Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.21194na 1ON1541547381e-101
KLTH0F14652gna 1ON1431611222e-08
KLTH0B01892g5.153ON41579635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21194
         (154 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21194 s55 complement(725370..725834) [465 bp, 154 aa] {O...   288   e-101
KLTH0F14652g Chr6 complement(1200124..1200555) [432 bp, 143 aa] ...    52   2e-08
KLTH0B01892g Chr2 (148776..150023) [1248 bp, 415 aa] {ON} simila...    29   5.7  

>Kwal_55.21194 s55 complement(725370..725834) [465 bp, 154 aa] {ON}
           [contig 295] FULL
          Length = 154

 Score =  288 bits (738), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/154 (94%), Positives = 146/154 (94%)

Query: 1   MISYVGYLTRKTVRKIRDYVDGTLDIVKEPARLVGFRRQMANNEDGQTSSKRAVLTRRGT 60
           MISYVGYLTRKTVRKIRDYVDGTLDIVKEPARLVGFRRQMANNEDGQTSSKRAVLTRRGT
Sbjct: 1   MISYVGYLTRKTVRKIRDYVDGTLDIVKEPARLVGFRRQMANNEDGQTSSKRAVLTRRGT 60

Query: 61  EVQDTRKARNSYVTHRATDCDSMSSPLDSDGXXXXXXXXDASYRVTYVARDSRPRRLRNV 120
           EVQDTRKARNSYVTHRATDCDSMSSPLDSDG        DASYRVTYVARDSRPRRLRNV
Sbjct: 61  EVQDTRKARNSYVTHRATDCDSMSSPLDSDGENENENEEDASYRVTYVARDSRPRRLRNV 120

Query: 121 RFSVAPDDESTASYREVDPADPFVLNIRIASRSS 154
           RFSVAPDDESTASYREVDPADPFVLNIRIASRSS
Sbjct: 121 RFSVAPDDESTASYREVDPADPFVLNIRIASRSS 154

>KLTH0F14652g Chr6 complement(1200124..1200555) [432 bp, 143 aa]
           {ON} no similarity
          Length = 143

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 71/161 (44%), Gaps = 36/161 (22%)

Query: 3   SYVGYLTRKTVRKIRDYVDGTLDIVKEPARLVGFRRQ--MANNEDGQTSSKRAVLTRRGT 60
           +Y+ +L R  V K R  +DG   +V++  + +G  RQ     +  G  +S+R V+TRRG 
Sbjct: 7   TYMAFLARDAVGKARHCMDGAFRVVRDSGKCIGLGRQEQAVPHHVGIVNSRRTVVTRRGD 66

Query: 61  EVQDTRKARNSYVTHRATDCDSMSSPLDSDGXXXXXXXXDASYRVTYVARDSRPRRLRNV 120
            +Q   ++ ++Y            SP  S G         A+ R  +   +  PR   +V
Sbjct: 67  SLQ---RSHSTY------------SPRSSPG---------AAVRPNFGDSEGGPRAAAHV 102

Query: 121 RFSVAPDDESTASYRE----------VDPADPFVLNIRIAS 151
           RF  +    ++               VDPADPFVL +R+ +
Sbjct: 103 RFPSSISVSASTPASAAAASIPCNAMVDPADPFVLTVRVTT 143

>KLTH0B01892g Chr2 (148776..150023) [1248 bp, 415 aa] {ON} similar
           to uniprot|P16451 Saccharomyces cerevisiae YGR193C PDX1
           Dihydrolipoamide dehydrogenase (E3)-binding protein
           (E3BP) of the mitochondrial pyruvate dehydrogenase (PDH)
           complex plays a structural role in the complex by
           binding and positioning E3 to the dihydrolipoamide
           acetyltransferase (E2) core
          Length = 415

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 1   MISYVGYLTRKTVRKIRDYVD--GTLDI----VKEPARLVGFRRQMANNEDGQTSSKRAV 54
           ++SY+G +++++V K+ +Y++    LD+    +KEP      + ++A  E    S +  +
Sbjct: 219 VLSYLGKVSQESVTKLAEYIEKGSALDLTNIELKEPEPAPKAKEEVAKKEPVVLSEQLHL 278

Query: 55  LTRRGTEVQDTRKARNSYV 73
               G   +   ++  SYV
Sbjct: 279 KVASGVTYEQLARSLESYV 297

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,023,778
Number of extensions: 479322
Number of successful extensions: 1204
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1203
Number of HSP's successfully gapped: 10
Length of query: 154
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 54
Effective length of database: 42,014,799
Effective search space: 2268799146
Effective search space used: 2268799146
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)