Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.211873.483ON57357330120.0
KLTH0F14630g3.483ON57357328290.0
SAKL0F02970g3.483ON57357126710.0
KLLA0B10868g3.483ON57457326210.0
Kpol_480.193.483ON57457126040.0
TDEL0D055203.483ON57357125810.0
TPHA0D042003.483ON57457125810.0
YPR145W (ASN1)3.483ON57257125810.0
KNAG0A079203.483ON57857525770.0
Suva_16.4743.483ON57257125770.0
CAGL0I10648g3.483ON57457325660.0
Smik_16.3963.483ON57257125650.0
NDAI0B058103.483ON57757625620.0
Skud_16.4393.483ON57257125470.0
Suva_7.4103.483ON57257225430.0
NCAS0F035103.483ON57557225400.0
Smik_6.2203.483ON57257125400.0
KAFR0G036703.483ON57257125390.0
Skud_7.4353.483ON57257225340.0
YGR124W (ASN2)3.483ON57257225290.0
AFR303W3.483ON57157224790.0
Ecym_12443.483ON57357324730.0
ZYRO0B04136g3.483ON57257124640.0
TBLA0C044303.483ON58057824580.0
TBLA0C063008.875ON5185081697e-12
KNAG0J002008.875ON5155051536e-10
NCAS0C001908.875ON5174301528e-10
SAKL0D00352g8.875ON5154541412e-08
ZYRO0A00528g8.875ON5121031402e-08
KLLA0D10285g8.875ON5154781393e-08
Kpol_455.78.875ON5181051287e-07
TPHA0C049508.875ON525991288e-07
Skud_13.468.875ON5191131242e-06
NDAI0K001808.875ON5222121153e-05
KAFR0L021108.875ON514951143e-05
ADL350C8.875ON508941134e-05
YML096W8.875ON525951135e-05
Smik_13.398.875ON521961117e-05
Suva_13.528.875ON519861118e-05
TDEL0B004408.875ON516941101e-04
Ecym_81558.875ON5131121082e-04
Kwal_27.97058.875ON515791020.001
CAGL0H06963g8.875ON51793950.006
KLTH0E16412g8.875ON51595950.006
Skud_7.311singletonON8189810.026
Kpol_1071.97.58ON95773780.81
KNAG0B026607.339ON825143715.0
SAKL0A08910g2.512ON60390707.1
KAFR0B06530singletonON53885707.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21187
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...  1164   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...  1094   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1033   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1014   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1007   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   998   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   998   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   998   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   997   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   997   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   993   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   992   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   991   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   985   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   984   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   983   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   983   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   982   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   980   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   978   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   959   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   957   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   953   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   951   0.0  
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    70   7e-12
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    64   6e-10
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    63   8e-10
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    59   2e-08
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   2e-08
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    58   3e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    54   7e-07
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    54   8e-07
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    52   2e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   3e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    49   3e-05
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    48   4e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   5e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   7e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    47   8e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    47   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    46   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    44   0.001
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    41   0.006
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    41   0.006
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    36   0.026
Kpol_1071.9 s1071 complement(17560..20433) [2874 bp, 957 aa] {ON...    35   0.81 
KNAG0B02660 Chr2 (514239..516716) [2478 bp, 825 aa] {ON} Anc_7.3...    32   5.0  
SAKL0A08910g Chr1 (780195..782006) [1812 bp, 603 aa] {ON} highly...    32   7.1  
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}             32   7.1  

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/573 (97%), Positives = 561/573 (97%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/573 (90%), Positives = 544/573 (94%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIFTCFRH+ V++FKPDAL+L KRIRHRGPDWSGN+I+NSTL+AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P VSE+ +YIL VNGE+YNHIQLREEFS YPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AWALYD KKDR++AARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRY+ P+W+DE+RIPSEPLDLLKIR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEKAN++M+PV+YDSEDKHLAGVDD+G L SAGWS LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMNLDPKEKMIN AEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QHI K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK 573

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/571 (84%), Positives = 517/571 (90%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF C++HE V +FKP ALQL+KRIRHRGPDWSGNV++N+T+LAHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ SE+ DY L VNGEIYNHI+LREE + YPFKTLSDCEPIIPLY+KY ID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD KKDR+IAARDPIGITTLYMGR S SP TV+FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYYTP+WLDE RIP  PLD   IRNSLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKAN +++PV YD EDKHLAGVDD G LH+AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FLD+CMN+DP EKMINQ+EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDEQF QPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/573 (83%), Positives = 518/573 (90%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FR+ DV  +KP ALQL+KRIRHRGPDWSGN+++NST+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ SE+  Y LAVNGEIYNHI LREE + YPFKTLSDCEPIIPLYEKY IDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+KKDR+IAARDPIGITTLYMGR S SPK+V+F+SELKCLTD+CD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD++TRY+TP+WLDE+RIP+ P+D   +R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEK N E++PV YDS+   LAG+D+ G LH+AGWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL LCMN+DP +KMI  AEG+IEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE+TISDEQF QPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QH+ K
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 511/571 (89%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  ++HE+ + FKP ALQL+KRIRHRGPDWSGNV++NST+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   DY+L VNGEIYNHIQLRE   DY +KTLSDCEPIIPLY K+ IDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD KKDR+IAARDPIGITTLYMGR+SKSPKTV+FASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDQITRY++P+W+DE RIP+EP+    IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEKA  EM+   YDSEDKHL G+DD G LH+AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMIN +EGRIEKYILRKAFDTSDEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISDE F  PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/571 (81%), Positives = 515/571 (90%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF   +HEDV  +K  ALQL+KRIRHRGPDWSGNV+RN+TLL HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y L VNGEIYNHI+LREEFSDY F TLSDCEPIIPLYEKY ID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR+IAARDP+GITTLYMGR+S SPKTV+FASELKCLTD+CD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEKAN E++  +YDSEDKHLAG+DDSG LHSAGWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DPK+KMIN+ EGR+EKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISD+ F  PK+ WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRW+PKADWGCAEDPSGR+A+IHDQH+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/571 (82%), Positives = 513/571 (89%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIFT ++HE+ + FKP ALQL+KRIRHRGPDWSGNV++NST++AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S++ D+IL VNGEIYNHIQ+RE+F DY FKTLSDCEPIIPLY KYG +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR+IAARDPIGITTLYMGR SKSPKTVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRYYTP+W+DENRI ++PLDL+KIR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETEKA    +     S    L G+DD+G L S+GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLDLCMN+DP EKMINQ EGRIEKYILRKAFDT+DEP  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISDE F+ P+  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/571 (81%), Positives = 511/571 (89%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FRHEDV ++KP ALQL+KRIRHRGPDWSGN I+NST+  HERLAIVG+++GAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLREE +DY F TLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D + IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET KA  ++ P  YDS+ +HLAG+DD GKLH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/575 (82%), Positives = 514/575 (89%), Gaps = 4/575 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FRHEDV  FKP ALQL+KRIRHRGPDWSGN+I+NST++AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   DYIL+VNGEIYNHIQLREE  +Y +K+LSDCEPIIP+Y KY +DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD KKDR++AARDPIGITTLYMGR S  PKTV+FASELKCLTD+CD+IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYYTPNWLDE +IPS P+DL +IR++LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYD----SEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPN 296
             IAAIAARETEKAN E++P +YD    +E  HLAG+DD G L SA WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476
           LEARVPFLD+EFLDLCMN+DPK+K+INQ EGRIEKYILRKAFDT DEP  KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAE  ISDE F  PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIH+QH+
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/571 (81%), Positives = 509/571 (89%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HEDV ++KP ALQL+KRIRHRGPDWSGN ++NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  DY FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR+IAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARET KA  ++ P  YD++ +HLAGVDD G LH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAEA ISDE F  PKAEWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/573 (81%), Positives = 511/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  ++H+DV  FKP ALQL+KRIRHRGPDWSGNV++NST++ HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ SE+ DY L VNGEIYNHIQLRE+F DY FKTLSDCEPIIP Y ++ IDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR++AARDP+GITTLYMGR S SPKTV+FASELKCLTD+CD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRY+TP+W+DE+RIP+ P++   IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYD-SEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPD 299
             IA+IAARETEKAN E +  + D S  K LAG+D+ G LH+AGWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L+AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479
           RVPFLD+EFL LCMN+DPK+KMI+Q+ GRIEKYILRKAFDTSDEP  KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAE  ISD  F  PK EWG+DIPTTKEAYWYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           AASTVMRWIPKADWGCAEDPSGRYAKIH+QH++
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVT 573

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/571 (81%), Positives = 509/571 (89%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HEDV  +KP ALQL+KRIRHRGPDWSGN I+NST+  HERLAIVGL++GAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  +Y FKTLSDCEPIIP+Y K+ IDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET  A  +++P  YDS+ +HLAGVDD GKLH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD+EFL LCMN+DP EKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDTAE  ISDE F  PKAEWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/576 (81%), Positives = 512/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HEDV  FKP ALQL+KRIRHRGPDWSGNVI+N+T+LAHERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y L VNGEIYNHIQ+RE+F DYPFKTLSDCEPIIPLY K+ ID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+K+DR+IAARDPIGITTLYMGR+SK+P+TV+FASELKCLTD+CDSIIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRY+TP+WLDE RIP   LDL  IR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDK----HLAGVDDSGKLHSAGWSRLHSFAVGLPN 296
             IA+IAARETEKAN +      ++ D+    HL GVDD G LH+ GWS+LHSFA+GLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL+AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476
           LEARVPFLDR+FL LCMN+DPKEKMINQAEGRIEKYILRKAFDTSD+P AKPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKDTAE  ISD  F+ PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIH++H++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 506/571 (88%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  ++HEDV ++K  ALQL+KRIRHRGPDWSGN  +NST+  HERLAIVGL++GAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  DY FKTLSDCEPIIP+Y K+ I+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D + IR+SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARET  A  ++ P  YDS+ +HLAGVDD G LH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DPKEKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/572 (80%), Positives = 507/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HED++ FKP ALQL+KRIRHRGPDWSGN I NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + DY+L VNGEIYNHIQLRE+ SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD+KKDR+IAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TP+WLDE R+P+ P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETE AN E N  E  +E   LAG+DD G LH++GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANE-EASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FL LCMN+DPK+KMIN  EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+DTAE  ISD  F  PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           A TVMRW+PKADWGCAEDPSGRYA+IH++H++
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/572 (80%), Positives = 511/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FRHEDV  +KP ALQL KRIRHRGPDWSGNV++N+T+LAHERL+IVGLD+GAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y L VNGEIYNHIQ+REE +DY FKTLSDCEPIIPLY KY +DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR SK+P+TVYFASELKCLTD+CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDQITRY+ P+WLDE+RIPS P+DL  IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSED-KHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPD 299
             IA+IAARETEKA  +++  + + E  KHL GVDD G LH+ GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L+AARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQK 479
           RVPFLD+EFL LCMN+DPK+KMI+QA G+IEKYILRKAFDT+D+P  KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKDTAE  ISD  F+ PK  WG+D+PTTKEAYWYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           AA TVMRWIPKADWGCAEDPSGRYAKIH++H+
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 510/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+H+D+  FKP ALQL+KRIRHRGPDWSGN + NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLREE SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ +YD KKDR++AARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKAN ++N  E   ++K LAG+DD G LH++GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADVNE-ESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FL LCMN+DPK+KMI   EG+IEKYILRKAFDT++EP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A+TVMRW+PKADWGCAEDPSGRYAKIH++H+
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 505/571 (88%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FRHEDV  FK  ALQL+KRIRHRGPDWSGNV++NST++ HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y L VNGEIYNHIQLRE+F DY FKTLSDCEPIIPLY +  IDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+KKDR++AARDPIG+TTLYMGR S SPKTV+FASELKCL D+CDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TPNW+DEN+IP+ P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE AN E++  +Y  E  HLAG+DD G L ++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFLDLCMN+DP +K+INQ EGRIEKYILRKAFDT D+P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDTAE  ISDE F  PK+ WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/572 (80%), Positives = 508/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HED++ FKP ALQL+KRIRHRGPDWSGN + NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLRE+ S Y F+T SDCEPIIPLY ++ IDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD KKDR++AARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TPNWLDE RIPS P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKAN + +  +    +K LAG+DD G LH++GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADG-DASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL LCMN+DPK+KMIN  EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAE  ISD  F  PKA+WG+DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           A TVMRW+PKADWGCAEDPSGRYAKIH++H+S
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHVS 571

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/572 (80%), Positives = 508/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  F+HED+  FKP ALQL+K+IRHRGPDWSGN + NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLRE  SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD+KKDR++AARDPIG+ TLYMGR S+SP+TVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TP+WLDE RIPS P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKAN + N  + + ++K LAG+DD G LH++GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANE-DNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLD++FL LCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+DTAE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           A TVMRWIPKADWGCAEDPSGRYAKIH++H+S
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHVS 571

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/572 (78%), Positives = 498/572 (87%), Gaps = 2/572 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF C+R +D++ FKP AL+L+KR+RHRGPDWSGNVI+N T+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHI LREE SDY F +LSDCEPIIPLY KY ++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD ++DR++AARDPIG+TTLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRY+ P+W+DE RIPS+P+D   +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE+AN E   V  D   KHLAG+DD G LH+ GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DP EKMI   +GRIEKYILRKAFDTSDEPG  PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDEQF  P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572
           A+TVMRW+PKADWGCAEDPSGRYAKIHDQHIS
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHIS 570

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/573 (76%), Positives = 507/573 (88%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF C+R + ++ FKP ALQL+KRIRHRGPDWSGNV++N T+  HERLAIVGLDTGAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+VS++ +Y+L VNGEIYNHI LR+  +DYPF TLSDCEPIIPL++KYG++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD K DR++AARDPIG+TTLYMG+ SKSP+T YFASELKCL + CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDQITRY+ P+WL ++  P++P+D  K+R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IAAIAARETEKAN EM+ V+YDS+ ++L GVDD   LH++GWS+LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS+HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMN+DP+EKMI   EG+IEKYILRKAFDTSDEP  +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISDEQF QPK EWGDDIP+TKEAYWYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK 573
           ASTVMRW+PKA+WGC+EDPSGR+AKIH++HISK
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK 573

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/571 (78%), Positives = 497/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  FRH DV +++P ALQL+KRIRHRGPDWSGNV++NST+L HERLAIVGL++G+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y L VNGEIYNHIQLREE SDYPF++LSDCEPIIPLY KYG+DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           AW LYD+K+DR++AARDPIGITTLYMG+ SKSPKT +FASELKCL D+CD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRY+ P WLDE+ +PS PLD   +R+SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
             IA+IAARETE+AN E++PV YDSE+KHLAG+D  G LH+ GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480
           VPFLDR+FL+LCM LDP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE    P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           A+TVMRWIPKADWGC  DPSGR+AKIH+QHI
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/578 (77%), Positives = 499/578 (86%), Gaps = 7/578 (1%)

Query: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60
           MCGIF  ++H +V+ FKP ALQL KRIRHRGPDWSGNV++N+TL AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120
           P+ S   +Y+L VNGEIYNHIQLREE +DY +KTL DCEPIIP+Y KY +DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180
           A+ LYD++KDR+IAARDP+GITTLYMGR+SK+PKTVYFASELKCL D+CDSIIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+I RY+ PNW+DE+ IP+ P+DL ++R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANTEMNPVEYDSED-------KHLAGVDDSGKLHSAGWSRLHSFAVG 293
             IA+IAARETEK   E N ++Y+ +        K L G+DDSG L +  WS+LHSFA+G
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGS+HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEE 473
           AWGLEARVPFLDR+FL+LCMN+DP +KMI   EG+IEKY+LRKAFDTSDEP  KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKDTAE  ISDE F  PK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571
           LFPQKTAA TVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 122/508 (24%), Positives = 198/508 (38%), Gaps = 83/508 (16%)

Query: 1   MCGIFTCFRHEDVDKF-----------KPDAL----------QLAKRIRHRGPDWSGNVI 39
           MCGI       D  KF            PDAL           L K I  RGP+++   +
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFAS--L 58

Query: 40  RNSTLLAHERLAIVGLDTGAQPMVSE----EKDYILAVNGEIYNHIQLREEFSDYPFKTL 95
           R  TL  H       + +  +P   +    E  Y+L  NGE+YN  ++    + +  K L
Sbjct: 59  R--TLKDHRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYND-EIIHNDTQFIVKLL 115

Query: 96  SDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTL-YMGRDSKSPK 154
            + E       K  I   K LDG FA+++YD K  R+   RDPIG  +L Y   D+    
Sbjct: 116 LNTEQ----NSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSLCYYLTDANELY 171

Query: 155 TVYFASELKCLTDNCDSIIAFPPGHVYDSET--------DQITRYYTPNWLDENRIPSEP 206
               +  +K    NCD+ + +     YD+          + I   +T N   +    S  
Sbjct: 172 VSSVSGSIKGFK-NCDAGVIYE----YDATNKNSPLTIFNNIFEDFTINDKSDLEFKSLQ 226

Query: 207 LDLLKIRNSLEKAVRKRLMAEVP-----------YXXXXXXXXXXXXIAAIAARETEKAN 255
             + ++   L  AVRKR+++  P           +            I  +   E +KA 
Sbjct: 227 KHIEELYKVLYNAVRKRVLSIHPTHIENSPIAVLFSGGLDCSVIVALICEVIRNEKKKAI 286

Query: 256 TEMNPVEYDSEDKHLAGVDD-SGKLHSAGWSRLHSFAVGLP------NAPDLEAARKVAK 308
            E+  V +++    L   D    KL  +    L      +P      + P  E   K   
Sbjct: 287 IELLNVGFENPRTGLMPKDTPDRKLAISSSYILQKLYPNVPIKLIEVDVPYDEYLEKRPI 346

Query: 309 FIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGE 368
            I  ++ + T      +D    + ++  +     I+  +   +  R+   +G+ ++ SG 
Sbjct: 347 VIDLMYPKET-----EMDLSIAIAFYFASRGKGYIQTGSDKRIEYRR---KGI-VLFSGL 397

Query: 369 GSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDREF 428
           G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R PFLD   
Sbjct: 398 GADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYPFLDEHV 456

Query: 429 LDLCMNLDPKEKMINQAEGRIEKYILRK 456
           +    +  P    IN    +I K ILRK
Sbjct: 457 IKYSTHDIP----INY---KINKLILRK 477

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 124/505 (24%), Positives = 192/505 (38%), Gaps = 97/505 (19%)

Query: 1   MCGIFTC------FRHEDVDKFK------PDALQLAKR--------IRHRGPD---WSGN 37
           MCGI  C      F  E V+  +      P  L    R        I  RGP+   W G+
Sbjct: 1   MCGILLCRDPGRQFNDEHVEFAEAQPIEIPGGLDAQARWIASTLPCIAARGPNFASWRGS 60

Query: 38  VIRNSTLLAHERLAIVGLDTGAQPMVSE----EKDYILAVNGEIYNHIQLREEFSD--YP 91
              ++   +    +++ L    QP   +    +  Y+L  NGE+YN      EF+D  Y 
Sbjct: 61  AEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYND---EIEFNDTQYI 110

Query: 92  FKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTL-YMGRDS 150
              L+  E  IP       D    LDG FA+ +YDT+  +    RD IG  +L Y    S
Sbjct: 111 ADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAIGKRSLSYYVNTS 163

Query: 151 KSPKTVYFASELKCLTD----NCDSIIAFPPGHVYDS------ETDQITRYYTPNWLDEN 200
           K    +Y +S    + D    +C + I +    +YD+      +++ I+  YT + L + 
Sbjct: 164 KD--QLYVSSVTGRVEDIEFRDCIAGIIY----IYDAKNQHLDDSNHISDPYTVSPLVDE 217

Query: 201 RIPSEPLDLLKIRNSLEKAVRKRL-------MAEVPYXXXXXXXXXXXXIAAI------- 246
                   + K+   L  AV KR+       +   P             I A+       
Sbjct: 218 NFTERGEHIEKLHFQLNLAVEKRINSIHPNHIENSPISVLFSGGLDCSVIVALICNQLSG 277

Query: 247 -AARETEKANTEM-NP----VEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300
            A +  E  N    NP    V  DS D+ LA        H      +    + +P    L
Sbjct: 278 KARKTVELLNVGFENPRTGLVPSDSPDRKLAIESYKTLQHLYPDIDIRLIEIDVPYEEYL 337

Query: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            A  KV   +        F  Q  +D    + ++  +    +I   +       KI  Q 
Sbjct: 338 RAKPKVIDLM--------FPKQTEMDLSIAIAFYFASKGEGSITDKST----KGKIAYQR 385

Query: 361 VKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 419
             +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   + G+E 
Sbjct: 386 KGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIASNGVEI 444

Query: 420 RVPFLDREFLDLCMNLDPKEKMINQ 444
           R PFLD   +       P    IN+
Sbjct: 445 RYPFLDSSVVKFSTEDLPINYKINK 469

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 99/430 (23%), Positives = 173/430 (40%), Gaps = 80/430 (18%)

Query: 66  EKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALY 125
           E+ Y+L  NGE+YNH ++    + Y    L +  P IP          K L+G FA+++Y
Sbjct: 87  EERYVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPA-------IIKKLNGEFAYSIY 138

Query: 126 DTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDSET 185
           D +       RD +G  +L    D  + +  Y AS    +T +  + I    G +Y   T
Sbjct: 139 DIQNGTFYFGRDTVGKRSLSYFLDENTGE-FYLAS----VTGSQPNFIDCTAGIIYQYST 193

Query: 186 DQ--------ITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMA-------EVPY 230
                     I+  Y      + ++   P  +  +   L KAV +R+++         P 
Sbjct: 194 RSKKLNSDLSISSPYEIATTMDQQLTKLPNCIDGLFEHLNKAVHRRIVSIHPAHIENSPI 253

Query: 231 XXXXXXXXXXXXIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSF 290
                       IAA+  ++      E  P+                +L + G+    + 
Sbjct: 254 SILFSGGLDCSVIAALICKQLSNIKKEKKPIL---------------ELLNVGFENPRTG 298

Query: 291 AVGLP-NAPDLEAARKVAKFIGSVHHEHTFTL-------QEGLD---ALDDVIYHLETYD 339
              LP + PD + A   ++ + +++ + T  L       +E L+    + D+++  +T  
Sbjct: 299 M--LPKDVPDRKLALSSSEILKNLYPDVTIKLVNIDVSYEEYLEYRPKVIDLMFPKQTEM 356

Query: 340 VTTIRASTPMFLLSRK-----IKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSA 386
             +I  S   F  + K     I   G+K        ++ SG G+DE++GGY  FA   S 
Sbjct: 357 DLSIAIS---FFFAAKGSGYTISKDGIKEKYQRKGIVLFSGLGADELYGGYHKFANK-SP 412

Query: 387 AEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDREFLDLCMNLDPKEKMINQAE 446
            +   E  +++ N++  +  R +K     G+E R PFLD E +       P    IN   
Sbjct: 413 DDLAIELTRQINNIYDRNLNRDDKVIANNGVEVRYPFLDEEVIKFSTMEIP----INY-- 466

Query: 447 GRIEKYILRK 456
            ++ K ILRK
Sbjct: 467 -KVNKMILRK 475

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 108/454 (23%), Positives = 179/454 (39%), Gaps = 76/454 (16%)

Query: 22  QLAKRIRHRGPDWSGNVIRNSTLLAHERLA-IVGL-DTGAQPMVSEEKDYILAVNGEIYN 79
           +L   I +RGP+++   IRNS+       + I+ L D   +  V     ++L  NGE+YN
Sbjct: 44  RLIPYIINRGPNYAS--IRNSSKYGISWFSSILSLRDPLTRQSVKINDRFVLQYNGELYN 101

Query: 80  HIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKY---LDGMFAWALYDTKKDRMIAAR 136
                 + +D  F        I  L E+Y  D PK    ++G FA+ ++D + +++   R
Sbjct: 102 S---SIQHNDTLF--------IASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGR 150

Query: 137 DPIGITTLYMGRDSKSPKTVYFASELKCLT---DNCDSIIAFPPGHVYDSETDQI----- 188
           D IG  +L    DS++ K   F S +   +   ++C+    +    +YDS+T  +     
Sbjct: 151 DTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNLEDDLR 204

Query: 189 ---TRYYTPNWLDENRIP-SEPLDLLKIRNSLEKAVRKRLMA-------EVPYXXXXXXX 237
                Y     +DE     SE ++LL   N L +AV +R+ +         P        
Sbjct: 205 IRDVPYTVSCSIDEEMCQISENIELL--FNELSEAVCRRVESIHPLHRENSPISILFSGG 262

Query: 238 XXXXXIAAIAARET----------------EKANTEMNPVEYDSEDKHLAGVDDSGKLHS 281
                IAA+   +                 E   T+M P +  + D+ LA    +     
Sbjct: 263 LDCSVIAALICEQIIKSGSDTVIELLNVGFENPRTKMEPEQ--APDRILAKNSATTLRKL 320

Query: 282 AGWSRLHSFAVGLPNAPDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVT 341
               ++    V +P    LE   KV   I     E   ++           Y     D  
Sbjct: 321 YPTVKIILIEVDVPYKEYLEQRGKVVDLIYPKQTEMDLSIAVAF-------YFASKGDGF 373

Query: 342 TIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLH 401
           ++  +       RK    GV +  SG G+DE++GGY   A   SA E       ++ N+H
Sbjct: 374 SVAENGTREPYHRK----GVVL-FSGLGADELYGGYHKLANK-SAEELANALTLQINNIH 427

Query: 402 LADCLRANKSTMAWGLEARVPFLDREFLDLCMNL 435
             +  R +K   + G+E R PFLD + +     L
Sbjct: 428 DRNLNRDDKVIASNGVEVRYPFLDEKVVQFSTEL 461

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P    IN    +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP----INW---KINKLILRK 471

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 23/132 (17%)

Query: 69  YILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGI---DAPKYLDGMFAWALY 125
           YIL  NGE+YN     EE  D      +D   +  L E   +   +   +L+G FA+ +Y
Sbjct: 88  YILQFNGELYN-----EEILD------NDTSFVASLLENDKMSVFEVISFLEGEFAYTIY 136

Query: 126 DTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFAS---ELKCLTDNCDSIIAFPPGHVYD 182
           D  + ++   RD IG  +L    D ++   +Y AS   + +  TD    I+     ++YD
Sbjct: 137 DMHEHKLYFGRDDIGKRSLSYRLD-QAIGDIYVASVTGQQEGFTDCLAGIV-----YIYD 190

Query: 183 SETDQITRYYTP 194
            E   + +   P
Sbjct: 191 VEDKSLNQQMLP 202

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 112/478 (23%), Positives = 200/478 (41%), Gaps = 66/478 (13%)

Query: 22  QLAKRIRHRGPDWSG--NVIRNSTLLAHERLAIVGLDTGAQPMVSEEKDYILAVNGEIYN 79
           +L   I  RGP+++   ++   + +L    L++    T    MV +   Y+L  NGE+YN
Sbjct: 43  ELIPYIVRRGPNYASLRSLSEINAMLFSSVLSLRTPFTKQSVMVQDR--YLLQYNGELYN 100

Query: 80  HIQLREEFSDYPFKTLSDCEPIIPLYEKYGID-APKYLDGMFAWALYDTKKDRMIAARDP 138
              +  E  ++     SD E I  L EK+ ++   +   G FA+A+ D ++ ++   RD 
Sbjct: 101 DDTV--ENCEH-----SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDS 153

Query: 139 IGITTL-YMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPG--HVYDSETDQITRYYTPN 195
           IG  +L Y+  D +    +Y  S    ++  CD       G  +++D  T Q+T   +  
Sbjct: 154 IGKRSLSYILLDDE----LYITS----VSGRCDGFQNCLAGVIYIFDINTKQLTG--SVK 203

Query: 196 WLDENRIPSEPLD---------LLKIRNSLEKAVRKRLMAEVPYXXXXXXXXXXXXIAAI 246
             DE  I S+ +D          +K+   L ++V +R++   P                 
Sbjct: 204 IHDEPYIVSDQIDNDFQLLEEYKIKLYECLRRSVYQRIVTIHPMHLENGNISILFSGGLD 263

Query: 247 AARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDLEAARKV 306
            +  T     ++  +  +SE           +L + G+    +  +   ++PD   A K 
Sbjct: 264 CSVITALLCEQLIKINRNSETII--------ELLNVGFENPRTGKMP-SDSPDRILAIKS 314

Query: 307 AKFIGSVHHEHTFTLQEGLDALDDVIYHLET-----YDVTT---IRASTPMFLLSR---K 355
           A+ +  ++ +    L E      D + H +T     Y   T   +  +   +  SR   K
Sbjct: 315 AQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMDLSIAIAFYFASRGRGK 374

Query: 356 IKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLR 407
           +   G          ++ SG G+DE++GGY  F+   S  E   E  K++  +H  +  R
Sbjct: 375 VTENGESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNR 433

Query: 408 ANKSTMAWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRI-EKYILRKAFDTSDEP 464
            +K     G+E R PFLD   +   ++L P    +N+   R+  K ILR  F  S+EP
Sbjct: 434 DDKVISNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGR---IEKYILRKAFDTSDEP 464
           FLD E +   ++  P    +N+   R   +EK  LR   D + EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 31/182 (17%)

Query: 60  QPMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEP-IIPLYEKYGIDAPKYLDG 118
           Q +V +E+ Y+L  NGE+YN  ++    + Y    L  C+  ++ L  K        LDG
Sbjct: 84  QSIVVDER-YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDVVSLVRK--------LDG 133

Query: 119 MFAWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELK----CLTDNCDSIIA 174
            FA+ +YD K+  +   RD IG  +L    D  S +   F S +        D    +I 
Sbjct: 134 GFAYTIYDLKEGNIYFGRDTIGKRSLCYSIDENSGEL--FISSVTGTRGTFVDCLGGVI- 190

Query: 175 FPPGHVYDSETDQI-------TRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAE 227
               + YD++T  +        +Y   +  DE    S+ ++LL    +L ++V+KR+++ 
Sbjct: 191 ----YTYDTKTHTLDDTKVIRDKYVVTDMTDELENESQYMELL--YGTLYESVKKRVLSI 244

Query: 228 VP 229
            P
Sbjct: 245 HP 246

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILR 455
           +E R PFLD    +  +N   KE  IN    +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 20/170 (11%)

Query: 69  YILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTK 128
           YIL  NGE+YN+       + Y    L        L EK  I+  + L+G FA+ ++D+K
Sbjct: 89  YILQFNGELYNNEIHGISDTTYFVNCLKTA-----LDEKDIINILRTLEGEFAYTIFDSK 143

Query: 129 KDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLT--DNCDSIIAFPPGHVYDSETD 186
           K  +   RD IG  +L    D ++ + +Y +S    +    NC   I +    +Y+ E  
Sbjct: 144 KKLVYFGRDTIGKRSLGYKLDYETNE-LYISSATGDVEGFKNCVGGIVY----IYNIEKK 198

Query: 187 QITR-------YYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVP 229
           Q+         Y     +DE    +  L + K+ +SL ++V KR+++  P
Sbjct: 199 QLDEENMIREPYTVSAEVDEGESRANEL-IAKLYDSLYESVEKRVLSIHP 247

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 12/113 (10%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKA---FDTSDEPGAKP 468
            R PFLD    +  +NL   E  IN    ++ K ILRK    F   DE   +P
Sbjct: 448 VRYPFLD----EYVINLSTLEIPINY---KVNKLILRKVASLFLKLDEIAEEP 493

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 16/124 (12%)

Query: 27  IRHRGPDWSG-NVIRNSTLLAHERLAIVGLDTGAQPMVSEEKD----YILAVNGEIYNHI 81
           I  RGP++S   VI+     AH+      + +  +P   +  +    Y L  NGE+YN  
Sbjct: 47  IAARGPNYSSLRVIK-----AHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN-- 99

Query: 82  QLREEFSDYPFKTLSDCEPIIPLYE-KYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIG 140
              +E SD+   +L     +  L + +  +D  + L+G +A+ +YD K       RDPIG
Sbjct: 100 ---KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIG 156

Query: 141 ITTL 144
             +L
Sbjct: 157 KRSL 160

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 92/212 (43%), Gaps = 23/212 (10%)

Query: 27  IRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQPMVSEEKD-YILAVNGEIYN-HIQLR 84
           I  RGP++S   +     +     +++ L         E KD Y++  NGE+YN  IQ  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFS-SVLSLREPFTKQCVEIKDRYVVQFNGELYNDEIQYN 107

Query: 85  EEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTL 144
           +  + Y  + L + + II        D  + LDG FA+ +YD +       RDPIG   L
Sbjct: 108 D--TQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIGRRCL 157

Query: 145 YMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQITR-------YYTPNWL 197
               D+++ + +Y +S   C T   D I      + YD +  ++         +Y    L
Sbjct: 158 SFSIDNETGE-LYISSVTGCKTGFQDCIAG--TIYKYDCQLKELNTDSKISKPFYVSEEL 214

Query: 198 DENRIPSEPLDLLKIRNSLEKAVRKRLMAEVP 229
           D+  +     ++ K+   L  +V KR+++  P
Sbjct: 215 DDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRK 456
           FLD +     +    +E  IN    +I K ILRK
Sbjct: 455 FLDID----VIKFSTEELPINY---KINKLILRK 481

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKA 457
           FLD       +    +E  IN    ++ K ILRK 
Sbjct: 447 FLDHN----VVQFSTQEIPINY---KVNKLILRKV 474

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 98/214 (45%), Gaps = 26/214 (12%)

Query: 27  IRHRGPDWSGNVIRNSTLLA-HERLAIVGLDTGAQPMVSEEKDYILAVNGEIYNHIQLRE 85
           I +RGP++S   +      A    +  + L    Q +  E++ Y+L  NGE+YN  ++++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLALRLPFTKQSLCVEDR-YVLQFNGELYNK-EIKQ 103

Query: 86  EFSDYPF--KTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITT 143
           + +D  F    LS    +I    +        LDG FA+ +YD ++ ++   RD IG  +
Sbjct: 104 DQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIGKRS 155

Query: 144 LYMGRDSKSPKTVYFASELKCLT--DNC--DSIIAFPPGHVYDSETDQIT--RYYTPNWL 197
           L    D+ +   +Y AS    +   +NC    I  F       SE  +I   +Y   + +
Sbjct: 156 LCFKMDTTN--GLYVASCTGNIEGFENCLGGVIYIFDLNERTISEHSKIIQRQYEVVDLI 213

Query: 198 DENRIPSEPLDLL--KIRNSLEKAVRKRLMAEVP 229
           DEN    E LD +  K+   L ++V KR+ +  P
Sbjct: 214 DENM---ETLDSMKEKLYTVLNESVSKRVTSIHP 244

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRK 456
           FLD + +   + L    K         +K ILRK
Sbjct: 441 FLDEKVIKASVALPISYKN--------DKMILRK 466

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKA 457
           FLD    +  + L   E  IN    ++ K ILRK 
Sbjct: 452 FLD----EYVIKLSTAEIPIN---FKVNKLILRKV 479

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 69  YILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYG-IDAPKYLDGMFAWALYDT 127
           Y L  NGE+YN     +E S     +L     +  L E  G ID  K L+G +A+ +YD 
Sbjct: 89  YFLQFNGELYN-----KEISQGDNDSLYIASMLQNLKEGMGVIDVIKSLEGEYAYTIYDV 143

Query: 128 KKDRMIAARDPIGITTL 144
              ++   RDPIG  +L
Sbjct: 144 NSSKLYFGRDPIGRRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKA 457
           PFLD    +  +     E  IN    ++ K ILRK 
Sbjct: 451 PFLD----EYVIKFSTVEIPINY---KVNKLILRKV 479

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQPMVSEEKD----YILAVNGEIYN-HI 81
           I  RGP++S   +R  T+ A+       + +  +P   +  +    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSS--LR--TVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  QLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGI 141
                 S Y    L D E      +   ID  K L+G +A+ +YD K  +    RDPIG 
Sbjct: 103 SHWGNDSLYIASLLKDLED-----DGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLDLCMNLDPKEKMINQ 444
            R PFLD   +       P    IN+
Sbjct: 448 VRYPFLDEHVIKFSAVDIPINFKINK 473

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQPM----VSEEKDYILAVNGEIYNHIQ 82
           I  RGP++S   +R S   A++      + +  QP     +S +  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSS--LRVSK--AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREEFSDYPFKTLSDCEPIIPLYEKYG-----IDAPKYLDGMFAWALYDTKKDRMIAARD 137
             +E SD      +D + I  L +        ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 --KEISD----DDNDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTL 144
           PIG  +L
Sbjct: 154 PIGRRSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRK 456
           FLD + +        +E  IN    ++ K ILR+
Sbjct: 449 FLDHDVI----KFSTEEIPINY---KVNKMILRR 475

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 109/263 (41%), Gaps = 51/263 (19%)

Query: 1   MCGIFT----------CFRHEDVDKFKPDALQLAKR----------IRHRGPDWSGNVIR 40
           MCGI            CF  E V+       Q +K           I+ RGPD+S   +R
Sbjct: 1   MCGILLHYAPLKSDNHCFVDEYVEDIADGHSQRSKTTAFFDSMVPYIKSRGPDYSS--LR 58

Query: 41  NSTLLAHERLAIVGLDTGAQPMVSEE----KDYILAVNGEIYNHIQLREEFSDYPFKTLS 96
            S+   H       + +  +P  S+       +IL  NGE+YN     +E + +     +
Sbjct: 59  VSS--EHSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYN-----QEITAHD----N 107

Query: 97  DCEPIIP-LYEKYG--IDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTLYMGRDSKSP 153
           D + I+  L E Y       + L G FA+ LYD ++ +    RD +G  +L     + + 
Sbjct: 108 DTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKRSLSYHLSAITG 167

Query: 154 KTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQI-------TRYYTPNWLDENRIPSEP 206
           + +Y +S    +    D I      +VYD+E+  +       ++Y+    LDE  +    
Sbjct: 168 E-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFITKKLDE-ELTCLD 223

Query: 207 LDLLKIRNSLEKAVRKRLMAEVP 229
             + ++   L  AVRKR+++  P
Sbjct: 224 STVEQLYGMLSLAVRKRVLSIHP 246

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEP 464
              G+E R PFLD E ++L  +L P     N+   R+      +  D  +EP
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL-PINYKTNKNILRLLATNKLQLMDIGEEP 485

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 12/85 (14%)

Query: 69  YILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAP-KYLDGMFAWALYDT 127
           YIL  NGE+YN     ++ S       +D + I  L EK  +D   + L G FA+++Y+T
Sbjct: 91  YILQYNGELYN-----DDISH------NDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KKDRMIAARDPIGITTLYMGRDSKS 152
           K   +   RD +G  +L   +D+++
Sbjct: 140 KTKCIYFGRDSVGKRSLSYHQDNET 164

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFLDLCMNL 435
           +E R PFLD   ++    L
Sbjct: 442 VEVRYPFLDDRVIEFSTQL 460

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLDLCMNLDP----KEKMI 442
           + G+E R PFL  E ++      P    ++KMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 71/163 (43%), Gaps = 26/163 (15%)

Query: 1   MCGIFTCF------RHEDVDKFKPDAL----------QLAKRIRHRGPDW-SGNVIRNST 43
           MCGI  C+       ++ + +F  D +           + K +R RGP++ S   I++  
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 44  LLAHERLAIVGLDTGAQPMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKT--LSDCEPI 101
            +    +  +      Q +V   K Y+L  NGE+YN  ++ E  +D  F +  L  C   
Sbjct: 61  SIWISSVLSLRQPFTKQSIVIGNK-YVLQFNGELYND-EIIESGNDTQFLSGLLKKC--- 115

Query: 102 IPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTL 144
             + E    +    LDG FA+ + D + + +   RD IG  +L
Sbjct: 116 --ISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKA 457
           FLD + +     L    K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 66  EKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALY 125
           E  ++L  NGEIYN   +    + Y  + L + + I  +         + L G FA+ +Y
Sbjct: 88  EDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RTLSGEFAYTIY 138

Query: 126 DTKKDRMIAARDPIGITTLYMGRDSKSPK 154
           D     +   RDPIG  +L    D+   K
Sbjct: 139 DKLTGEVFFGRDPIGRRSLSFKLDTGDSK 167

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 35.8 bits (81), Expect = 0.026,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 14/89 (15%)

Query: 102 IPLYEKYGIDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASE 161
           +P Y +  IDAPK+L+ MFA++    +K              ++ G      +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDNCDSIIAFPPGHVYDSE 184
             L C    LT  CD+  +F PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kpol_1071.9 s1071 complement(17560..20433) [2874 bp, 957 aa] {ON}
           complement(17560..20433) [2874 nt, 958 aa]
          Length = 957

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 61  PMVSEEKDYILAVNGEIYNHIQ--LREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKY--- 115
           P V EE   I     + +N+I+  L EE + +  KTL   E    L+EKY  DA K    
Sbjct: 358 PQVIEENKSIFPEVSKDFNYIKEILDEEEASFA-KTLDRGEK---LFEKYASDASKLDSK 413

Query: 116 -LDGMFAWALYDT 127
            LDG+  W LYDT
Sbjct: 414 TLDGLQVWRLYDT 426

>KNAG0B02660 Chr2 (514239..516716) [2478 bp, 825 aa] {ON} Anc_7.339
           YLR207W
          Length = 825

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 55/143 (38%), Gaps = 18/143 (12%)

Query: 82  QLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMFAWALYDTKKD--RMIAARDPI 139
           Q+R ++SD  +        I P  E + I  P + DG+    L  TK    R+ +AR  I
Sbjct: 214 QIRHKYSDEQWNV------IFPYTESFNIRLPDFDDGLLGPQLSSTKLSTIRIKSARPDI 267

Query: 140 GITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHVYDSETDQITRYYTPNWLDE 199
             + L   R            ++    +N D   +F  G   +   DQI   +   W + 
Sbjct: 268 TSSVLTKMR----------GGDIMLRFNNVDESSSFALGSDLEDNDDQIVDLFYIAWDEY 317

Query: 200 NRIPSEPLDLLKIRNSLEKAVRK 222
               +   D LK R  LE +V +
Sbjct: 318 KGTYTRARDCLKARKLLEFSVEE 340

>SAKL0A08910g Chr1 (780195..782006) [1812 bp, 603 aa] {ON} highly
           similar to uniprot|P29468 Saccharomyces cerevisiae
           YKR002W PAP1 Poly(A) polymerase one of three factors
           required for mRNA 3'-end polyadenylation forms
           multiprotein complex with polyadenylation factor I (PF
           I) also required for mRNA nuclear export may also
           polyadenylate rRNAs
          Length = 603

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 8/90 (8%)

Query: 65  EEKDYILAVNGEIYNHIQLREEFSD-----YPFKTLSDCEPIIPLYEKYGIDAPKYLDGM 119
           E K  +L    E  N I L   F+      Y + T  +C+ I+   + YG    + +   
Sbjct: 383 ESKLRLLVQKLEALNGINLAHPFTKPFETTYAYSTEDECKEIV---DNYGTYKTEGVLKN 439

Query: 120 FAWALYDTKKDRMIAARDPIGITTLYMGRD 149
           +A    D K D  +  +  + ITT+Y+G D
Sbjct: 440 YAEVTSDNKDDESLKDKKKVHITTMYIGLD 469

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 110 IDAPKYLDGMFAWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNC 169
           +D  KY   ++   L +T KDR         +T   +G  S S KT    ++L  + D+ 
Sbjct: 267 VDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSG 326

Query: 170 DSIIAFPPGHVYDSETDQITRYYTP 194
            S+    PG +  S    +   Y+P
Sbjct: 327 TSLTVL-PGTIIHSIASSLNGRYSP 350

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,624,427
Number of extensions: 2663325
Number of successful extensions: 6264
Number of sequences better than 10.0: 53
Number of HSP's gapped: 6324
Number of HSP's successfully gapped: 71
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)