD LR++GWIFP  +S   W+D Y L+N   V W ++L+QIPTM+ALTFF
Sbjct: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 487  GILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXX 546
            GILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYTNSVLFIR   
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 547  XXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEY 606
                        T  +M++GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KLN FEY
Sbjct: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 607  ATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQT 666
             TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQT+NGE++G VA+STV RDY+QT
Sbjct: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 667  QFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINAD 726
            +FL+ IGEQI+VLKLQN+LFFGTI+SIEEKI+KLL++S+KD+ K+RIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINAD 720

Query: 727  NIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEW 786
            NIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN VG+L  VELF DLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 787  CENEFLIQFKDLRNKTK------------------------------LKAGKKQDRRMSK 816
            CENEFL Q+K LR K K                              L  G+ +D   + 
Sbjct: 781  CENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840

Query: 817  VPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSD 875
            + LP NTPRN Q +SVAQ +F  DEQ++ + K  Y+   P+LP+LL AL+++RP I+S  
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900

Query: 876  KSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMS 935
            ++V+E E + W+ LC YF ++RLA+ SLLLH DNIFF++ETGM+K TY L QG LYE  S
Sbjct: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 936  GKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCI 995
              TC+G++            + +E ETD  LW+ID + L K+K ENL LY EV L+ +CI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020

Query: 996  NQDRLKELLGHCLVSS 1011
               R KELLG+ LVS+
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1059 (52%), Positives = 689/1059 (65%), Gaps = 60/1059 (5%)

Query: 5    RPKNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDGS-PHYYLGRSYVANXXX 63
            +  N+ SIS+ ISVSLGL             P   P    G+ S    YLGRSYV+    
Sbjct: 4    QKNNRHSISDTISVSLGLQNQDPQILQQ---PNGGPTVTLGNMSDTSNYLGRSYVSGFLS 60

Query: 64   XXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVS--- 120
                            + +   ++SIH S +L RQTAA+S +F +   FED +       
Sbjct: 61   ASPAINHDNNNNTLPIANQ-HLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYIS 119

Query: 121  --EDD-----GHSTTA----EEPSMNGTLISPVSSVPD-TPIDINE-------PSNALL- 160
              EDD     G   TA     E  ++  L      V D  P D N        PS++LL 
Sbjct: 120  NLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLLA 179

Query: 161  -----PPNAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNY 215
                 P  +E + E          Y S++ R S +  ++  P      K + T   ++ Y
Sbjct: 180  GENLLPSISEQEQETAQ-RRRTSAYQSIRHRNSESTEYSSIPTW---RKYIATPSEIIQY 235

Query: 216  MPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFG 275
            +PA I           SYGMIIFPITEP+FSHLGPTG+SMFY+S+IISQ I+SGG+S+F 
Sbjct: 236  LPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFP 295

Query: 276  NAVGSEMIEITPFYHAMAASIVAGLP-GEKDRVLSTTIVCYALSSIITXXXXXXXXXXXX 334
              +GSEMIE+TPF+H MA +I   LP G  D +++TT+ CY +SS++T            
Sbjct: 296  CGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHL 355

Query: 335  XKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXX 394
             KIVGFFPRHILIGCIGGVGYFL+ITG+EV+TRVAK            T++  L +W   
Sbjct: 356  GKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLP 415

Query: 395  XXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTE 454
                      Q    NSLVLP+FYI  L+LFHF+VA+IPSLSL+ LRDSGWIFP   +  
Sbjct: 416  TLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDS 475

Query: 455  HWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELI 514
             W+D Y L+N   V W +ILKQIPTMLALTFFGILHVPINVPALAMS+ +D+ DVDKELI
Sbjct: 476  KWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELI 535

Query: 515  AHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIP 574
            AHG SNF+SG+ GS+QNYLVYTNSVLFIR               T  IMI+GPVI+++IP
Sbjct: 536  AHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIP 595

Query: 575  VCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACF 634
            +CIVGSLIFLLGYELL EAL D  GK++ FEY T+V IVFTMG FDFVLG+IVGILIACF
Sbjct: 596  ICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACF 655

Query: 635  SFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIE 694
            SFL+DSTKLQT+NGEFDG VA+STV RD IQT+FLN IGEQI+VLKLQNLLFFGTI+SIE
Sbjct: 656  SFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIE 715

Query: 695  EKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISS 754
            EKIDKLLE+SD DSSK RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISS
Sbjct: 716  EKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISS 775

Query: 755  IKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLKAGKK----- 809
            I+  D IY AFN VG+LEGVELF+DLNSALEWCENEFL ++K LR KT+ K   K     
Sbjct: 776  IRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTLREKTRQKRKNKIDINL 835

Query: 810  --------QDRRMS-KVP-----LPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERP 854
                    ++R M  ++P     LP NTPRNNQ +SVAQ +F  +EQ+   LK  ++  P
Sbjct: 836  AITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEP 895

Query: 855  PVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVI 914
             VLPLLL  L+++RP+I+S+DKS++E E + WS LC Y  ++ L A S L H +N FF++
Sbjct: 896  SVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIV 955

Query: 915  ETGMVKVTYNLRQGQLYETMSGKTCYGRM--XXXXXXXXXXXCVEVEMETDCSLWIIDDA 972
            E+G++K T+ L  G LYETMS +TCYG++              + ++ ETDC+LW+ID  
Sbjct: 956  ESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWVIDMD 1015

Query: 973  GLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
             L +++ ENL LY E++L+ + I   R KELLG+ LVS+
Sbjct: 1016 ALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1072 (51%), Positives = 692/1072 (64%), Gaps = 94/1072 (8%)

Query: 5    RPKNKP-SISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDGSPHYYLGRSYVANXXX 63
            + KNK  SIS +ISVSLGL             PR + F      + +Y +GRSYV+    
Sbjct: 10   KKKNKQQSISGSISVSLGLQQEEE--------PRDDYFDDENVNNNNY-MGRSYVSGFLS 60

Query: 64   XXXXXXXXXXXXXXX--XSYRPEQ---SQSIHQSVSLRRQTAALS------------NEF 106
                              +Y   Q   ++ IH S  L +QTAA+S             ++
Sbjct: 61   VSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDY 120

Query: 107  EDTFEFED------------QLAGVSEDDGHSTTAEEPSMNGT--------LISPVSSVP 146
               F+ ED            Q  G+ +D+       EP             LISP+SS  
Sbjct: 121  ITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSS-- 178

Query: 147  DTPIDINEPSNALLPPNAEHDLE-YGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKM 205
                +IN   + LLP     D+  Y SI  Y     SL SR S     NI          
Sbjct: 179  ----NINPNIDDLLPTVTGEDVSSYQSI--YRTATPSL-SRNSETIWQNIAD-------- 223

Query: 206  MFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQL 265
                 + ++Y+PA +           SYGMIIFPITEP+FSHLGPTG+SMFY+S+IISQ 
Sbjct: 224  --FPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQT 281

Query: 266  IYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITXXX 325
            IYS G+S+F + +GSEMIE+TPF+H MA +I   LPG  D +++TTI CY +SS++T   
Sbjct: 282  IYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLT 341

Query: 326  XXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNI 385
                      KIVGFFPRHILIGCIGGVGYFLL+TG+EVTTRVAK            ++ 
Sbjct: 342  FYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDW 401

Query: 386  EVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGW 445
              L KW             Q  F NSLVLP+FYI  L+LFHFIVA+IPSL+L+ LRDSGW
Sbjct: 402  ATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGW 461

Query: 446  IFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLD 505
            IFP   S   W+D Y L++FK V W ++ KQIPTMLALTFFGILHVPINVPALAMS+ LD
Sbjct: 462  IFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLD 521

Query: 506  KLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIV 565
            K DVDKELIAHG SNF+SG +GS+QNYLVYTNSVLFIR               T  +M +
Sbjct: 522  KYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFI 581

Query: 566  GPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGI 625
            GPVI+++IP+CIVGSLIFLLGYELL EAL+D WGK++NFEY T+V IV TMG FDFVLGI
Sbjct: 582  GPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGI 641

Query: 626  IVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLL 685
            IVGILIACFSFL+DSTKLQT+NGE+DG VA+STV RD IQT+FLN IGEQI+VLKLQNLL
Sbjct: 642  IVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLL 701

Query: 686  FFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSS 745
            FFGTI+SIEEKID+LLE+  KDSS+ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +
Sbjct: 702  FFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 761

Query: 746  KRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK 805
            K+I L+ISSIK  D IY+AF+ VG+L+GVELF+DLNSALEWCENEFL ++K LR+K K +
Sbjct: 762  KKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSR 821

Query: 806  AGKKQ-------------------DRRMS-KVP-----LPFNTPRNNQFVSVAQKLF-TD 839
              +KQ                   D++ +  +P     LP NTPRN+Q +SVAQ +F  +
Sbjct: 822  LHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNE 881

Query: 840  EQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLA 899
            EQ++ +LK+  +++ P LPLLL  L+++RP I+S+DK+VKE E + WS LC YF K  LA
Sbjct: 882  EQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLA 941

Query: 900  AHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVE 959
            + S L+H +NIFF++ETG++K T+NL QG +YETMS +TCYG++            + + 
Sbjct: 942  SQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI-TGQHNESTLKTLTIR 1000

Query: 960  METDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
             E D  LW+ID   L K++ EN  L+TE+ L+ + +  +R KELLG+ LVS+
Sbjct: 1001 AEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/948 (54%), Positives = 653/948 (68%), Gaps = 28/948 (2%)

Query: 85   QSQSIHQSVSLRRQTAALSNEFEDTFE--FEDQLAGVSEDDGHSTTAEEPSMNGTLISPV 142
            +++SIHQS  L +QTAA+  +F ++ E   +D L  +   D  +    + S+      PV
Sbjct: 80   RNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNINEHKESL------PV 133

Query: 143  SSVPDTPID----INEPSNALLPPNAEHDLEYGSI-DGYEHQYVSLQSRRSGANTHNIGP 197
            + V  TP D     +E S  LL P++  + E  SI +G  H Y S++S +          
Sbjct: 134  TVVLSTPADEVEEQDESSRLLLTPSSS-NAEVSSIAEGLRHHYSSIESTKDNNMPIEEQQ 192

Query: 198  DASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFY 257
            D ++ EK+       + Y PA +           SYGMIIFPI+EP+FSHLGPTGMSMFY
Sbjct: 193  DNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFY 252

Query: 258  VSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGE--KDRVLSTTIVCY 315
            +S+II Q IYS G+S+F + +GSEMIEITPF+H MA +I+  LPGE  +D +++TTI CY
Sbjct: 253  ISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCY 312

Query: 316  ALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXX 375
             +SS+ T             KIVGFFPRHILIGCIGGVGYFLLITG+EVTTR+AK     
Sbjct: 313  VISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSL 372

Query: 376  XXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSL 435
                   T+  +L KW             Q  F  SLVLP+FYIA L+LFHFIVA+IP L
Sbjct: 373  PLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRL 432

Query: 436  SLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINV 495
            SL  LR++GWIF  T     W+D Y L++F  V W ++ KQIPTMLALTFFGILHVPINV
Sbjct: 433  SLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINV 492

Query: 496  PALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXX 555
            PALAMS+ +DK DVDKELIAHG SN +SG+ GS+QNYLVYTNSVLFIR            
Sbjct: 493  PALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLL 552

Query: 556  XXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFT 615
               T  +M++GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KL  FEY TVV IV T
Sbjct: 553  IFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLT 612

Query: 616  MGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQ 675
            MG  DFVLGIIVGILIACF FL+DS+KLQT+NGEF G+VA+STV+RD IQ++FLN IG+Q
Sbjct: 613  MGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQ 672

Query: 676  IHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEG 735
            I+VLKLQNLLFFGTI+SIEEKIDKLLE+SD++SSK++IKYLILDF+NINADNIDYSAAEG
Sbjct: 673  IYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEG 732

Query: 736  FNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQF 795
            FNRIKR T SK I LIISSIK  DRIY +FNKVG+L GVELF+DLN ALEWCENEFL Q+
Sbjct: 733  FNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQY 792

Query: 796  KDLRNKTKLK----AGKKQDRRMSK---VPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLK 847
            K +R + K+K    A    D  +SK   + L  NTPRN Q  SVAQ +F  +EQ++  LK
Sbjct: 793  KMIRERIKIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLK 852

Query: 848  SSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHK 907
            + ++++ PVLPLLL AL+++RP I+S DK  K  E   WS L  YF KKR+A+ S+L H 
Sbjct: 853  NRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHG 912

Query: 908  DNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMX----XXXXXXXXXXCVEVEMETD 963
            +NIFF++E G++KVT++L QG++YETMS + CYG++                + ++ E D
Sbjct: 913  NNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEAD 972

Query: 964  CSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
              +WIID + L K+K EN+ LY E++L+ + I   R K LLGH LVS+
Sbjct: 973  TVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1059 (50%), Positives = 676/1059 (63%), Gaps = 91/1059 (8%)

Query: 4    NRP-KNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTG-----DGS-------PH 50
            +RP +N+ SIS AISVSLGL           +    N  ++ G     D S       P 
Sbjct: 6    DRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPF 65

Query: 51   Y----YLGRSYVANXXXXXXXXXXXXXXXXXXXSYRP---EQSQSIHQSVSLRRQTAALS 103
            Y    Y GRSY+                     S  P    +S+SIH S  + RQTA LS
Sbjct: 66   YNSNNYAGRSYLGG-GFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTAELS 124

Query: 104  NEFEDTFEFEDQLAGVSEDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPN 163
            N F D                 +T  EE          V +  D   D N   +  +   
Sbjct: 125  NNFSD----------------DTTGMEE----------VRNRYDAMEDENSSLHHYMTHQ 158

Query: 164  AEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXX 223
                L  G+ + + +   S  +R SG++    G D             +++Y P+ +   
Sbjct: 159  DYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQD-------------VLHYFPSAVLGL 205

Query: 224  XXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMI 283
                    SYGMIIFPITEP+FSHLG TG+SMFY+S+IISQ +YSGG S+F + +GSEMI
Sbjct: 206  LLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMI 265

Query: 284  EITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPR 343
            E+TPF+H MA +I   +PG+ D +++TTI CYA+SS++T             KIVGFFPR
Sbjct: 266  EVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPR 325

Query: 344  HILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXX 403
            HILIGCIGGVGYFLLITGL VTTR+AK             + ++L KW            
Sbjct: 326  HILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVN 385

Query: 404  XQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLY 463
             Q  F NSLVLP+FYI  L+LFHF+VA++PS+SLD LRD GWIFPA  S + WFD Y L+
Sbjct: 386  TQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLF 445

Query: 464  NFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLS 523
            ++  V W ++L QIPTMLALTFFGILHVPINVPALA+S+ +DK DVDKELIAHGYSNF+S
Sbjct: 446  DWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFIS 505

Query: 524  GIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIF 583
            G++GS+QNYLVYTNSVLFIR               TF +M++GPVIV++IP+CIVGSLIF
Sbjct: 506  GMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIF 565

Query: 584  LLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKL 643
            LLGYELL EAL DT GK+ NFEY T+V IV TMG +DFVLG+IVGILIACFSFLVDSTKL
Sbjct: 566  LLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKL 625

Query: 644  QTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLEL 703
            QT+NGEFDG+VARSTV+RDY+Q+ FLN +GEQI+VLKLQN+LFFGTI+SIEEKIDKLLE+
Sbjct: 626  QTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEI 685

Query: 704  SD-KDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIY 762
            +D K SSK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  D IY
Sbjct: 686  TDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIY 745

Query: 763  RAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK--------------AGK 808
              F+ VG+L+ VELF+DLN ALEWCENEFL ++K LR++ + K              A K
Sbjct: 746  NVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNVTSAIEAAAAK 805

Query: 809  K---QDRRMSK-----------VPLPFNTPRNNQFVSVAQKLFTDEQSMTHL--KSSYRE 852
            K    + ++SK             LP NTPRN+Q +SVAQ +F DE+ +  L  +S    
Sbjct: 806  KVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMFNDEEDVDALEDESCNDG 865

Query: 853  RPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFF 912
            + PVLPLLL AL+ +R  I S+D  ++E E +LWS L  YF K+RL   S+LLH  + FF
Sbjct: 866  QQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFF 925

Query: 913  VIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDA 972
            V+E+G++K+  +L QG +YETMS +TC G +            V +  ETD  LW+ID  
Sbjct: 926  VVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVD 985

Query: 973  GLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
            GL KL+ ENL LYTE++L+ L I   R ++LLG+ LVS+
Sbjct: 986  GLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/976 (51%), Positives = 650/976 (66%), Gaps = 52/976 (5%)

Query: 86   SQSIHQSVSLRRQTAALSNEFEDTFEFEDQLAGVSEDDGHSTTAEEPSMN----GTLISP 141
            S++IH+   L RQTAA++ EF+D     +  + + E       A+E  ++      L + 
Sbjct: 97   SRAIHEQNKLHRQTAAIAEEFDDG-TIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDND 155

Query: 142  VSSVPDTPIDIN----------EPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSRRSGAN 191
            + +   TP+ IN          + + ALL P++ ++  YGS+   E  ++S  S     +
Sbjct: 156  LITDNKTPVSINLKRATDPELEQQTVALLTPSSSNNDNYGSVSP-EENFLSATSNYEQES 214

Query: 192  THN---IGPDASLRE-------KMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPIT 241
            T+    + P A  R+       K   T +R+ NYMPA I           SYGMIIFPIT
Sbjct: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMIIFPIT 274

Query: 242  EPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLP 301
            EP+F+ LGPTG+SMFY+S+IISQ IYS G+S+F + +GSEMIEITPFYH MA +I   LP
Sbjct: 275  EPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP 334

Query: 302  GEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITG 361
            G  D +++TTI CY +SS+IT             KIVGFFPRHILIGCIGGVGYFL+ITG
Sbjct: 335  GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394

Query: 362  LEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAA 421
            LEVTTR+AK             +  +L KW             Q  F NSLVLP+FYI  
Sbjct: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIIT 454

Query: 422  LLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTML 481
            L+LFHF+VA+ P+LSL  LR +GWIFPA + +  W+D Y  ++     W +++KQIPTML
Sbjct: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514

Query: 482  ALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLF 541
            ALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSNF SG+ GSVQNYLVYTNSVLF
Sbjct: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574

Query: 542  IRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKL 601
            IR               T  +M++GPVI+++IP+CIVGSLIFLLGYELL EA+ D +GK+
Sbjct: 575  IRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634

Query: 602  NNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSR 661
              FEYAT+  IV TMG FDFVLGI+VGILIACFSFLVDSTKLQTVNGEFDG VA+STV R
Sbjct: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694

Query: 662  DYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFK 721
            D+ QT+FL++IGEQI+VLKLQN+LFFGTI+SIEEKI++LLE+SD D SK RIK+LILDFK
Sbjct: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754

Query: 722  NINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLN 781
            NINADNIDYSAAEGFNRIKR+T +KRI LIIS+I+ SDRIY  FN+VG+L+ +ELF+DLN
Sbjct: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814

Query: 782  SALEWCENEFLIQFKDLRNKTKLKAGKK----------QDRRMSK--------------- 816
            SALEWCENEFL Q+K+LR K + K  ++          Q RR  +               
Sbjct: 815  SALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTSSLMQNL 874

Query: 817  VPLPFNTPRNNQFVSVAQKLFTDEQSM-THLKSSYRERPPVLPLLLSALQRFRPQIMSSD 875
            + L  NTPRN Q VS AQ+ F++EQ + T + +  +   P+L +LL AL+ +RP I+S D
Sbjct: 875  MSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPNIVSMD 934

Query: 876  KSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMS 935
               +  E   W  LC YF +K   A++  LH +N FF+++ G++KV YNL  G +YET+S
Sbjct: 935  TEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLS 994

Query: 936  GKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCI 995
              TCYG++            + V++ETD  LWIID+  +  +K +N+ LYTE++L+ L I
Sbjct: 995  NGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAI 1054

Query: 996  NQDRLKELLGHCLVSS 1011
               R KELLG+ LVS+
Sbjct: 1055 RDTRFKELLGYTLVSA 1070

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1041 (51%), Positives = 685/1041 (65%), Gaps = 54/1041 (5%)

Query: 5    RPKNKPSISEAISVSLGLXXXXXXXXXXXYIPR-------ANPFSHTGDG--SP-HYYLG 54
            R + + SISEAISVSLGL             PR       +NP+    D   SP + YLG
Sbjct: 11   RNRGRHSISEAISVSLGLQNTNT--------PRDHHDGNHSNPYDSQNDQFMSPRNNYLG 62

Query: 55   RSYVANXXXXXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFED 114
            RSYV+                    +    +++SIH + +L RQTA L  +F +    ED
Sbjct: 63   RSYVSGFLSCSPYGSNSLESDRLPIARM--RTKSIHAAKNLHRQTAKLCEDFNEP-NVED 119

Query: 115  QLAGVSEDDGHSTTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPNAE--HDLEYGS 172
                 +  D  S T E   M    IS    + D   ++  P +       +   D+    
Sbjct: 120  N----NIQDYVSATEEPRPME---ISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYESL 172

Query: 173  IDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXS 232
            + G    Y ++ +   G         ++L  + M ++ ++V+Y+PA I           S
Sbjct: 173  VTGAHGGYRAIPTSPGGG--LRTSSRSALWRQFMSSSSKLVHYLPATILGLLLNVLDGLS 230

Query: 233  YGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAM 292
            YGMIIFPITEP+FSHLGP+G+SMFYVS+IISQ+IYS GFS F   VGSEMIE+TPF+H+M
Sbjct: 231  YGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSM 290

Query: 293  AASIVAGLPGEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGG 352
            A +I   LPG  D +L+TTI CY +SS++T             KIVGFFPRHILIGCIGG
Sbjct: 291  ALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGG 350

Query: 353  VGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSL 412
            VGYFL++TGLEVTTRVAK            T++  L KW             Q  F NSL
Sbjct: 351  VGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSL 410

Query: 413  VLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPM 472
            VLP FYIA L+ FHF+VA+IP++SL  LR+ GWIFP   S + W+D Y L+    V W +
Sbjct: 411  VLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGL 470

Query: 473  ILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNY 532
            I KQ PTMLAL+FFGILHVPINVPALA+S+ +DK DVDKELIAHGYSN LSG +GS+QNY
Sbjct: 471  IAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNY 530

Query: 533  LVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKE 592
            LVYTNS+LFIR               TF +M++GPVI++YIP+CIVGSLIFLLGYELL E
Sbjct: 531  LVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYE 590

Query: 593  ALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDG 652
            AL +T GK+ NFEY T+  IV TMG FDFVLG+IVGILIACFSFLVDSTKLQT+NGE+DG
Sbjct: 591  ALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDG 650

Query: 653  QVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELS-DKDSSKK 711
            ++A+STV RDY+Q++FL+ IGEQI+VLKLQ+LLFFGTI+SIEEKI+KLLE+S D+ +SK+
Sbjct: 651  KIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKR 710

Query: 712  RIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGML 771
            RIK LILD KNINADNIDYSAAEGFNRIKRFT SK I LIISSI  +D IY AF+KV +L
Sbjct: 711  RIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLL 770

Query: 772  EGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK----------AGKKQDRRMSKVP--- 818
            + VELF DLN ALEWCENE L ++K+LR K + +          A     + +  VP   
Sbjct: 771  DDVELFGDLNGALEWCENELLFKYKELRAKARDRLQNKMQMANLAANNDTKAIDGVPKSH 830

Query: 819  -------LPFNTPRNNQFVSVAQKLFTDEQ-SMTHLKSSYRERPPVLPLLLSALQRFRPQ 870
                   LPFNTPRN+Q +SVAQ++F +EQ ++  LK +Y+E PPVLPLLL AL+ +RP 
Sbjct: 831  HMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALKPYRPG 890

Query: 871  IMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQL 930
            I+S D +VK  E  LWS LC YF ++RLA+ S+LLH  +IFFV+ETG++K+ Y+L QG +
Sbjct: 891  ILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIV 950

Query: 931  YETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLL 990
            YE++S +TCYG +            V ++ ET+  LW+ID + LA+LK+ENL+LYTE++L
Sbjct: 951  YESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELIL 1010

Query: 991  VTLCINQDRLKELLGHCLVSS 1011
            +   + + R +++LG+ LVS+
Sbjct: 1011 LIATVKEQRYRQILGYTLVSA 1031

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1061 (49%), Positives = 670/1061 (63%), Gaps = 68/1061 (6%)

Query: 3    SNRPKNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDGSPHYY-------LGR 55
            SNR + +PS SEA+SVSLGL                N +S   D +           +GR
Sbjct: 13   SNR-RVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIGR 71

Query: 56   SYVANXXXXXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEFEDQ 115
            SY  +                     R   S+SI    +L RQTA +SN+F DT   E +
Sbjct: 72   SYAGSISSNSPSLYLNTSRTDELLPIRKMPSKSILGPDALHRQTAEISNDFNDTSMDEAK 131

Query: 116  LAGVSE-----------DDGHSTTAEEPSM---NGTLISPVSSVPDTPIDINEPSNALLP 161
            +    E           +   S     P       + +SP+ S       + +   ALL 
Sbjct: 132  IKRYIELLNRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLDGLEQ--RALLT 189

Query: 162  PNA-----EHDLE--YGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVN 214
            P++     E DLE  Y  I+   +  + +QSR   +        +S   K +     ++N
Sbjct: 190  PSSSIVGNEFDLESTYDEINNDYNSILRIQSRELTS--------SSFATKGL----ELLN 237

Query: 215  YMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAF 274
            Y+PA I           SYGMIIFPITEPLFS LGPTG+SMFY+S+I+ QL+ SGGFS+F
Sbjct: 238  YLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSF 297

Query: 275  GNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITXXXXXXXXXXXX 334
               +GSEMIEITPFYH MA +I   LP + + V++TTI CY +SS++T            
Sbjct: 298  PCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKM 357

Query: 335  XKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXX 394
             KIVGFFPRHILIGCIGGVGYFL+ITG+EV+TR+ K            TN++ LGKW   
Sbjct: 358  GKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLP 417

Query: 395  XXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTE 454
                      Q    NSLVLP+FYI  ++LFHFIVA++P+LSLD LR++GWIFP TDS  
Sbjct: 418  TLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSKN 477

Query: 455  HWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELI 514
             W+D Y  +N   + W ++LKQIPTMLALTFFGILHVPINVPALAMS+ +DK DVD+ELI
Sbjct: 478  SWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDRELI 537

Query: 515  AHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIP 574
            AHGYSN +SG++GSVQNYLVYTNSVLFIR               T  +M+ G VIV++IP
Sbjct: 538  AHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIP 597

Query: 575  VCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACF 634
            VCIVGSLIFLLGYEL+ EAL DT G + +FEY T++ IVF MG +DFVLGIIVGILIAC 
Sbjct: 598  VCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIACL 657

Query: 635  SFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIE 694
            SF+VD TKL+T+NGE+DGQVA+STV RDYIQT+FLN I +QI++LKLQN+LFFGTI+SIE
Sbjct: 658  SFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIE 717

Query: 695  EKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISS 754
            EKIDKLLE+SDKD SK+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT  KRI LIISS
Sbjct: 718  EKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIISS 777

Query: 755  IKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLKAGKK----- 809
            IK  D+IY  FN V +LE VELFDDLNSALEWCENEFL Q+  L  K K +  K+     
Sbjct: 778  IKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISISK 837

Query: 810  ------------------QDRRMSKVPLPFNTPRNNQFVSVAQKLFTDE-QSMTHLKSSY 850
                               D++M  + LP NTPRNNQ +SVA+K+F +E Q+ +  K+  
Sbjct: 838  DSGSTYFSRNRSDSGLSAADQQM-LMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHN 896

Query: 851  RERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNI 910
                PVL LLL +++ FRP + S D S++E E   W  L  YF +      S L++  N 
Sbjct: 897  ETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNF 956

Query: 911  FFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIID 970
            FFV+E+G+V+VT++L QG + ETMS +TCYG++            +  + ET+  +W+ID
Sbjct: 957  FFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMID 1016

Query: 971  DAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011
            D  ++++K+ENLNLYTE+LL+ + I + R K L+G+ LVS+
Sbjct: 1017 DDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/992 (50%), Positives = 650/992 (65%), Gaps = 67/992 (6%)

Query: 81   YRPEQSQSIHQSVSLRRQTAALSNEFE-----------------DTFEFE-DQLAGVSED 122
            +  E S+ IH+S +L +QTA LSN F+                 D F  E + +  + E+
Sbjct: 73   FSSEGSKLIHESGNLHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEE 132

Query: 123  DG------------------------HSTTAEEPSMN-----GTLISPVSSVPDTP-IDI 152
            D                         H    E+ ++      G   +      D+  +D+
Sbjct: 133  DQMLQNSQRRRGRMSVDAAADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDV 192

Query: 153  NEPSN--ALLPPNAEHDL--EYGSIDGYEH---QYVSL---QSRRSGANTHNIGPDASLR 202
            ++ +   ALLP N+ + +  EYG+ D       QY+SL    +   G  +       S  
Sbjct: 193  SDSTENLALLPTNSHNSMYVEYGTFDEENQPATQYISLLPDGASSGGFTSQGFRSSMSHY 252

Query: 203  EKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSII 262
            +K      R+  Y PAV            SYGMIIFPITEPLFSHLGPTG+SMFYVS++I
Sbjct: 253  DKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVI 312

Query: 263  SQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLP-GEKDRVLSTTIVCYALSSII 321
             QL +S G S+F +A+GSEMIEITPF+H MA SI+  +P G  ++V+STTIVCYALSSII
Sbjct: 313  CQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSII 372

Query: 322  TXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXX 381
            T             KIVGFFPRHILIGCIGGVGYFL+ITGLEV TRV +           
Sbjct: 373  TGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSL 432

Query: 382  XTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILR 441
             T+ ++L KW             Q    NSLVLP+FYI  LLLFHF+VAL+PSLSLD LR
Sbjct: 433  FTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLR 492

Query: 442  DSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMS 501
            D GWIF   ++ E+W+DFY LY+FK V W +I KQ+PTMLALTFFGILHVPINVPALAMS
Sbjct: 493  DFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMS 552

Query: 502  IGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFG 561
            + +DK DVDKELIAHGYSN +SG +GS+QNYLVYTNSVLFIR               TF 
Sbjct: 553  LNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 562  IMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDF 621
            +M++GPVI+++IP+CIVGSLIFLLGYEL++EA+ DTWGKL  FEY T+  IV TMG  DF
Sbjct: 613  VMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDF 672

Query: 622  VLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKL 681
            V+GIIVGIL+ACFSFLV+ST+LQT+NGE+DG+VA+STV RDYIQ++FL  IGEQI+VLKL
Sbjct: 673  VIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKL 732

Query: 682  QNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKR 741
            QN+LFFGTI+SIEEK++ LLE+ + DSSKKRIKYLILDFKNI A +IDYSAAEGFNRIKR
Sbjct: 733  QNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKR 792

Query: 742  FTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNK 801
            F   +RIHLIISSI   D+IY AF+KV + E VELF DLN ALEWCENEFL+++K +R K
Sbjct: 793  FLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTK 852

Query: 802  T---KLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDEQSMTHLKSSYRERPPVLP 858
            T   KL   KK   RMSK  LP NTPRN+QFVS  + ++T+E  +  L +  +ER   LP
Sbjct: 853  TRARKLAQLKKSQNRMSK--LPVNTPRNHQFVSEVRNIYTEEMEIQKLSNELKERQQFLP 910

Query: 859  LLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGM 918
            + L ++++FR  I S ++  +  E  LW  L  YF +K+   ++ + H++N+F V+E+G+
Sbjct: 911  IFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGV 970

Query: 919  VKVTYNLRQGQLYETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLK 978
            + +T++L QG+ YETMS KT YG +            V +  +T+C L  ID   LA LK
Sbjct: 971  LNLTHHLIQGEFYETMSPKTAYGVI---SNVNSDPLAVSITTDTECVLRYIDAESLADLK 1027

Query: 979  RENLNLYTEVLLVTLCINQDRLKELLGHCLVS 1010
              +  L+TE+L++ + I++DR +ELLG+ L+S
Sbjct: 1028 LTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1092 (48%), Positives = 675/1092 (61%), Gaps = 99/1092 (9%)

Query: 5    RPKNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFS-HTGDGSPHYYLGRSYVANXXX 63
            RP  + SISE+ISVSLGL                NP     G+ S   YLGRSYV+    
Sbjct: 11   RPA-RQSISESISVSLGLQNNDARQSD-----NENPLQVLPGESS---YLGRSYVSGLWS 61

Query: 64   XXXXXXXXXXXXXXXXSYRPEQSQSIHQSVSLRRQTAALS-----------------NEF 106
                            S     S+ IH+S  L RQT A+                  NE+
Sbjct: 62   PTQRNNKSGYDLLPT-SNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEY 120

Query: 107  EDTFEF-EDQLAGVSEDD--GHSTTAEEPSMNGTLISPVSS-------VPD-------TP 149
             D  E  E + A +   D  G   T  + ++ G    PV+S       +PD       TP
Sbjct: 121  IDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTP 180

Query: 150  ID-----INEPSNALLPPNAEHDLEYGSIDG----YEHQYVSLQSRRSGANTHNIGPDAS 200
            +      I++ S+  L P   +      ++G    Y  Q  +L S  S      IGP  +
Sbjct: 181  VSSLSVAISDASS--LTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAG--MKIGPPIT 236

Query: 201  LR-EKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVS 259
             + + +   +  +V+Y+PA I           SYGMIIFPITEP+FS LGP+G+SMFY+S
Sbjct: 237  SKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYIS 296

Query: 260  SIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGE-KDRVLSTTIVCYALS 318
            ++ISQ  YS G+S+F   +GSEMIE+TPF+H MA +I+  L  E K+ +++TTI CY +S
Sbjct: 297  TVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVIS 356

Query: 319  SIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXX 378
            S+ T             K+VGFFPRHILIGCIGGVGYFLLITG+EV TR+AK        
Sbjct: 357  SMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFL 416

Query: 379  XXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLD 438
                T+ + L +W             Q+ F NSLVLP+FYI  L+LFHFIVA++P+LSL 
Sbjct: 417  LNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLT 476

Query: 439  ILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPAL 498
             LR+SGWIFP   S   W+D Y  +NF  V W +++KQIPTM+ALTFFGILHVPINVPAL
Sbjct: 477  KLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPAL 536

Query: 499  AMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXX 558
            AMS+ +DK DVD+ELIAHGYSNF SG+ GS++NYLVYTNSVLFIR               
Sbjct: 537  AMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVL 596

Query: 559  TFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGA 618
            T  +M++GPVI+++IP+CIVGSLIFLLGYELL EAL DTWGKLN FEY TV  I+ TMG 
Sbjct: 597  TIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGI 656

Query: 619  FDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHV 678
            FDFVLGIIVGILIACF FL+DST LQTVNGEF G+VA+STV RD IQT FL+ +GEQI+V
Sbjct: 657  FDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYV 716

Query: 679  LKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNR 738
            LKLQNLLFFGTI+SIEEKIDKLLE+S+ DSSK+RIKYLILDFKNIN DNIDYSAAEGFNR
Sbjct: 717  LKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNR 776

Query: 739  IKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDL 798
            I+RFT +K I LIISSI+  D IYRAFN VG+LE VELF DLNS+LEWCENE L  + +L
Sbjct: 777  IRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNEL 836

Query: 799  RNKTKLK------------------AGKKQDRRM-------------SKVPLPFNTPRNN 827
            R K K +                  A K+ D R              + + LP NTPRN+
Sbjct: 837  RTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNH 896

Query: 828  QFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLW 886
            Q ++VAQ +F  DEQ+++ L+   + + P+LPLLL  L+++RP I S+DK  ++ E  +W
Sbjct: 897  QMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIW 956

Query: 887  SDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMXXX 946
            S LC YF KK + A + L H + IFF+++TG++K  + L QG +YETM+ +TCYG++   
Sbjct: 957  SRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDS 1016

Query: 947  XXXXXXXXCVE-------VEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDR 999
                              +  ETD  LW+ID A + +L+RE+  L+ ++ L+ + I   R
Sbjct: 1017 GTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKR 1076

Query: 1000 LKELLGHCLVSS 1011
             K+LLGH L+S+
Sbjct: 1077 FKDLLGHALISA 1088

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/913 (52%), Positives = 619/913 (67%), Gaps = 40/913 (4%)

Query: 135  NGTLIS--PVSSVPDTPIDINEPSNALLPP-----NAEHDLEYGSIDGYE------HQYV 181
            NG +++  P+  + +  ID +E S  L  P     + E+ L + S + Y+      + Y+
Sbjct: 242  NGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYI 301

Query: 182  SLQSRRSGANTHNIGPDASLREKMMFTAR--RMVNYMPAVIXXXXXXXXXXXSYGMIIFP 239
            S     S   T ++    SL  K M T    ++++ +PA I           SYGMI+FP
Sbjct: 302  S----SSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFP 357

Query: 240  ITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAG 299
            IT+ +F HLGPTG+SMFY+S+IISQL+YSGGFSAF + +G EMIEI PF+H MA ++   
Sbjct: 358  ITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNS 417

Query: 300  LPG-EKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYFLL 358
            +P  +++ +++TTI CY +S I T             K+VGFFPRHILIGCIGGVGYFL+
Sbjct: 418  IPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLI 477

Query: 359  ITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPAFY 418
            +TG+EVTTRV K            TN+  L K              Q  + +SL+LP+FY
Sbjct: 478  VTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFY 537

Query: 419  IAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIP 478
            I   + FHFIVAL+P+LSLD LR +GWIFP  +S++ W+  Y  +NF    W ++ KQIP
Sbjct: 538  IITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIP 597

Query: 479  TMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNS 538
            TM ALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSN +SG+ GSVQNYLVYTNS
Sbjct: 598  TMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNS 657

Query: 539  VLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTW 598
            VLFIR               T  I+ +GPVI+++IPVCIVGSLIFLLG+EL+ EAL DTW
Sbjct: 658  VLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW 717

Query: 599  GKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARST 658
            GK+  FEY T++ IVFTMG +DFVLGI+VGILIACFSFLVDSTKLQTVNGEF+G VA+ST
Sbjct: 718  GKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKST 777

Query: 659  VSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLIL 718
            V RDY+Q+QFL+ I EQI+VLKLQN+LFFGTI+SIEEKID LLE+SD DSSK+RIKYLIL
Sbjct: 778  VYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLIL 837

Query: 719  DFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFD 778
            D KN+N+DNIDYSAAEGFNRIKRFT SKRI LIISSIK +D+IY+ FN V +LE VELF 
Sbjct: 838  DLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFS 897

Query: 779  DLNSALEWCENEFLIQFKDLRN------------KTKLKAG-------KKQDRRMSKVPL 819
            DLN ALEWCENEFL Q++ ++N            +  ++ G          + R S   L
Sbjct: 898  DLNGALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNL 957

Query: 820  PFNTPRNNQFVSVAQKLFTD-EQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSV 878
            P NTPRN+Q VSVA+ +F + EQ +    ++  +  PVL LL+ AL+++R  I S D  V
Sbjct: 958  PINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKV 1017

Query: 879  KEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKT 938
            ++ E   WS LC YF K+ LA  + LLH +N+FF++E+G++K+ +NL QG +YETMS +T
Sbjct: 1018 RDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRT 1077

Query: 939  CYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQD 998
            CYGR+            + ++ ETDC +W+I+  GL K+K ENL LYTE+ L+ + +  D
Sbjct: 1078 CYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDD 1137

Query: 999  RLKELLGHCLVSS 1011
            R   LLG+ L+S+
Sbjct: 1138 RFNNLLGYALISA 1150

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/979 (49%), Positives = 633/979 (64%), Gaps = 67/979 (6%)

Query: 81   YRPEQS---QSIHQSVSLRRQTAALSNEFEDTFEFEDQ------------LAGVSEDDGH 125
            Y PE     +SI  +  L RQTA LS  F D+  F D+            +A  +E D +
Sbjct: 90   YPPENKTSMKSITVADILHRQTAELSKTFYDS-NFTDKDVKDYIDIIDNDVATSNESDSN 148

Query: 126  STTAEEPSMNGT-----LISPVSSVPDTPIDINEPSNALLPPN----AEHDLEYGSIDGY 176
            ST   EP +        L       P+   D  E S  L P +    AE DLE      +
Sbjct: 149  ST--PEPYLGDEYDQHRLAIRTQKSPNIADD--EQSRLLTPSSSIIGAELDLE-----AH 199

Query: 177  EHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVIXXXXXXXXXXXSYGMI 236
              ++  ++   S  N  N        E  +    ++++Y PA +           SYGMI
Sbjct: 200  YDEFEPVRMDASSINRQN--------ESKLIDFSQILHYFPAAVLGLLLNILDALSYGMI 251

Query: 237  IFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASI 296
            IFPITEP+F+++G  G+SMFY+SSII Q I SGGFS+F   +GSEMIEITPFYH MA +I
Sbjct: 252  IFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAI 311

Query: 297  VAGLPGEKDRVLSTTIVCYALSSIITXXXXXXXXXXXXXKIVGFFPRHILIGCIGGVGYF 356
               L  +++ ++STTI CY +SS++T             KIV FFPRHILIGCIGGVGYF
Sbjct: 312  KNSLDVQEE-IISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYF 370

Query: 357  LLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGXXXXXXXXXXXXQHAFGNSLVLPA 416
            L++TGLEVTTRVAK            ++  ++GKW             QH F NSLVLP+
Sbjct: 371  LVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPS 430

Query: 417  FYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQ 476
            FYI  ++LFHFIVAL+P LSL+ LRDSGWIFP T+S + WFD Y  +N   VSW +ILKQ
Sbjct: 431  FYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQ 490

Query: 477  IPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYT 536
            +PTMLALTFFGILHVPINVPALAMS+ +DK DVD+E IAHGYSNFLSG+ GSVQNYLVYT
Sbjct: 491  MPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYT 550

Query: 537  NSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYD 596
            NSVLFIR               T  +M++GPVI+++IP+CIVGSLIFLLGYELL EAL D
Sbjct: 551  NSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLD 610

Query: 597  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVAR 656
            T GK+  FEY T++ IVFTMG +DFVLGIIVGIL+AC  F+VD TKLQT+N E+DG +A+
Sbjct: 611  TVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAK 670

Query: 657  STVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYL 716
            STV RD+IQ++FL+ IGEQI+++KLQN+LFFGTI+SIEEKID LL+LSD DSSK RI+YL
Sbjct: 671  STVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYL 730

Query: 717  ILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVEL 776
            ILDFKNIN DNIDYSAAEGFNRIKRFT  + I LIISSI  +D+IY+AFNK+G+L+ +EL
Sbjct: 731  ILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIEL 790

Query: 777  FDDLNSALEWCENEFLIQFKDLRNKTKLKAGKK----QDRRMSK---------------- 816
            F DLN+ LEWCEN++L ++++L  K K +   +    QD+ +S                 
Sbjct: 791  FSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSS 850

Query: 817  ---VPLPFNTPRNNQFVSVAQKLFTDE-QSMTHLKSSYRERPPVLPLLLSALQRFRPQIM 872
               + LP NTPRN+Q +SVA+ +F +E Q+++  K+          LLL +++RFRP + 
Sbjct: 851  QRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVF 910

Query: 873  SSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYE 932
            S  K ++  E + W+ L  YF K  +  +S  L+++N FF++++G++KVT++L  G+L E
Sbjct: 911  SESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSE 970

Query: 933  TMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVT 992
            TM  +T YG +            V    ET   +W+ID  GL K+++ENL LY+E+ L+ 
Sbjct: 971  TMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLI 1030

Query: 993  LCINQDRLKELLGHCLVSS 1011
            + I+  R K LLG+ LV++
Sbjct: 1031 MSISDYRFKALLGYTLVNA 1049

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1040 (47%), Positives = 638/1040 (61%), Gaps = 56/1040 (5%)

Query: 1    MVSNRP----KNKPSISEAISVSLGLXXXXXXXXXXXYIPRANPFSHTGDG--SPHYYLG 54
            M  NR      ++PSISEA+++ L +                 P S        P  YLG
Sbjct: 1    MTKNRRFSAWSHRPSISEALNIQLNIPDSPSGGANA-----GGPVSERIPTLMRPEAYLG 55

Query: 55   RSYVANXXXXXXXXXXXXXXXXXXX----SYRPEQSQSIHQSVSLRRQTAALSN------ 104
            RSYV +                        +R + S  +H    L RQTAAL +      
Sbjct: 56   RSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYD 115

Query: 105  ---EFEDTFEFEDQL---AGVSEDDG---HSTTAEEPSMNGTLISPVSSVPDTPIDINEP 155
               E E+   FE  +    G     G   ++    + +++  L++   +V D+  D    
Sbjct: 116  GGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAG 175

Query: 156  SNALLPP-NAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVN 214
            +   L P   ++   YG+I+  E Q  S  + R+       GP       +     R V 
Sbjct: 176  TRLFLSPITTDYIHSYGAIN--EEQSASETASRA-----ETGPS-----PLRLWGTRTVR 223

Query: 215  YMPAVIXXXXXXXXXXXSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAF 274
            Y+PAVI           SYGMIIFPI EP+FSHLGP G+SMFYVS+IISQL+YSGGFS+F
Sbjct: 224  YIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSF 283

Query: 275  GNAVGSEMIEITPFYHAMAASIVAGLPGEK-DRVLSTTIVCYALSSIITXXXXXXXXXXX 333
            G   GSEMIE+TPF+H MA SI   L  EK D +++TTIVCYALS+IIT           
Sbjct: 284  GYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLR 343

Query: 334  XXKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKXXXXXXXXXXXXTNIEVLGKWGX 393
              K+V FFP HILIGCIGGV YFL+ITG+EV+TRV K             + ++L KW  
Sbjct: 344  LGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLI 403

Query: 394  XXXXXXXXXXXQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDST 453
                       Q    NS++LP FY++A  LFHFIVALIPSLSLD LRD GWIFP T+S 
Sbjct: 404  PALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESG 463

Query: 454  EHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKEL 513
              W+D+  LYN + + W ++L +IPTMLALTFFGILHVPINVPALA+S G+DK+DVDKEL
Sbjct: 464  GRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKEL 523

Query: 514  IAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVIVAYI 573
            IAHGYSN  SG  GS+QNYLVYTNSVLFIR               TF  M  GP I++ I
Sbjct: 524  IAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISII 583

Query: 574  PVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIAC 633
            PVCIV SLIFLLGYELLKE LYD++ +L+NFEY TVV I+ TMG FDFVLGIIVG+L+AC
Sbjct: 584  PVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVAC 643

Query: 634  FSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSI 693
            FSFLV+ST+ +T++ EFDG+VA+S   RDY+Q+ FL K+ EQI+VLKLQN LFFGTI+SI
Sbjct: 644  FSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISI 703

Query: 694  EEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIIS 753
            EEKI  LLE  +    KK IKYLILDFK+IN DNIDYSAAEGFNRIKR    KRI LI+S
Sbjct: 704  EEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVS 762

Query: 754  SIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKT-KLKAGKKQDR 812
            SI   D+IY  F+K+G+L+ VELF DLNSALEWCENE L +++ L ++  ++K  ++   
Sbjct: 763  SISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKD 822

Query: 813  RMSKVPLPF-NTPRNNQFVSVAQKLFTDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQI 871
             + K  +P  NTPRN Q ++ AQ +++ EQ +    S Y+   P L LLL AL+ +R   
Sbjct: 823  IVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYR--- 879

Query: 872  MSSDKSVKEGEE-RLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQL 930
              S  + KE +E RLW  LC YF +K  +  + +  + ++FFV+E+G++K+TY L QG L
Sbjct: 880  --SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSL 937

Query: 931  YETMSGKTCYGRMXXXXXXXXXXXCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLL 990
             E ++ KTCYG +              V  ET+C LW+ID  GL KL+ ENL LYTE+L+
Sbjct: 938  QEAIASKTCYGNISGPGSLSYSSV---VRTETECVLWMIDAPGLQKLQEENLPLYTELLV 994

Query: 991  VTLCINQDRLKELLGHCLVS 1010
            V + + Q R KELLGH L++
Sbjct: 995  VYISVIQHRFKELLGHSLIN 1014

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 119/286 (41%), Gaps = 23/286 (8%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G+ N +  + G++ ++  Y  S +                  T   M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 629
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 630 LIACFSFLVDSTKLQTVNG-EFDGQVARS---TVSRDYIQTQFLNKIG--------EQIH 677
            I C   +++  K    +  +   +VA +   T   DY++T   N +G        E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLRTMKKNPLGGENRLEEVEGCM 576

Query: 678 VLKLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLILDFKNINADNID 729
           ++++   L F     +++++D++                SK  IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 730 YSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
            SAA+  + I      + + + ++++  +D+I     K G++  +E
Sbjct: 635 SSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/284 (19%), Positives = 114/284 (40%), Gaps = 20/284 (7%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G+ N +  + G++ ++  Y  S +                  T   M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 626
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 627 VGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIG-------EQIHVL 679
           +G + +  + +  S K +          +  T   DY+     N +        E   ++
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGCMIV 577

Query: 680 KLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLILDFKNINADNIDYS 731
           ++   L F     +++++D++                SK  IKY+I D   + +  +D S
Sbjct: 578 RIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDSS 635

Query: 732 AAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
           AA+  + I      + + + ++++  +D+I    +K G++  VE
Sbjct: 636 AAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/292 (20%), Positives = 123/292 (42%), Gaps = 37/292 (12%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G  N  + ++G++  +  Y  S +                    G++++  V 
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKI-----NSFSGAQTVMSGVCMGVIVLLTVK 439

Query: 570 -----VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAI---VFTMGAFDF 621
                + YIPVCI+  +  ++G  LL+EA  D     N+  Y  ++     V T   +  
Sbjct: 440 FFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSL 499

Query: 622 VLGIIVGILIACFSFLVDSTK--LQTV-----NGEF---DGQVARSTVSRDYIQTQFLNK 671
            +G+ +G   +  S +  S K  +Q +      G+F   D  ++ +T   D    + L  
Sbjct: 500 EMGVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEEL-- 557

Query: 672 IGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSD------KDSSKKR--IKYLILDFKNI 723
             E   V+K+   L F  +  ++E++ +L              S++R  IKYL+ D   +
Sbjct: 558 --EGCLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGM 615

Query: 724 NADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
               +D SAA+    I +  + +R+ + ++ +   +++        +L  VE
Sbjct: 616 TF--MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/285 (20%), Positives = 111/285 (38%), Gaps = 21/285 (7%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G  N    + G++ ++  Y  S +                  T   M +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 626
           V YIP C++  +  ++G  LL+E   D    L    Y+ +     T G    +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 627 VGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIG--------EQIHV 678
           +G + +  + +  S K +          +  T   DY++T   N           E   +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEGCMI 577

Query: 679 LKLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLILDFKNINADNIDY 730
           +++   L F     +++++D++                SK  IKY+I D   + +  ID 
Sbjct: 578 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDS 635

Query: 731 SAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
           SAA+  + I      + + + ++++  +D+I     K G+   VE
Sbjct: 636 SAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVE 680

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/284 (20%), Positives = 110/284 (38%), Gaps = 20/284 (7%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G+ N +  + G++  +  Y  S +                  T   M +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKL--NNFEYATVVAIVFTMGAF-DFVLGII 626
           V YIP C++  +  ++G  LL+E   D    L    F    V A+ F    F     GI 
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGIC 527

Query: 627 VGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIG-------EQIHVL 679
           +G + +  + +  S K +          +  T   DY+     N +        E   ++
Sbjct: 528 IGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIV 587

Query: 680 KLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLILDFKNINADNIDYS 731
           ++   L F     +++++D++                SK  IKY+I D   + +  ID S
Sbjct: 588 RIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSS 645

Query: 732 AAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
           AA+    I      + + + + ++  +D++ R   K G+   VE
Sbjct: 646 AAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 125/301 (41%), Gaps = 37/301 (12%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G  N +  + G++ ++  Y  S +                  T   +      
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 629
           + YIPVC++  +  ++G  LL+EA  D    +    Y  +++ + T+    F   +  GI
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLT-TFFYSVEAGI 518

Query: 630 LIACFSFLVDSTKLQT----------------VNG-EFDGQVARSTVSRDYIQTQFLNKI 672
            + C   ++   K  T                VN  E++G   +++ S   +  Q L +I
Sbjct: 519 TVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEG---KNSTSERRVNPQ-LEEI 574

Query: 673 GEQIHVLKLQNLLFFGTILSIEEKIDKLLEL---------SDKDSSKKRIKYLILDFKNI 723
            E   ++++   L F     ++ ++++ LEL         + +   ++  KY+I D   +
Sbjct: 575 -EGCLIVRIPEPLTFTNTDDLKTRLNR-LELYGSTKTHPAAPRSRDQEMTKYVIFDLHGM 632

Query: 724 NADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSA 783
               ID SA +    I      + +H+ +  + ++ ++   F   G+LE VE   D++ +
Sbjct: 633 T--TIDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRS 688

Query: 784 L 784
           L
Sbjct: 689 L 689

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 107/242 (44%), Gaps = 22/242 (9%)

Query: 560 FGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAF 619
           F I  + P+I  YIPVCI+  +  ++G  LL+EA +D         Y+ +     T+ A 
Sbjct: 428 FTIQFLLPII-RYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLAT 486

Query: 620 DFVLGIIVGILIACFSFLVDSTKLQTVNG-EFDGQV--ARSTVSRDYIQTQ----FLNKI 672
            F   +  GI I C   +++  K    +  +  G+V    + ++ D  Q      F+N  
Sbjct: 487 LF-YSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQ 545

Query: 673 GEQIH---VLKLQNLLFFGTILSIEEKIDKLLE--------LSDKDSSKKRIKYLILDFK 721
            E+I    ++K+   L F     ++ ++ +L +         + +   K+  + +I D K
Sbjct: 546 IEEIEGFLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMK 605

Query: 722 NINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLN 781
            +   +ID SAA+    I    + + +H+ ++++  ++++       G+ E  E     N
Sbjct: 606 GMT--HIDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKVRERLVTSGVAELCERNTITN 663

Query: 782 SA 783
           S+
Sbjct: 664 SS 665

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 119/292 (40%), Gaps = 35/292 (11%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPV- 568
           ++EL+A G  N  S I+GS+  +  Y  S +                    G++++  + 
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKI-----NAFSGAQTVMSGAFMGLLVLLTIK 447

Query: 569 ----IVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVL- 623
               ++ YIP+C++  +  ++G  LL+EA  D       F Y  +  +VFT+     +  
Sbjct: 448 FLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDEL--LVFTLTVLTTMFY 505

Query: 624 GIIVGILIAC----FSFLVDSTK-----LQTVNGE---FDGQVARSTVSRDYIQTQFLNK 671
            + VGI I C     S +  S K     L  V G     +        +R++       +
Sbjct: 506 SVEVGICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELE 565

Query: 672 IGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDK--------DSSKKRIKYLILDFKNI 723
             E   ++K+   L F     ++E++++L +              S+   +Y+I+D   +
Sbjct: 566 ELEGCLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGM 625

Query: 724 NADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
              ++D SAA+    I      + + + ++ +    R+     K G+++ VE
Sbjct: 626 T--HMDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 55/271 (20%), Positives = 98/271 (36%), Gaps = 49/271 (18%)

Query: 505 DKLDVD----KELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTF 560
           +K D+D    +EL++ G  N +S +  ++  +  Y  S L I                  
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 561 GIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEA---LYDTWGKLNNFEYATVVAIVFTMG 617
             M        Y+P+C++  +I  + Y LL+E    L+  W      E  T VA+V T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 618 AFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQ-- 675
            +    G+ +G+ +     L  +T           Q     + RD +  +F N   EQ  
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTT-----------QSRVQILGRDPVTKKFQNIYAEQSE 509

Query: 676 ---------IHVLKLQNLLFFGTILSIEEKIDKL------------------LELSDKDS 708
                      V+K+   L F  +  +++++ +L                  +  S    
Sbjct: 510 QIPLEEIEKTMVIKIPEPLIFSNVSDLKKRLSRLEKYGSLKVHPSYPTPLRPVSASAGSQ 569

Query: 709 SKKRIKYLILDFKNINADNIDYSAAEGFNRI 739
           S+  I Y+I D   +    ID SA +    +
Sbjct: 570 SESYISYVIFDL--LGMTYIDMSALQALTEM 598

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 90/222 (40%), Gaps = 25/222 (11%)

Query: 572 YIPVCIVGSLIFLLGYELLKEALYDT---WGKLNNFEYATVVAIVFTMGAFDFVLGIIVG 628
           ++P+CI+  +I  + + LL+EA  D    W      E    + IV T   +    G+ +G
Sbjct: 334 HLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVTMG 393

Query: 629 ILIACFSFLVDSTKLQT-VNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFF 687
           + +     L  ST+ +  + G          +  D      L +I E++ V+K+   L F
Sbjct: 394 MCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPLIF 452

Query: 688 GTILSIEEKIDKLLE-----------------LSDKDSSKKRIKYLILDFKNINADNIDY 730
             +  +   + ++ +                 LS   S +  +KYL++D   +    ID 
Sbjct: 453 SNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YIDI 510

Query: 731 SAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLE 772
           SA +    I    S + I ++ +  K  D  ++ F K G+ E
Sbjct: 511 SALQALREIVDAYSRRNICVMFTRPKIPDLRHK-FRKSGISE 551

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 56/292 (19%), Positives = 120/292 (41%), Gaps = 44/292 (15%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXT-FGIMIVGPV 568
           ++EL+A G  N +  + G++ ++  Y  S +                  T F I  + PV
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 569 IVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGII-- 626
           I  Y P+CI+  +  ++G  LL+EA  D    +    Y  +  I+FT+    FV  II  
Sbjct: 444 I-HYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNEL--IIFTL---IFVTTIIHS 497

Query: 627 --VGILIAC------------------FSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQT 666
              GI + C                   + ++ + +   V+G + G       + D  ++
Sbjct: 498 VEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG-----LKTIDLRES 552

Query: 667 QFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLIL 718
             L ++ +   ++K+   L F     ++E++++L                +++ IKY+I 
Sbjct: 553 SALEELDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIF 612

Query: 719 DFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGM 770
           +   + +  +D SAA+    I +    + +++    + ++ +I    +  G+
Sbjct: 613 ELGGMTS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDAGI 662

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 113/307 (36%), Gaps = 43/307 (14%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXT-FGIMIVGPV 568
           ++EL+A G SN +   +G++ ++  Y  S +                  T   I+ + PV
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 569 IVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFT------------- 615
           I  YIPVCI+  +  ++G+ LL+E   +         Y  +  IV T             
Sbjct: 473 I-HYIPVCILSVITTVIGFTLLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSM 531

Query: 616 -MGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGE--------FDGQVARSTVSRDYIQT 666
            +G    +L II     +      D+  + +++                +ST S DY   
Sbjct: 532 YIGCVYSILNIIKHSAKSRIQIYTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPE 591

Query: 667 QFLNK---------IGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRI---- 713
              N            EQ  ++K+   L F     ++EK+++   L    +   +I    
Sbjct: 592 SRRNSADECFRCSLTNEQTLIVKIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDT 651

Query: 714 ----KYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVG 769
               KY+I D + +    +D SA E    I         H+   ++   + I       G
Sbjct: 652 LFQPKYIIFDLQGMTL--MDSSATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASG 709

Query: 770 MLEGVEL 776
           +++ +EL
Sbjct: 710 IIDLIEL 716

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 64/322 (19%), Positives = 126/322 (39%), Gaps = 40/322 (12%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G  N +  I G++ ++  Y  S +                  T    +     
Sbjct: 373 NRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNA 432

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGI 629
           + +IPVC++  +  ++G  L +EA  D         Y  ++    T+    F   +  GI
Sbjct: 433 IHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTVLT-TFFYSVEAGI 491

Query: 630 LIAC----FSFLVDSTK-----LQTVNG--------EFDGQVARSTV---SRDYIQTQFL 669
            + C       + +STK     L+ V+G        +F+       V     D I+   +
Sbjct: 492 TLGCGYSVIRVIKNSTKSKIQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDIEGSLI 551

Query: 670 NKIGEQIHVLKLQNLLFFGTILSIEEKID--KLLELSDKDSSKKRIKYLILDFKNINADN 727
            KI E++  +  ++L    T L   EK    K    S K  ++ + K++I D   +    
Sbjct: 552 VKIPERLTFMNTEDL---KTRLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--E 606

Query: 728 IDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSAL--- 784
           ID SA++    I      + + + ++ +     +       G++E VE  D   +A+   
Sbjct: 607 IDSSASQILQEIVLSLRKRGVRVYLARVPLIAGVRERLVASGVVEMVEKCDASVTAVDSA 666

Query: 785 --EWCENEFLIQFKDLRNKTKL 804
             +WC       FK++++  ++
Sbjct: 667 FDDWC-------FKNIQDALRV 681

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 53/134 (39%), Gaps = 3/134 (2%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXT-FGIMIVGPV 568
           ++EL+A G  N +    G +  +  Y  S +                  T F I  + PV
Sbjct: 375 NRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPV 434

Query: 569 IVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVG 628
           I  YIP C++  +   +G  LL+EA +D    +    Y  ++  V T     F   I  G
Sbjct: 435 I-HYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFG 492

Query: 629 ILIACFSFLVDSTK 642
           IL  C   L+   K
Sbjct: 493 ILAGCTYSLISIVK 506

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 57/281 (20%), Positives = 112/281 (39%), Gaps = 22/281 (7%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++EL+A G  N ++ + G++ ++  Y  S +                  T   +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGA---FDFVLGII 626
           + YIP+CI+  +  ++G  LL+EA  +         Y  +     T+ A   +   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 627 VGILIACFSFLVDSTK-----LQTVNGEFDGQVARSTVSRDYIQTQFLNK-IGEQIH--- 677
           +G   +  S +  S K     L  V G  +       +  D I     NK + E+I    
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 678 VLKLQNLLFFGTILSIEEKIDKLLELSDKDS--------SKKRIKYLILDFKNINADNID 729
           ++K+   L F     ++E++++L       +        SK   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 730 YSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGM 770
            SA + F  I      +++ + ++ +  S +I     K G+
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 56/285 (19%), Positives = 111/285 (38%), Gaps = 22/285 (7%)

Query: 510 DKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRXXXXXXXXXXXXXXXTFGIMIVGPVI 569
           ++ELIA G+ N +  + G++ ++  Y  S + +                T     +   +
Sbjct: 377 NRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPM 436

Query: 570 VAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAF---DFVLGII 626
           + Y P C++  +  ++G  LL+E   D    ++   Y+ +     T  A       LG+ 
Sbjct: 437 IHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVT 496

Query: 627 VG-----ILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQI---HV 678
           VG     ILI   S L     L  + G  D  V      ++Y    F N   EQ    ++
Sbjct: 497 VGCIYSLILIVKHSALSRIQILAKLEGS-DEFVNVDDYIKNYNGRDFENITLEQFEHCYI 555

Query: 679 LKLQNLLFFGTILSIEEKIDKLLELSDKD--------SSKKRIKYLILDFKNINADNIDY 730
           +K+   L F     +  ++ +L      +         S+  ++Y+I D + + +  +D 
Sbjct: 556 VKIPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDS 613

Query: 731 SAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVE 775
            +A+    I R    + + + ++ +     I       G+L+ VE
Sbjct: 614 GSAQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>YMR004W Chr13 (274017..275552) [1536 bp, 511 aa] {ON}  MVP1Protein
           required for sorting proteins to the vacuole;
           overproduction of Mvp1p suppresses several dominant VPS1
           mutations; Mvp1p and Vps1p act in concert to promote
           membrane traffic to the vacuole; participates in
           transcription initiation and/or early elongation of
           specific genes; interacts with "foot domain" of RNA
           polymerase II; deletion results in abnormal CTD-Ser5
           phosphorylation of RNA polymerase II at specific
           promoter regions
          Length = 511

 Score = 32.0 bits (71), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 120 SEDDGH--STTAEEPSMNGTLISPVSSVPDTPIDINEPSNALLPPN 163
           ++DD H  STT  EPS+NG      +    TP+D NE     LP N
Sbjct: 18  TKDDDHVVSTTNSEPSLNGISGEFNTLNFSTPLDTNEEDTGFLPTN 63

>Kpol_309.9 s309 (18180..19916) [1737 bp, 578 aa] {ON}
           (18180..19916) [1737 nt, 579 aa]
          Length = 578

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 799 RNKTKLKAGKKQDRRMSKVPLPFNTPR---NNQFVSVAQKLFTDE-----QSMTHLKSSY 850
           RN+   K  KKQ+++ S + +P   P+   N Q  +V +K + +E     ++ T +  SY
Sbjct: 476 RNEPSSKINKKQEKQFSDLKMPEKKPQQKSNQQVENVWKKAWNNEIHNLKEAFTFIYRSY 535

Query: 851 RERP-PVLPLLLSALQRFRPQIMSSDKSVKEGEERL 885
            + P  +  L LS + R   + +     ++E ++ +
Sbjct: 536 LDLPRNIFKLTLSTVARLWNRFIGVKDYLRESDKDI 571

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,986,745
Number of extensions: 3838620
Number of successful extensions: 11532
Number of sequences better than 10.0: 52
Number of HSP's gapped: 11736
Number of HSP's successfully gapped: 55
Length of query: 1011
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 891
Effective length of database: 39,721,479
Effective search space: 35391837789
Effective search space used: 35391837789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)