Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.208437.127ON44144122500.0
KLTH0F12584g7.127ON44144121790.0
SAKL0F05346g7.127ON44744519450.0
ADL017C7.127ON44344218750.0
Ecym_83507.127ON44544418510.0
KLLA0D14311g7.127ON44344218120.0
TDEL0H028907.127ON44244018100.0
YPL259C (APM1)7.127ON47547317870.0
TBLA0A009507.127ON46946617780.0
ZYRO0C05236g7.127ON44744417750.0
Suva_16.457.127ON47847617710.0
KNAG0L009507.127ON46145917650.0
Smik_6.4667.127ON47647417630.0
Skud_16.197.127ON47647417490.0
NCAS0E021407.127ON48144817480.0
TPHA0C043207.127ON45445117440.0
Kpol_1062.567.127ON45045017370.0
NDAI0E036807.127ON44444217300.0
KAFR0L004707.127ON46546716860.0
CAGL0K00539g7.127ON45645616600.0
Ecym_52393.165ON4644725719e-68
KLTH0F06534g3.165ON4664735441e-63
KLLA0C03894g3.165ON4754855241e-60
Kwal_33.141823.165ON4674725222e-60
SAKL0C07414g3.165ON4824875153e-59
NCAS0C035803.165ON4914945101e-58
CAGL0C05203g3.165ON4754855092e-58
TDEL0D045803.165ON4824934971e-56
ZYRO0B04840g3.165ON4764894831e-54
SAKL0D13090g2.555ON4995134813e-54
YOL062C (APM4)3.165ON4915004804e-54
Suva_15.1033.165ON4915004795e-54
Kpol_1045.443.165ON4694634777e-54
Smik_15.963.165ON4915004788e-54
ABR047W2.555ON4984674595e-51
NDAI0G029203.165ON4864844577e-51
ADR315W3.165ON4923824577e-51
KLTH0D07502g2.555ON5045284588e-51
Skud_15.913.165ON4915004542e-50
Kwal_26.81462.555ON5055334501e-49
TBLA0F008403.165ON4814394429e-49
KLLA0F25432g2.555ON5075294333e-47
TPHA0P006603.165ON4734394289e-47
Ecym_45912.555ON5015274122e-44
TDEL0B064302.555ON5255464036e-43
KNAG0K011503.165ON4744803823e-40
KAFR0C010203.165ON4284623434e-35
CAGL0K03223g2.555ON5983683423e-34
KAFR0A020602.555ON5403333272e-32
ZYRO0E05874g2.555ON5493353273e-32
TPHA0I023902.555ON5593383212e-31
NCAS0A126502.555ON5883533133e-30
Kpol_1056.132.555ON5413403052e-29
Skud_8.262.555ON5963572973e-28
Smik_8.232.555ON6033572903e-27
Suva_8.332.555ON5963622832e-26
KNAG0C055502.555ON5823532743e-25
YHL019C (APM2)2.555ON6053612682e-24
TBLA0B067602.555ON6572172231e-18
NDAI0B016102.555ON6722421892e-14
SAKL0A09218g2.522ON4732641757e-13
AGL061W2.522ON4112231596e-11
KLTH0D06556g2.522ON4561971509e-10
TDEL0A029702.522ON4961421491e-09
TPHA0C041302.522ON5331391472e-09
KAFR0D035602.522ON4553901462e-09
KLLA0E18789g2.522ON4971481383e-08
Kwal_26.79572.522ON4561941383e-08
ZYRO0B01738g2.522ON4922351365e-08
TBLA0I006202.522ON6091461196e-06
Kpol_1018.422.522ON5751401133e-05
NCAS0A048702.522ON4894761044e-04
Suva_4.5482.522ON484155990.001
CAGL0L02145g2.522ON543143990.001
Skud_2.4192.522ON484155920.010
Ecym_72662.522ON517126890.024
YBR288C (APM3)2.522ON483262880.027
TBLA0E001403.575ON543135850.074
KLTH0G00528g3.575ON633134850.086
Smik_2.4302.522ON484125840.096
ZYRO0E09746g3.575ON538135830.11
NDAI0K019302.522ON612149820.20
KNAG0A069702.522ON505138810.23
Kwal_47.192923.575ON538134790.36
AFR274C3.575ON532153780.44
NCAS0F040103.575ON547135741.3
KAFR0L019708.853ON93299741.8
KLTH0H11770g1.388ON156133701.9
CAGL0M10131g2.495ON54293732.1
Kwal_0.348singletonOFF13285682.8
TPHA0G037003.575ON539135704.3
TDEL0D064303.575ON536135704.7
CAGL0A04741g3.575ON536135695.5
NDAI0G052101.388ON15661667.2
Smik_10.1261.247ON712176687.3
Kpol_507.73.575ON533134688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20843
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   871   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   843   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   753   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   726   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   717   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   702   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   701   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   692   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   689   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   688   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   686   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   684   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   683   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   678   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   677   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   676   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   673   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   671   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   654   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   644   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   224   9e-68
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   214   1e-63
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   206   1e-60
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   205   2e-60
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   202   3e-59
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   201   1e-58
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   200   2e-58
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   196   1e-56
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   190   1e-54
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   189   3e-54
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   189   4e-54
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   189   5e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   188   7e-54
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   188   8e-54
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   181   5e-51
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   180   7e-51
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   180   7e-51
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   181   8e-51
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   179   2e-50
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   177   1e-49
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   174   9e-49
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   171   3e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   169   9e-47
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   163   2e-44
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   159   6e-43
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   151   3e-40
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   136   4e-35
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   136   3e-34
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   130   2e-32
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   130   3e-32
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   128   2e-31
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   125   3e-30
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   122   2e-29
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   119   3e-28
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   116   3e-27
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   113   2e-26
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   110   3e-25
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   107   2e-24
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    91   1e-18
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    77   2e-14
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    72   7e-13
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    66   6e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    62   9e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    62   1e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    61   2e-09
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    61   2e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    58   3e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    58   3e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    57   5e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    50   6e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    48   3e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    45   4e-04
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    43   0.001
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    43   0.001
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    40   0.010
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.024
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    39   0.027
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    37   0.074
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    37   0.086
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    37   0.096
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    37   0.11 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    36   0.20 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    36   0.23 
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    35   0.36 
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    35   0.44 
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    33   1.3  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...    33   1.8  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    32   1.9  
CAGL0M10131g Chr13 (1008833..1010461) [1629 bp, 542 aa] {ON} sim...    33   2.1  
Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88...    31   2.8  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    32   4.3  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    32   4.7  
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    31   5.5  
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    30   7.2  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    31   7.3  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    31   8.9  

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/441 (96%), Positives = 424/441 (96%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNNAEGGS 240

Query: 241 XXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQV 300
                IELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQV
Sbjct: 241 GKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQV 300

Query: 301 HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRI 360
           HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRI
Sbjct: 301 HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRI 360

Query: 361 KTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQY 420
           KTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQY
Sbjct: 361 KTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQY 420

Query: 421 QSYPWVRYITQSGDDYTIRTA 441
           QSYPWVRYITQSGDDYTIRTA
Sbjct: 421 QSYPWVRYITQSGDDYTIRTA 441

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/441 (91%), Positives = 420/441 (95%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MASCIYFCDN GKVILSRRYRDDVPPSAIE+FP+LLLEAEQESS+VPPCLTHNG+QY+FI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEY+KTVEEESIRDNFVIIYELLDEMLD
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKSYKLIKS KKSKNV+RPP+QLTKSVSWRPEGITYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DVTESINMLITASGQVLRSEILGKV VRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASSSEATE 240

Query: 241 XXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQV 300
                IELEDL+FHQCVRLSKFENEKII+FIPPDGDF+LMNYRLSTPIKPLIWCDAKIQV
Sbjct: 241 GKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAKIQV 300

Query: 301 HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRI 360
           HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILW+I
Sbjct: 301 HSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKI 360

Query: 361 KTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQY 420
           KTFNGGKEYSFAAQLGLPSMTD EVP+AKRPIQVKFQIPYFTTSGIQVRYLK++EPKLQY
Sbjct: 361 KTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQY 420

Query: 421 QSYPWVRYITQSGDDYTIRTA 441
           QSYPWVRYITQSGDDYTIRTA
Sbjct: 421 QSYPWVRYITQSGDDYTIRTA 441

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/445 (79%), Positives = 396/445 (88%), Gaps = 6/445 (1%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MASCIYFCD+ GK ILSRRY+DD+P +AI++FP LL+E EQESSV+PPCL HNG+QY+F+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+YVLTM+RSLS NVAQ+F+FLYK+VEVL EY+K VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KS KKSKNV+RPP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXX------XX 234
           DV ESINMLIT  GQVLRSEILGKVKV+S LSGMPDLKLGLNDKGIF+            
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 235 XXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWC 294
                      IELEDL+FHQCVRLSKFENEKII+FIPPDGDF+LM+YRL+TPIKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 295 DAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKS 354
           D KIQVHS+SRIE+HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS+K+ PEK+
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 355 AILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVH 414
           AILW+IK+F GGKEYS AAQLGLPS++D E P  KRP+QVKFQIPYFTTSGIQVRYLK++
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 415 EPKLQYQSYPWVRYITQSGDDYTIR 439
           EPK+QYQSYPWVRYITQSGDDYTIR
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIR 445

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/442 (76%), Positives = 393/442 (88%), Gaps = 3/442 (0%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S IYFCD+ GK++LSRRY+DD+P +AIE+FP LL+E EQESSV+PPC + NG+QY+FI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+YVLT+++S+SINVAQVFS+L+KL+EVL EY+K VEEESI+DNFVIIYELLDEM+D
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           +GIPQIT+TKML+QYITQKS+KLI+S KK KNVVRPPA LT SVSWRPEGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXX- 239
           DV ESINML+T  GQVLRSEILGKVKV+SRLSGMPDLKLGLNDKGIF             
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 240 --XXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAK 297
                   IELEDL+FHQCVRL+KFENEKII+FIPPDGDF+LM+YRLSTPIKPLIWCD K
Sbjct: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300

Query: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357
           +QVHS+SRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG++K+VP ++AIL
Sbjct: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360

Query: 358 WRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417
           W+IK+F GGK+YS AA++GLPS++D    K KRP+Q+KFQIPYFTTSGIQVRYLK++EPK
Sbjct: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420

Query: 418 LQYQSYPWVRYITQSGDDYTIR 439
           +QY SYPWVRYITQSGDDYTIR
Sbjct: 421 MQYNSYPWVRYITQSGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/444 (75%), Positives = 389/444 (87%), Gaps = 5/444 (1%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+S IYFCD  GK++LSRRY+DD+P SAIE+FP LL+E EQES+V+PPC +HNG+QY+FI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y+LT++RS+  NVAQVFSFL+ LV+VL EY+K VEEESI+DNFVIIYELLDE++D
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
            GIPQIT+TKML+QYITQKS+KLI+S KK KNVVRPP+ LT +VSWRPEGI YKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXX-----XX 235
           DV ESINM++T  GQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 236 XXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCD 295
                     IELEDL+FHQCVRLSKFENEKII+FIPPDGDF+LM+YRLSTPIKPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355
           AKIQVHS+SR+E+HCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHGS+K+VPEK+A
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 356 ILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHE 415
           ILW+IK+F GGK+YS AA++GLPS+ D+     KRP+Q+KFQIPYFTTSGIQVRYLK++E
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420

Query: 416 PKLQYQSYPWVRYITQSGDDYTIR 439
           PKLQY SYPWVRYITQSG+DY IR
Sbjct: 421 PKLQYNSYPWVRYITQSGEDYIIR 444

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/442 (74%), Positives = 375/442 (84%), Gaps = 3/442 (0%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS + FCD+ GK +LSRRY+DDV  SA+E F  LLLE EQESSV+PPC  HNG+ YM++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           Q+ND+YVL ++RS+S+N   +F+F+YKL+ V+ EY+K VEEESIRDN++IIYELLDEM+D
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
            G+PQ+TETKMLKQYITQKS+KL +S KK KNV RPP +LT SVSWRPEGI YKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXX---XX 237
           DV ESINML+T  GQVLRSEILG VKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240

Query: 238 XXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAK 297
                   IELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLM YRLSTPIKPLIWCD K
Sbjct: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300

Query: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357
           +QVHS SRIEIHCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G++K+VPEK+AIL
Sbjct: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360

Query: 358 WRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417
           W+  +F GGKEYS AAQLGLPS++D E PK KRP+Q+KFQIPYFTTSGIQVRYLK+ EPK
Sbjct: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420

Query: 418 LQYQSYPWVRYITQSGDDYTIR 439
           LQY SYPWVRYITQSGDDYTIR
Sbjct: 421 LQYNSYPWVRYITQSGDDYTIR 442

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/440 (74%), Positives = 379/440 (86%), Gaps = 1/440 (0%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S IYFCD  G+ ILSRRYRDD+P SAI+RF  LL + E+ESSV+PPCL H G+QY+FI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           +H D+YV+ +S SL+ N AQVF+FL+KLVE L +YLKTVEEES+RDNFVIIYELLDEM+D
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KLIK+VKK K   RPP  LT SVSWR +GITYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXX-XXXXXXXXX 239
           D+ ESINM++   GQVLRSEI+G+V VRSRLSGMPDLKLG+NDKGIFT            
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETGESQVTA 240

Query: 240 XXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQ 299
                  ELEDL+FHQCVRLSKFENEKII+FIPPDG+F+LM+YRL+TP+KPLIWCD  +Q
Sbjct: 241 GKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQ 300

Query: 300 VHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWR 359
           VHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P FRYSHGS+K+VPEK+AILW+
Sbjct: 301 VHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWK 360

Query: 360 IKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQ 419
           I++F GGKEYS AAQ+GLPS+  VE PK KRP+QVKFQIPYFTTSGIQVRYLK++EPKLQ
Sbjct: 361 IRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQ 420

Query: 420 YQSYPWVRYITQSGDDYTIR 439
           Y+SYPWVRYITQ+GDDYTIR
Sbjct: 421 YKSYPWVRYITQNGDDYTIR 440

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/473 (69%), Positives = 385/473 (81%), Gaps = 34/473 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+YV+ +  SLS N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KS KK +N  RPP  LT SVSWRPEGIT+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT------------ 228
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 229 ------------XXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGD 276
                                        IELEDL+FHQCVRLSKFENEKII+FIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 277 FDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD 336
           FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 337 SPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE-----VPKA--- 388
           +P F+YSHGSLKYVPEKSAILW+I++F GGKEYS +A+LGLPS+++ E     +PK+   
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 389 --KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
             K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/466 (71%), Positives = 384/466 (82%), Gaps = 27/466 (5%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S I FCD+ GK +LSR+YRDD+P +AI+ F  LL++ E+ESSVVPPCLTHNG+ Y+FI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ ++ SLS N +QVF+FL+KLVEV++EYLK VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+ KK +N  RPP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF------------- 227
           D+ ESINML+T  GQVLRSEI+G+VKVRSRLSGMPDLKLG+NDKGIF             
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 228 --------------TXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPP 273
                         T                 +ELEDL+FHQCVRLSKFENEKII+FIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 274 DGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333
           DG+F+LM+YRL+TPIKPLIWCD  I VHS+SR+EIHCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 334 DADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQ 393
           DAD+P FRYSHGS+K+VPEK+AILW+I++F GGKEYS AAQLGLPS+ D E PK KRP+Q
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 394 VKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           +KFQIPYFTTSGIQVRYLKV+EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/444 (70%), Positives = 382/444 (86%), Gaps = 5/444 (1%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +YFCD  G+ ILSRRYRDD+P SAI++F  LLL+ E+ESSV+PPCL+H+G+QY+FI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+YV+ ++ SL+ NVAQVF+FL+KL+EVL EYLK+VEEES+RDNF+IIYELLDEM+D
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+VKKSK   RPP ++T SVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXX-----XXX 235
           D+ ESINML+   GQVLRSEI+G++KV+S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240

Query: 236 XXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCD 295
                     IELEDL+FHQCVRLSKFENEKII+FIPPDG F+LMNYRLS P+KPLIWCD
Sbjct: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300

Query: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355
             +QVHSQSRIEIHCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HGS+K+VP+K+A
Sbjct: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360

Query: 356 ILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHE 415
           ILW+I++F GGKEYS +AQ+GLPS+  ++ PK KRP+Q+KFQIPYFTTSGIQVRYLK+ E
Sbjct: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420

Query: 416 PKLQYQSYPWVRYITQSGDDYTIR 439
           PKL Y+SYPWVRYITQSGDDYTI+
Sbjct: 421 PKLLYKSYPWVRYITQSGDDYTIK 444

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/476 (68%), Positives = 384/476 (80%), Gaps = 37/476 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ ++ SLS N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KS KK +N  RPP  LT SVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT------------ 228
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 229 ---------------XXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPP 273
                                           IELEDL+FHQCVRLSKFENEKII+FIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 274 DGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333
           DG FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 334 DADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE-----VPKA 388
           DAD+P F+YSHGSLKYVPEKSAILW++++F GGKEYS +A+LGLPS+++       +PK 
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 389 -----KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
                K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/459 (69%), Positives = 379/459 (82%), Gaps = 20/459 (4%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSRRY+DDVP SAI++F  LL + E ES+V+PPC+ HNG++Y+FI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+YV+ ++ SL++N+A+VF+FL+KL+ VL EYLKTVEEESIRDNFVIIYEL+DEM+D
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITE +MLK+YITQKS+KL K+ KK +N  RPP++L  SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX----------- 229
           D+ ESINMLIT  GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT            
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 230 ---------XXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLM 280
                                    IELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 281 NYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 340
           NYRL+T IKPLIWCD  IQVHS+SRIEI CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 341 RYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPY 400
           +YSHGS+KYVPE+SAILW+IK+F GGKEY+  A++GLPSM   E PK KRP+QVKF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 401 FTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           FTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 383/474 (80%), Gaps = 35/474 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSRRYRDDVP SAI++F  LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ +  SL+ N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KS KK +N  RPP  LT SVSWRPEGIT+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 XXXXX-------------------------IELEDLQFHQCVRLSKFENEKIISFIPPDG 275
                                         IELEDL+FHQCVRLSKFENEKII+FIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 276 DFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 335
            FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 336 DSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE-----VPKA-- 388
           D+P F+YSHGSLKYVPEKSAILW++++F GGKEYS +A+LGLPS++  +     +PK+  
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 389 ---KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
              K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 383/474 (80%), Gaps = 35/474 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ +  SL  N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQI ETKMLKQYITQKS+KL+KS KK +N  RPP  LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXX--- 237
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 238 ----------------------XXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDG 275
                                         IELEDL+FHQCVRLSKFENEKII+FIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 276 DFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 335
            FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 336 DSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMT-DVE----VPKA-- 388
           D+P F+YSHGSLKYVPEKSAILW++++F GGKEYS +A+LGLPS++ D+E    +PK+  
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 389 ---KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
              K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/448 (71%), Positives = 381/448 (85%), Gaps = 9/448 (2%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ G  +L+RRYRDD+P SAIE+FP LL + E+E+++VPPCL++NG+QY+FI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ ++ S+S N AQ+F+FLYKLV+VL  YLKTVEEESIRDNFVIIYELLDE +D
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+ KK +N  RPP  LT SVSWR   I YKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXX--------- 231
           D+ ESINML+T  GQ+LRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 232 XXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPL 291
                         IELEDL+FHQCVRLSKFE EKII+FIPPDGDF+LMNYRLST IKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 292 IWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVP 351
           IWCD  IQVHSQSRIEIHCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHGS+KYVP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 352 EKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYL 411
           EK+ I+W+I++F GGKEYS +AQ+ LPS+ ++E  KAKRP+Q+KFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 412 KVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           K++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIR 479

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/451 (71%), Positives = 378/451 (83%), Gaps = 12/451 (2%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S IYFCDN GK IL+RRYRDD+  +AI+ F  LLL+ E+E+ V+PPC+ H G+ Y+FI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           +H+DIYV+ ++ S   NVAQ+F FL++LVEVL EY+K V EES+RDNFVIIYELLDEM+D
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSK--NVVRPPAQLTKSVSWRPEGITYKKNEA 178
           +GIPQITETKMLK+YITQKS+KLIK+    K  N  RPPA+LT SVSWRPEGITYKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXX 238
           FLD+ ESINML+T  GQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF+          
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 XXXXXX----------XIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPI 288
                            IELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLMNYRL+TPI
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 289 KPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLK 348
           KPLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHGS+K
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 349 YVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQV 408
           ++PEK+AILW++++F GGKEYS +AQL LPS+  VE PK +RP+QVKFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 409 RYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           RYLKV+EPKLQY+SYPWVRYITQSG+DYTIR
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/450 (71%), Positives = 379/450 (84%), Gaps = 11/450 (2%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +YFCD +GK ILSRRYRDD+P SAI++F  +LLE E+ESSVVPPCL + G+ Y+FI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QH+DIYV+ ++ S   N+AQ+F FL++LV VL +YLK+VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KLIK+ KK +N  RPP  LT SVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX----------- 229
           D+ ESINML+   GQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 230 XXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIK 289
                           IELEDL+FHQCVRLSKFENEKII+FIPPDG+F+LMNYRL+TPIK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 290 PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKY 349
           PLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHGS+K+
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 350 VPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVR 409
           +PEK+AILW++++F GGKEYS  AQLGLPS+  +E PK KRP+Q+KFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 410 YLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           YLK++EPKLQY+S+PWVRYITQSGDDYTIR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/442 (72%), Positives = 378/442 (85%), Gaps = 3/442 (0%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS IYFCD  G+ +LSR+YRDD+P +AI++F +LL + E+ESSV+PPCLT+N  QY+FI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QH+DIY++ ++  L  N+A+VF+FLYK+++VL +YLKTVEEESIRDN+VIIYELLDE++D
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+K+ KK +N  RPP+ LT SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXX--XXXXX 238
           D+ ESINML+T  GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 239 XXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKI 298
                  IELEDL+FHQCVRLSKFE EKII+FIPPDGDF+LMNYRLST IKPLIWCD  +
Sbjct: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300

Query: 299 QVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILW 358
           QVHS SRIEIHCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS+K+VPEKSAILW
Sbjct: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360

Query: 359 RIKTFNGGKEYSFAAQLGLPSMTD-VEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417
           +I++F GGKEYS AA+L LPS +   E  + K+P+QVKFQIPYFTTSGIQVRYLK++EPK
Sbjct: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420

Query: 418 LQYQSYPWVRYITQSGDDYTIR 439
           LQY+SYPWVRYITQSGDDYTIR
Sbjct: 421 LQYKSYPWVRYITQSGDDYTIR 442

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/467 (66%), Positives = 375/467 (80%), Gaps = 31/467 (6%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS +YFCD+ GK +LSR+YRDD+P SAI++F +LL + E+ES+++PPC++HNG+QYMFI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y+  ++ S+  N++ +F+FL+K+++VL  YLKTVEEESIRDNF+IIYELLDEM+D
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YG+PQITETKMLK+YIT KS+KL K+ KK +N  RPP +LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF------------- 227
           D+ ESINMLIT  GQVLRSEI+G V+V+SRLSGMPDLKLG+ND+GIF             
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 228 ---------TXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFD 278
                    T                 IELEDL+FHQCVRLSKFENEKIISFIPPDG+FD
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 279 LMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSP 338
           LMNYRLST IKPLIWCD  IQ +   RIEIHC+AKAQIKKKS A NVEILIPVPEDADSP
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 339 KFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVE------VPKAKRPI 392
            F+YSHG +KY+PEK+ +LW+I +F GGKEYS AAQ+GLPS++  +        ++K+P+
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 393 QVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           QVKF+IPYFTTSGIQVRYLKV+EPKLQY++YPWVRYITQSGDDYTIR
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIR 464

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/456 (69%), Positives = 374/456 (82%), Gaps = 15/456 (3%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           MAS IYFCDN G+ +LSR+YRDD+P SAI+RFP LL   E+E++++PPC+ HNG+Q++FI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
           QHND+Y++ ++ S+S N A +FSFL+K++EVL+EYLK VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180
           YGIPQITE KMLKQYITQKS+KL K+ KK +N  RPP  LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX----------- 229
           D+ ESINML+T  GQVLRSEI+G+VKV+S+LSGMPDLKLG+NDKG+F+            
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 230 ---XXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLST 286
                              +ELEDL+FHQCVRLSKFENEK I+FIPPDGDF+LM+YRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 287 PIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS 346
            IKPLIWCD  I+ HS+SRIEI CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 347 LKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMT-DVEVPKAKRPIQVKFQIPYFTTSG 405
           +KYVPEK+AILW+I+TF G KEYS AA++GLPS     E  K KRP+QVKFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 406 IQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIRTA 441
           IQVRYLK+ E  LQY+SYPWVRYIT+SGDDYTIR +
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  224 bits (571), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 147/472 (31%), Positives = 240/472 (50%), Gaps = 42/472 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S ++     G +I+S+  +D++     E F    ++      V  P LT     +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119
           + N  ++++T+SR  + + A ++ FLY   ++L  Y     E+S++ +F++ YE+LD +L
Sbjct: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVS-------------- 165
           D GIP+ TE   +  YI++K   L +++  S +++  P+ L K+ +              
Sbjct: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173

Query: 166 ---WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
              WR EGI YKKNE +LDV E I++L+   G +L+S + G V+  + LSGMP  + G N
Sbjct: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233

Query: 223 D-----------KGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFI 271
           D                                 + LED +FHQCV+L KF+ E++I F+
Sbjct: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293

Query: 272 PPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPV 331
           PPDG F+LM Y +   +         +       +E     K+    K  A +VE+ IP 
Sbjct: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPA 353

Query: 332 PEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLP---SMTDVEVPKA 388
           P D  + K   S G  K++PE++AI+W+I  ++G  E  F+A + +P       + + + 
Sbjct: 354 PPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNLEQW 412

Query: 389 KR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
            R PI V+F+I  F+ SG+ VRYLKV E  L Y +  WV+YI++SG  Y +R
Sbjct: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  214 bits (544), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/473 (30%), Positives = 236/473 (49%), Gaps = 42/473 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S ++     G++++S+  R  VP S  E F    ++      V  P LT     +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119
           +   +++++ +SRS + + A ++ FLYKL  +L E      E  ++++F+  YELLD +L
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALL-EAFGLHSENELKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYIT-------QKSYKLIKSVKKSKNVVRPPAQLTKSVS------- 165
           + G+P  TE   +   ++       ++    I+S     N + P AQ  ++ S       
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 166 ----------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMP 215
                     WR  GI YKKNE FL+V E I++L++  G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDKGIFTX------XXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIIS 269
             + GLND    +                       + LED +FHQCV+L KF++E+ I+
Sbjct: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295

Query: 270 FIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILI 329
           FIPPDG F+LM Y +   +         + +   + I+     K+    K TA +V++ I
Sbjct: 296 FIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355

Query: 330 PVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEV---P 386
           PVP +        S+G  K+VPE+SAI+W+   + G  E S +A   +P M D  +    
Sbjct: 356 PVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVP-MKDSALNIDQ 413

Query: 387 KAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
            +K P+ +KF+I  F+ SG+ VR+  V E    Y+   W++Y+++SG  Y +R
Sbjct: 414 WSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  206 bits (524), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/485 (28%), Positives = 244/485 (50%), Gaps = 57/485 (11%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLT--HNGLQYM 58
           M S I+  +  G +++S+  +D V  S  + F   ++    +  V  P LT      Q++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHND---IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELL 115
             + +D   ++++ +SRS +++ + ++ +L+KL + L E     +E+ ++D F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQ-LMEAFGINDEDVLKDEFMLLYEIL 115

Query: 116 DEMLDYGIPQITETKMLKQYITQKSYKLIKSVKKSK-----------NVVRPPAQLTK-- 162
           +  L+ GIPQ T+   L Q I + S K I++   SK           N+++ P +L+K  
Sbjct: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAP-KLSKRS 171

Query: 163 ----------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLS 212
                        WRP G+ YKKNE +LD+ E I +L+   G +++S + G V   S LS
Sbjct: 172 SSSIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLS 231

Query: 213 GMPDLKLGLNDK--------------GIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVR 258
           GMP  +LGLND                + +                 + LED +FHQCV+
Sbjct: 232 GMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQ 291

Query: 259 LSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKK 318
           L+K+E   +I F+PPDG F LM YR+   I        ++++   S +      ++    
Sbjct: 292 LNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPS 351

Query: 319 KSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLP 378
             +A +V + IPVP       F  S G  KY   +  ++W+   + G  E + + ++ +P
Sbjct: 352 NVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIP 411

Query: 379 S----MTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGD 434
           +    ++D+ +  ++ PI + F+I  F+ SG+ VR+LK  EP+L YQ   W++YI+ SG 
Sbjct: 412 ATSHDLSDL-LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG- 469

Query: 435 DYTIR 439
            Y IR
Sbjct: 470 AYEIR 474

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  205 bits (522), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 232/472 (49%), Gaps = 39/472 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M + ++     G++++S+  +  V  S  E F    ++      V  P LT     +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119
           +   +++++ +SRS + + A ++ FLY+L E+L E      E  +++ F+I YELLD +L
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQKSYKLIKSVK-------KSKNVVRPPAQLTK---------- 162
           + G+P  TE   +   ++ K    + +            N + P +Q  +          
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 163 -------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMP 215
                  ++ WR  GI YKKNE FL+V E I++L++  G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDK-------GIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKII 268
             + GLND        G                    + LED +FHQCV+L KF++E+ I
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295

Query: 269 SFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEIL 328
           +FI PDG F+LM Y +   +         + V   + I+     K+    K TA +V++ 
Sbjct: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLR 355

Query: 329 IPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKA 388
           IPVP +  S     S+G  K+VPE+SAI+W+   + G  E S +A       + + + + 
Sbjct: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLNIEQW 415

Query: 389 KR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
            R PI +KF+I  F+ SG+ VR+  V E    Y+   W++Y+++SG  Y +R
Sbjct: 416 PRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  202 bits (515), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 138/487 (28%), Positives = 237/487 (48%), Gaps = 54/487 (11%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M + ++     G++++S+  RD +  S  E F    ++      V  P LT     +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119
           + + +++++ ++RS + + A ++ FLYK   +L  Y     EES+++ F+  YELLD +L
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITETKMLKQYITQK----------SYKLIKSVKKSKNV-VRPPAQLTKSVS--- 165
           + G+P  TE   +   ++++          + +L+ S   + ++  R P  L K      
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKV 207
                             WR  GI YKKNE FLDV E IN+L++  G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 RSRLSGMPDLKLGLNDK------------GIFTXXXXXXXXXXXXXXXXXIELEDLQFHQ 255
            + LSG P  + GLND                +                 ++LED +FHQ
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295

Query: 256 CVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQS-RIEIHCRAKA 314
           CV+L++F  ++II F+PPDG F+LM Y +   +           V S +  +E     K+
Sbjct: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355

Query: 315 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAA- 373
               K TA +V + IPVP      K   S+G  ++VPE++A+LW+   + G  E + +A 
Sbjct: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSAL 415

Query: 374 QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQS 432
            + + + + + + +  R P+ + F+I  F+ SG+ VR+ KV E    Y +  WV+YI++S
Sbjct: 416 TVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRS 475

Query: 433 GDDYTIR 439
           G  Y +R
Sbjct: 476 G-AYEVR 481

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  201 bits (510), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 141/494 (28%), Positives = 248/494 (50%), Gaps = 81/494 (16%)

Query: 12  GKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQH---NDIYVL 68
           G++++S+ ++  +  S  + F    ++      V  P LT     +  I+    ++++++
Sbjct: 12  GELVVSKLFKGSMKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHIKSTRGDNLWIV 68

Query: 69  TMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML--DYGIPQI 126
            +SR+ +++ A ++ FLYKL  +L  Y     EE +++ F+I++ELLD M+    GIP +
Sbjct: 69  AVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDVMMCGSGGIPML 126

Query: 127 TETKMLKQYITQKSYKLIKSVKKS---------------------------KNVVRPPAQ 159
           TE  ++   I++ S K  KS+ ++                           K + R  A 
Sbjct: 127 TENSLV---ISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRRNSAS 183

Query: 160 LTKSVS------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSG 213
           L++ +S      WRP+GI +KKNE  L V E IN+L++  G VL++ + G + + + LSG
Sbjct: 184 LSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSIDLETHLSG 243

Query: 214 MPDLKLGLNDK----GIFTXX---------------XXXXXXXXXXXXXXXIELEDLQFH 254
            P  + GLND     G+ +                                + LED +FH
Sbjct: 244 TPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSVILEDCKFH 303

Query: 255 QCVRLSKFENEKIISFIPPDGDFDLMNYR----LSTPIK--PLIWCDAKIQVHSQSRIEI 308
           QCV L KF+ ++II F+PPDG  +LM Y     L+ P K  P++         + + +E 
Sbjct: 304 QCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIV-----TNTRNGTALEY 358

Query: 309 HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKE 368
               K+    + +A NV + IPVP +    K   ++GS K++PE+SA++WR   FNG  E
Sbjct: 359 RITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNGLTE 418

Query: 369 YSFAAQLGLPSMTDVEVPK---AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPW 425
            + +A + +P+  + ++     +K P+ + F+I  F+ SG+ VRY  + E   +Y++  W
Sbjct: 419 NTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKAVKW 477

Query: 426 VRYITQSGDDYTIR 439
           ++YI++SG  Y IR
Sbjct: 478 IKYISRSG-SYEIR 490

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  200 bits (509), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 146/485 (30%), Positives = 243/485 (50%), Gaps = 57/485 (11%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +    + G++I+S+ +++++  S  + F    ++      V  P LT     +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIF---RIQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLD 116
           + N    D+++++++RS +IN   V+ FLYK   +L  Y     EE +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115

Query: 117 EML-DYGIPQITE-TKMLKQYITQKSYKLIKSVK---KSKNVVRP--PAQLTKSVS---- 165
            ML + G P  T+   ++K+   + S + I++     ++KN   P  P  L ++ S    
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 166 -----------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVR 208
                            WRP+GI++KKNE FL V E I++L++  G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGLNDKGIF-------TXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSK 261
           + LSG P  + GLND           +                 + LED +FHQCV L K
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEK 295

Query: 262 FENEKIISFIPPDGDFDLMNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKS 320
           F+ ++II F+PPDG  +LM Y + + I  P           S + +E     K+    K 
Sbjct: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355

Query: 321 TANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSM 380
           TA NV + IPVP +    K   S+GS K+ PE+ A+LW    +NG  E + +A     ++
Sbjct: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411

Query: 381 TDVEVPK------AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGD 434
           T  + P+       K PI + F+I  F+ SG+ VRY  + E + +Y++  W+RY+++SG 
Sbjct: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469

Query: 435 DYTIR 439
            Y IR
Sbjct: 470 SYEIR 474

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 145/493 (29%), Positives = 240/493 (48%), Gaps = 66/493 (13%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S I    + G++I+++  +  +  S  + F    ++      V  P LT     +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
           + +    ++++ +SRS + N   ++ FLYKL  V+ +     +E ++++NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDT 115

Query: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKS---------VKKSKNVVRP---------PA 158
           +L+  GIP  TE   +   +T K  K I              S N+  P         P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 159 QLTKS---------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILG 203
            LT++               +SWRP GI YKKNE  L+V E I++L++  G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 KVKVRSRLSGMPDLKLGLNDK--------GIFTXXXXXXXXXXXXXXXXXIELEDLQFHQ 255
            + + + LSGMP  + GLND          I                   + LED +FHQ
Sbjct: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295

Query: 256 CVRLSKFENEKIISFIPPDGDFDLMNY----RLSTPIK--PLIWCDAKIQVHSQSRIEIH 309
           CV L KF  +++I F+PPDG  +LM Y     L+ P K  P++       +   + I+  
Sbjct: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYR 350

Query: 310 CRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEY 369
              K+    K +A +V + IPVP      +   S+G  K+VPE+SA++W+   + G  E 
Sbjct: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410

Query: 370 SFAAQLGLPS--MTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWV 426
           + +A + +PS   T + V +  R P+ + F+I  F+ SG+ VRY KV +   +Y++  W+
Sbjct: 411 TLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469

Query: 427 RYITQSGDDYTIR 439
           +YI++SG  Y IR
Sbjct: 470 KYISKSG-SYEIR 481

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  190 bits (483), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/489 (29%), Positives = 235/489 (48%), Gaps = 64/489 (13%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M + I+     G++I+S+ + + +  S  + F    ++      V  P LT     +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
           + N    ++++T+SR+ + N   ++ FLYK   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 MLDYG-IPQITETKMLKQYITQKSYKL--IKSVKKSKNVVRPPAQ------------LTK 162
           ++  G IP  TE   +   I+ K  K     S  KS  V   P              LT+
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 163 S---------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKV 207
           +                 WRP GI YKKNE FL V E IN+L++  G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 RSRLSGMPDLKLGLNDKG--------IFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRL 259
            + LSG P  + GLND                              + LED +FHQCV L
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 260 SKFENEKIISFIPPDGDFDLMNY----RLSTPIK--PLIWCDAKIQVHSQSRIEIHCRAK 313
            KF  E+II F+PPDG+ +LM Y     L+ P K  P++           S +E     K
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLK 348

Query: 314 AQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAA 373
           +    K +A +V + IPVP      K   S+G  K+  E++A++WR   ++G  E + +A
Sbjct: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408

Query: 374 QLGLPS--MTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYIT 430
            + +P+   T + + +  R P+ + F+I  F+ SG+ VRY +V +   +Y+   W++YI+
Sbjct: 409 -VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYIS 467

Query: 431 QSGDDYTIR 439
           +SG  Y +R
Sbjct: 468 KSG-SYEVR 475

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 137/513 (26%), Positives = 235/513 (45%), Gaps = 93/513 (18%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+SCIY  D T + ++ + ++     S  E    L  +A  +  +VP    + G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDIYVLTM--------SRSLSINVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVI 110
           + +  Y ++         ++    NV  + ++L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEMLDYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRP-------------- 156
           IYELLDE LD+G+PQ+T+  +++ YI  +     +    SK + +               
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PAQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLS 212
                  T ++SWRP+GI Y KNE FLDV E I   +  +   +R   + G+++ RS LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIP 272
           GMP LK+GL+                         + + +FHQCV L   + + I+SFIP
Sbjct: 237 GMPKLKIGLS------------KITSSLPKEREQFMNNAKFHQCVSLEDLQ-KNIVSFIP 283

Query: 273 PDGDFDLMNYRLST-----PIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEI 327
           PDG+F L  Y+L       P+  L+  D K +   + +I I        K +++ + + I
Sbjct: 284 PDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNI 343

Query: 328 LIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGK---EYSFAAQLG 376
            IP+         + A  P+F+   G++ +      +LW + +  GG    E+S   +  
Sbjct: 344 RIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFR 403

Query: 377 L-------------------------PSMTDV-------EVPKAKRPIQVKFQIPYFTTS 404
           L                         P + ++       E     R + ++F+IPY+T S
Sbjct: 404 LYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCS 463

Query: 405 GIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
           G++V+YLK+ E +LQY S+PWVRY T + ++Y 
Sbjct: 464 GLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYA 496

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  189 bits (480), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 144/500 (28%), Positives = 242/500 (48%), Gaps = 71/500 (14%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +    + G+++L++ +++ +  S  + F   ++       V  P LT     +  I
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
           +  H D ++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKSVKK-------------------SKNVVRPP 157
           ML   GIP  TE   L   I Q S K ++++                     S   +  P
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFP 172

Query: 158 AQLTK-------------------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLR 198
             LTK                    ++WRP+GI +KK+E FL V E IN+L++  G +L+
Sbjct: 173 KFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLNDK-GI--------------FTXXXXXXXXXXXXXXX 243
           S + G + + + LSG P  + GLND  G+               +               
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAA 292

Query: 244 XXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQ 303
             + LED +FH+CV L KF    II F+PPDG  +LM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHST 351

Query: 304 SRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIK 361
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VPE++A++WR  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 362 TFNGGKEYSFAA-QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQ 419
            +NG  E + +A  +     T + + +  R PI ++F++  F+ SG+ VRY  +     +
Sbjct: 412 KYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSK 471

Query: 420 YQSYPWVRYITQSGDDYTIR 439
           +++  W++YI+++G  Y +R
Sbjct: 472 HRAVKWIKYISKAG-SYEVR 490

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  189 bits (479), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 141/500 (28%), Positives = 242/500 (48%), Gaps = 71/500 (14%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +    + G++IL++ +++ +  S  + F   ++       V  P LT     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH---NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
           +    ++++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKSV----------------------------- 147
           ML   GIP  TE   L   I Q S K I++V                             
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFP 172

Query: 148 ----KKSKNVVRPPAQLT-----KSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLR 198
               K+S + +      +       ++WRP+GI +KK+E FL V E +N+L++  G +L+
Sbjct: 173 KFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLNDK-GIFTXXXXXXXXXXXXXXXXXIE---------- 247
           S + G + + + LSG P  + GLND  G+ +                  E          
Sbjct: 233 SYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAA 292

Query: 248 ----LEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQ 303
               LED +FH+CV + KF    II F+PPDG  +LM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHSA 351

Query: 304 SRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIK 361
              E+  R   K+    K +A +V + IPVP      K   S+G+ K+VPE++A++WR  
Sbjct: 352 RDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFN 411

Query: 362 TFNGGKEYSFAA-QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQ 419
            FNG  E + +A  +     T + + +  R P+ + F++  F+ SG+ VRY  +     +
Sbjct: 412 KFNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSK 471

Query: 420 YQSYPWVRYITQSGDDYTIR 439
           +++  W++YI++SG  Y +R
Sbjct: 472 HRAVKWIKYISKSG-SYEVR 490

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  188 bits (477), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 134/463 (28%), Positives = 225/463 (48%), Gaps = 41/463 (8%)

Query: 12  GKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHND---IYVL 68
           G++I+S+  + +   S  + F   ++       V  P LT     +  I+ N    ++++
Sbjct: 12  GELIVSKFSKSNAKRSISDIFRVQVI---NNLDVRSPILTLGSTTFHHIRSNSRDHLWLV 68

Query: 69  TMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDY-GIPQIT 127
            ++RS + N   ++ FLYK   +L  +     E ++++ F+  YELLD ML+  G+P  T
Sbjct: 69  AVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDLMLNVDGVPLDT 126

Query: 128 ETKMLKQYITQKSYKLIKSVKK------------SKNVVRPPAQLT--------KSVSWR 167
           E   +   ++ K    I S               SK + R    ++         +  WR
Sbjct: 127 ELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTMNTEPSNYPWR 186

Query: 168 PEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDK--- 224
           P GI YKKNE FL++ E I++L++    +L++ + G V + S LSG P  + GLND    
Sbjct: 187 PNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTCQFGLNDSLSV 246

Query: 225 ---GIFTXXXXXXXXXXX--XXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDL 279
                +                    + LED +FH+CV L KF  ++II F+PPDG  +L
Sbjct: 247 DEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIEL 306

Query: 280 MNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSP 338
           M Y +   I  P       I   S++ ++     K+    K +AN+V + IPVP      
Sbjct: 307 MKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDC 366

Query: 339 KFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAA-QLGLPSMTDVEVPK-AKRPIQVKF 396
           K   S+G  ++VPE+S I+W+   +NG  E   +A  +     T + + + A+ PI + F
Sbjct: 367 KLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDTTQLMLQQWARPPISLDF 426

Query: 397 QIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
           +I  F+ SG+ VRYLK+ E   +Y++  W++YI++SG  Y +R
Sbjct: 427 EIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  188 bits (478), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 143/500 (28%), Positives = 239/500 (47%), Gaps = 71/500 (14%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +    + G+++L++ +++ +  S  + F   ++       V  P LT     +  I
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
           +  H D ++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKSVKK-------------------SKNVVRPP 157
           ML   GIP  TE   L   I Q S K +++                          +  P
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFP 172

Query: 158 AQLTKS-------------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLR 198
             L KS                   ++WRP+GIT+KK+E FL V E +N+L++  G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLNDK-GIFTXXXXXXXXXXXXXXXXXIE---------- 247
           S + G + + + LSG P  + GLND  G+ +                  E          
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAA 292

Query: 248 ----LEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQ 303
               LED +FH+CV L KF     I F+PPDG  +LM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHST 351

Query: 304 SRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIK 361
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VPE++A++WR  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411

Query: 362 TFNGGKEYSFAA-QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQ 419
            +NG  E + +A  +     T + + +  R P+ + F++  F+ SG+ VRY  +     +
Sbjct: 412 KYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSK 471

Query: 420 YQSYPWVRYITQSGDDYTIR 439
           +++  W++YI++SG  Y +R
Sbjct: 472 HRAVKWIKYISRSG-SYEVR 490

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  181 bits (459), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 127/467 (27%), Positives = 214/467 (45%), Gaps = 107/467 (22%)

Query: 48  PCLTHNGLQYMFIQHNDIYVLTMSRSLSINVAQ-VFSFLYKLVEVLAEYL-KTVEEESIR 105
           P L+H G  Y++IQ + +Y L++S  +   V   VF++L +L ++  +YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMLDYGIPQITETKMLKQYITQKSYKLIKS--------------VKKSK 151
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+  +  +  +                 K +
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 152 NVVRPPAQ------------LTKSVSWRPEGITYKKNEAFLDVTESINMLIT-ASGQVLR 198
               P A              T ++SWRP GI Y KNE FLDV E +  L+     QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGKVKVRSRLSGMPDLKLGLN-----DKGIFTXXXXXXXXXXXXXXXXXIELEDLQF 253
           +++ G +  RS LSGMP L +GLN     D+  FT                      + F
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNKMVAQDRD-FT--------------------SQVHF 259

Query: 254 HQCVRLSKFENEKIISFIPPDGDFDLMNYRLS-----TPIKPLIWCDAKIQVHSQ----S 304
           HQCV L +   ++ I+F+PPDG+F L +Y+L+      P+  L  C A ++   +     
Sbjct: 260 HQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADAD 319

Query: 305 RIEIHCRAKAQIKKKSTANNVEILIPVPEDADS--------PKFRYSHGSLKYVPEKSAI 356
           R+ +        K +   + +++ +P+    +         P+F+   G + +      +
Sbjct: 320 RLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYL 379

Query: 357 LWRI---KTFNGGKEYSFAAQL-------------------------------GLPSMTD 382
           LW I   K  +G + ++  +Q                                 L + T 
Sbjct: 380 LWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTH 439

Query: 383 VEVP-KAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRY 428
              P  A   ++V F++PY T SG++V +LK+ EP+LQYQS+PW+RY
Sbjct: 440 ASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  180 bits (457), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 133/484 (27%), Positives = 228/484 (47%), Gaps = 66/484 (13%)

Query: 12  GKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQH----NDIYV 67
           G++I+S+ ++  +  S  + F    ++      V  P LT     +  I+     +++++
Sbjct: 12  GELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHIRSSKDSDNLWL 68

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDY-GIPQI 126
           +  +R+ + N A ++ FLYKL  +L EY    +EE +++ F+I++ELLD ML   GIP  
Sbjct: 69  VAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSCGIPLE 126

Query: 127 TETKMLKQYITQKSYKLIKS----------VKKSKNVVRPPAQLTKS------------- 163
           TE   +   ++ K  KL  +            K  N +  P  L ++             
Sbjct: 127 TEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHDSNFSFN 186

Query: 164 -VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
             SWRP+ I +KKNE  L V E IN+L+   G +L++ + G + +++RLSG P  + GLN
Sbjct: 187 DFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLN 246

Query: 223 DKGIFTXX--------------------XXXXXXXXXXXXXXXIELEDLQFHQCVRLSKF 262
           D                                          + LED +FHQCV L KF
Sbjct: 247 DSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF 306

Query: 263 ENEKIISFIPPDGDFDLMNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKST 321
           + E+II F+PPDG  +LM Y +   +  P           +   ++     K+    + +
Sbjct: 307 DRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLS 366

Query: 322 ANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMT 381
           A  V + IPVP          S+G+ K+VP ++A++W+   +NG  E + +A + +PS  
Sbjct: 367 AKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPSK- 424

Query: 382 DVEVPK------AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDD 435
             EV +      A+ P+ + F+I  F+ SG+ VRY  + E    Y++  W++Y+++SG  
Sbjct: 425 --EVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG-S 481

Query: 436 YTIR 439
           Y +R
Sbjct: 482 YEVR 485

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  180 bits (457), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 195/382 (51%), Gaps = 27/382 (7%)

Query: 48  PCLTHNGLQYMFIQ-HNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRD 106
           P LT     +  I+    ++++ + R  + + A ++ FLY + ++L  Y    EE ++ D
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLD 102

Query: 107 NFVIIYELLDEMLDYGIPQITETKMLKQYITQK-SYKLIKSVKKSKNVVRPPAQLTKSVS 165
           +F++ YELLD +LD G+PQ TE   +   +++K +     S     N  R     TK+VS
Sbjct: 103 DFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVS 162

Query: 166 -------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLS 212
                        WR EGI YKKNE +LDV E +++L+   G +L++ + G V+  + LS
Sbjct: 163 VETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLS 222

Query: 213 GMPDLKLGLNDKGIF---TXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIIS 269
           GMP    G ND       +                 + LED +FHQCV+L+KF+ E++I 
Sbjct: 223 GMPLCHFGFNDSQSLRQRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIR 282

Query: 270 FIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILI 329
           F+PPDG+F+LM Y +   ++P       +   ++  IE     ++    K +A +VE+ I
Sbjct: 283 FVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYI 342

Query: 330 PVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAA-----QLGLPSMTDVE 384
           P P    S K   S G  K+VPE++AI+W+I  F+G  E + +A     + G  +    +
Sbjct: 343 PAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQ 402

Query: 385 VPKAKRPIQVKFQIPYFTTSGI 406
            P+   PI +K +I  F+T+ +
Sbjct: 403 WPRP--PISMKLEIMMFSTAAL 422

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  181 bits (458), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 146/528 (27%), Positives = 240/528 (45%), Gaps = 118/528 (22%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+SC++  D     ++ R  +    P     + AL  +     S   P +   G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKSIAHP----EWYALYFKRVHPQSR-GPVIYSKGIIYIYI 55

Query: 61  QHNDIYVLTMSRS-LSINVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVIIYELLDE 117
             + +Y +++S   L  N+  + ++L     +L +YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MLDYGIPQITETKMLKQYI-----------------TQKSYKLIKSVKKSKNVV-----R 155
            LDYGIPQ+T+  +++  I                  ++S   I   K++K+       R
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 156 PPAQL---------TKSVSWRPEGITYKKNEAFLDVTESINMLIT-ASGQVLRSEILGKV 205
              Q          T+++SWRP+GI Y KNE F+D+ E  + L+   + QV ++ + GK+
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVRSRLSGMPDLKLGLN----DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSK 261
             RS LSGMP +++ +N    DK +F                    L   +FHQCV L  
Sbjct: 236 NCRSYLSGMPIVRVCINKMLKDKDLF--------------------LGSSKFHQCVSLES 275

Query: 262 FENEKIISFIPPDGDFDLMNYRL-----STPIKPLIWCDAKI-QVHSQSRIEIHCRAKAQ 315
             ++  I FIPPDGDF L  Y+L      +PI  LI  D KI +   + R+ +    +  
Sbjct: 276 LSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLI--DYKINERQKKHRLHLSVTIQPH 333

Query: 316 IKKKSTANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGK 367
            K +++A  ++I IP          +   +P+F+  HGS+ +      +LW  +   GG 
Sbjct: 334 FKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGH 393

Query: 368 -EYSFAAQLGLPSMTDVE-------VPKAKRP---------------------------- 391
            E S++  +      + E       + K+  P                            
Sbjct: 394 GETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQS 453

Query: 392 --IQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
             I  +F++PY+T+SG++V YLK+ E  L+YQS+ WVRY T +  +Y 
Sbjct: 454 NAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYA 501

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  179 bits (454), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/500 (28%), Positives = 237/500 (47%), Gaps = 71/500 (14%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S +    + G++IL++ +++ +  S  + F   ++       V  P LT     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  --QHND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117
             +H D ++++T++RS + N A ++ FLYKL  V+  Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MLD-YGIPQITETKMLKQYITQKSYKLIKS------------------------------ 146
           ML   GIP  TE   L   + + S K +++                              
Sbjct: 116 MLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFP 172

Query: 147 --VKKSKNVVRPPAQLTKS------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLR 198
             +KKS +        T        ++WR  GI +KK+E FL V E +N+L++  G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLNDK-GI--------------FTXXXXXXXXXXXXXXX 243
           S + G + + + L+G P  + GLND  G+               +               
Sbjct: 233 SYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAA 292

Query: 244 XXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQ 303
             + LED +FH+CV + KF    II FIPPDG  +LM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHST 351

Query: 304 SRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIK 361
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VPE++A++WR  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 362 TFNGGKEYSF-AAQLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQ 419
            +NG  E +  AA +     T +   +  R P+ + F++  F+ SG+ VRY  +     +
Sbjct: 412 KYNGLTENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSK 471

Query: 420 YQSYPWVRYITQSGDDYTIR 439
           +++  W++YI++SG  Y +R
Sbjct: 472 HRAVKWIKYISKSG-SYEVR 490

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 139/533 (26%), Positives = 241/533 (45%), Gaps = 123/533 (23%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+S I+  D     ++ + ++    P A   F     E  + S+V  P + H G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKSVQHPEA---FAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDIYVLTMS-RSLSINVAQVFSFLYKLVEVLAEYLK--TVEEESIRDNFVIIYELLDE 117
             + +Y ++MS  SL  ++     +L     +L +YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MLDYGIPQITETKMLKQYIT----------------------QKSYKLIKSVKKSKN--- 152
            LD+GIPQ+T+  +++  I                       Q+   + ++ +KS     
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 153 ----------VVRPPAQLTKSVSWRPEGITYKKNEAFLDVTESINMLIT-ASGQVLRSEI 201
                     V+R     T+++SWRP+GI Y KNE F+DV ES   ++     QV ++ I
Sbjct: 176 QDDEEYINSFVLRTT---TQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFI 232

Query: 202 LGKVKVRSRLSGMPDLKLGLN----DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCV 257
            G++  RS LSGMP +K+ +N    D+  F                    L   +FHQCV
Sbjct: 233 FGRIICRSYLSGMPVVKICINKMLKDRDQF--------------------LSSAKFHQCV 272

Query: 258 RLSKFENEKIISFIPPDGDFDLMNYRL-----STPIKPLIWCDAKIQVHSQSRIEIHCRA 312
            L    ++  I FIPPDGDF L  Y++      +P+  LI     ++   + +++I  + 
Sbjct: 273 SLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISMKI 331

Query: 313 KAQIKKKSTANNVEILIPVPEDADS--------PKFRYSHGSLKYVPEKSAILWRIKTFN 364
           +   K +++A  ++I +P+ +  ++        P+F+   GS+ +      +LW+     
Sbjct: 332 QPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMK 391

Query: 365 GGKEYSFAAQLGLPSMTDVEVPK------------------------------------- 387
           GG   ++ +      + D E  +                                     
Sbjct: 392 GGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINN 451

Query: 388 -AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
             +  I  +F++PYFT+SG++V YLK+ E +LQYQS+PWVRY T +  +Y  +
Sbjct: 452 PVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQ 504

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  174 bits (442), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 121/439 (27%), Positives = 207/439 (47%), Gaps = 50/439 (11%)

Query: 48  PCLTHNGLQYMFIQ---HNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESI 104
           P LT     + FI+    + ++++ ++RS + +   ++ +LYKL  ++  Y  T  E+ +
Sbjct: 45  PILTLGSTTFHFIRTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVYGLT-HEDIL 102

Query: 105 RDNFVIIYELLDEMLDY-GIPQITETKMLKQYITQKSYKLIKSVKK-------------- 149
           +D F++ +ELLD  L   G+P  TE   +   +T K  +++ S                 
Sbjct: 103 KDEFIVCHELLDITLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGH 162

Query: 150 -----------SKNVVRPPAQLTKS------VSWRPEGITYKKNEAFLDVTESINMLITA 192
                      S+N  R   Q  +S      + WR   I YKKNE  ++V E IN+L+  
Sbjct: 163 NSTPISMPKFLSRNSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGK 222

Query: 193 SGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF---------TXXXXXXXXXXXXXXX 243
              +LR+ + G + + + LSGMP  ++G+ND                             
Sbjct: 223 DDNILRAYVDGTIDITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSG 282

Query: 244 XXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQ 303
             + LE  +FHQCV L K+  + +I FIPPDG F+LM Y +S  +        ++ + S 
Sbjct: 283 DRVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSH 342

Query: 304 -SRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKT 362
            + +    + K+   +K +A NV + IPVP      K   S G  K++PE++ ++W    
Sbjct: 343 GTALSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHR 402

Query: 363 FNGGKEYSFAAQ-LGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQY 420
           FNG  E    AQ +   S+    + +  R P+ + F++  F+ +G+ VRYLKV E  + Y
Sbjct: 403 FNGSTENHLNAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHY 462

Query: 421 QSYPWVRYITQSGDDYTIR 439
            +  W++YI+ +G  Y +R
Sbjct: 463 NTIKWIKYISAAG-SYEVR 480

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  171 bits (433), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 139/529 (26%), Positives = 234/529 (44%), Gaps = 111/529 (20%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEA--EQESSVVPPCLTHNGLQYM 58
           M+SC    D T + ++ R  R    P        L L+   +       P    NG  Y 
Sbjct: 1   MSSCFLLLDETYEPLIRRALR----PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYA 56

Query: 59  FIQHNDIY-VLTMSRSLSINVAQVFSFLYKLVEVLAEYLKT-VEEESIRDNFVIIYELLD 116
            I  +++Y  + M  + S++   V  +L ++ ++  +++   + + ++RDNF +I+E+++
Sbjct: 57  VITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIE 116

Query: 117 EMLDYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVR-----PPAQ------------ 159
           E  DYGI Q+T   ++  +I     ++IK    S+N        PP              
Sbjct: 117 ESSDYGIIQVTNYNIIHDFI---KVEVIKPDDDSENTASEKHELPPGDQDETFINSYILR 173

Query: 160 -LTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDL 217
            +T +VSWRP+GI Y KNE FLDV E +  ++     V+R+ ++ G +  RS LSGMP L
Sbjct: 174 TMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQL 233

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKF--ENEKIISFIPPDG 275
            +GLN                         ++ L+FH+CV L     E   +I FIPPDG
Sbjct: 234 SIGLN----------------KLMQKNVHFMKRLKFHECVDLHTLIKEESPVIKFIPPDG 277

Query: 276 DFDLMNYRLSTPI--KPLIWCDA-------KIQVHSQSRIEIHCRAKAQIKKKSTANNVE 326
           +F+L NY+L+ P+  +P+I   +       +    +Q ++ +        K + +A  + 
Sbjct: 278 EFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDSAKELL 337

Query: 327 ILIPVPE-------DADSPK-FRYSHGSLKYVPEKSAILWRIKTFNGG---KEYSF---- 371
           I IP+         D + P  F+   G + +     +I+W+I    GG   K Y      
Sbjct: 338 IKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYGLKCMF 397

Query: 372 ---------AAQLGLPSMTD----VEVPKAKR--------------------------PI 392
                    A ++ L +  D       PK +R                           I
Sbjct: 398 EIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVDKFALI 457

Query: 393 QVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIRTA 441
            + F+IPY+  SG++V Y K+ EP+L YQS+PWVRY T + ++Y  + +
Sbjct: 458 AMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEYIYQVS 506

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  169 bits (428), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 123/439 (28%), Positives = 205/439 (46%), Gaps = 58/439 (13%)

Query: 48  PCLTHNGLQYMFIQHND---IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESI 104
           P LT     +  I+ +    ++++ ++RS + N   ++ FLYKL  +L  Y     EE +
Sbjct: 45  PILTLGSTTFHHIRSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKL 102

Query: 105 RDNFVIIYELLDEML-DYGIPQITETKMLKQYITQKSYKLIKSV-------KKSKNVVRP 156
            + F++ YE++D ML    +P  TE   L    ++ SY+L K++       K + N +  
Sbjct: 103 MEKFMVYYEMIDVMLTSNAMPINTE---LSSIASKISYRLPKTISNSPTNEKNNNNGLSI 159

Query: 157 PAQLTKS---------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEI 201
           P  LT++               + WRP GI YKKNE FL V E IN+L++    +L++ +
Sbjct: 160 PKFLTRNSRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYV 219

Query: 202 LGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXX-------------XXXXXXXXXXIEL 248
            G + + S LSG P  + GLND    T                              +++
Sbjct: 220 DGSIDLVSHLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKI 279

Query: 249 EDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEI 308
           ED  FHQCV L KF +E++I+F+PPDG F+LM Y +   +        ++ + S      
Sbjct: 280 EDCTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSS----- 334

Query: 309 HCRAKAQIKKKS------TANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKT 362
            C  + +I  KS      +A +  + IP+P      K   S G   +    +  +W+   
Sbjct: 335 RCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNK 394

Query: 363 FNGGKEYSFAAQLGLPSMTDVEVPK--AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQY 420
           + G  E     +    S TD+   +   + P+ + F+I  F+ SG+ V+YLKV E   +Y
Sbjct: 395 YKGLTENELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKY 454

Query: 421 QSYPWVRYITQSGDDYTIR 439
           +   W++Y+++SG  Y IR
Sbjct: 455 RPVKWIKYVSKSG-SYEIR 472

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  163 bits (412), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 137/527 (25%), Positives = 230/527 (43%), Gaps = 119/527 (22%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M SC++  D   +++  R  +    PS +E     +   ++      P L +    Y+FI
Sbjct: 1   MISCLFILDEELQLLTVRLLKP--VPSLLEPLEWFIRHPKKS-----PILQNMDYDYIFI 53

Query: 61  QHNDIYVLTMSRSLS-INVAQVFSFLYKLVEVLAEYL-KTVEEESIRDNFVIIYELLDEM 118
           Q + +Y L++S  L+ +    VFS+L +L  +  +YL + + +  I  NF +I+EL+DE 
Sbjct: 54  QRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDES 113

Query: 119 LDYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQL------------------ 160
           +  G PQ+T+  +++ YI       ++ VK S       A +                  
Sbjct: 114 IFMGTPQLTDYNIIRDYIK------VQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDT 167

Query: 161 ----------------TKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSE-ILG 203
                           T ++SWRP+GI Y KNE +LDV E +  L+      ++S  + G
Sbjct: 168 EATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYG 227

Query: 204 KVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE 263
            ++ RS LSGMP L +GLN                         +    FHQCV L +  
Sbjct: 228 YIQCRSYLSGMPMLTIGLN----------------KLNSENEYFMRRANFHQCVNLDQLT 271

Query: 264 NEKIISFIPPDGDFDLMNYRLST-----PIKPLIWCDAKIQVHSQ----SRIEIHCRAKA 314
            +K+ISF PPDG+F L NY+L+      P+  L  C  K++         R+ +      
Sbjct: 272 TDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTIST 331

Query: 315 QIKKKSTANNVEILIPVPE-----DAD---SPKFRYSHGSLKYVPEKSAILWRIKTFNGG 366
             K + + + + I +P+ +     D D    P+F+   G + +      +LW +    GG
Sbjct: 332 YFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGG 391

Query: 367 ---KEYSFAAQLGLPS----------MTDVEVPKAKRP---------------------- 391
              K     ++  L +          +++   PK  R                       
Sbjct: 392 HGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAA 451

Query: 392 -IQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
            ++V+F+IPY+T SG++V +LK+ E +LQ+QS+PWVRY T + D Y 
Sbjct: 452 LLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYA 498

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  159 bits (403), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 140/546 (25%), Positives = 230/546 (42%), Gaps = 135/546 (24%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+SCI+  D   + ++S+  +       I R    +   E +     P ++ +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDIYVLTM--SRSLSINVAQVFSFLYKLVEVLAEYL--KTVEEESIRDNFVIIYELLD 116
           + + +  +++  +   S NV  + +FL +   +L +YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EMLDYGIPQITETKMLKQYITQKS-----------------------------------Y 141
           E +D+G+ QIT+  +++ YI  K                                    Y
Sbjct: 116 ESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNLY 175

Query: 142 KLIKSVKKSKNVVRPPAQLTKS------------------VSWRPEGITYKKNEAFLDVT 183
           K ++  K   +         K                   VSWR +GI Y +NE FLDV 
Sbjct: 176 KFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVV 235

Query: 184 ESINMLIT-ASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXX 242
           E +  L+   SG + ++ I GK+  +S LSGMP LK+  N                    
Sbjct: 236 EQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN----------------KLSQ 279

Query: 243 XXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRL-----STPIKPLIWCDAK 297
                +   +FHQCV      NEK I FIPPDGDF L  Y L       P+  L+    K
Sbjct: 280 KDEQFISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVSFGVK 338

Query: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE-------DADSP-KFRYSHGSLKY 349
            ++  + +I++ C  +   K +++ + + + IP+         D   P +F+   G + +
Sbjct: 339 PKL-KKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLF 397

Query: 350 VPEKSAILWRIKTFNGGK---EYSFAAQLGL-------------------PSMTDVEVPK 387
                 +LW I+   GG    + S AA+  L                   P + D   PK
Sbjct: 398 NISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRD--GPK 455

Query: 388 -----------------AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYIT 430
                            A R + +KF+IPY T SG+QV YLK+ E +LQYQS+PWVRY T
Sbjct: 456 LEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRYKT 515

Query: 431 QSGDDY 436
            + ++Y
Sbjct: 516 VNDEEY 521

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  151 bits (382), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/480 (23%), Positives = 225/480 (46%), Gaps = 48/480 (10%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M + +      G++I+S+ ++  +  S  + F   ++ +     V  P LT     + ++
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLD---VRSPILTLGSTTFHYV 57

Query: 61  Q--HNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEM 118
           +     ++V+++SR+ + N A  + FLYK   +LA Y +   EE +++ F++ +ELLD M
Sbjct: 58  RTPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTM 115

Query: 119 LDYG-IPQITETKML--------------------KQYITQKSYKLIKSVKKSKNVVRPP 157
           ++ G IP  T+   +                    +Q  T  +     +  +  +    P
Sbjct: 116 VEGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNP 175

Query: 158 AQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDL 217
             ++       +G   K+NE  + V ESI++L++  G +L++ + G + + ++L G    
Sbjct: 176 GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVC 235

Query: 218 KLGLNDK------------GIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENE 265
           + GLND              + +                 + L D +FHQCV L +F+ +
Sbjct: 236 QFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRD 295

Query: 266 KIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNV 325
           +II F PP+G  +LM Y +   +       + +   + +  +     K+    K +A NV
Sbjct: 296 RIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKNV 355

Query: 326 EILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPS--MTDV 383
            + IPVP      K   S+G+ K++PE++A++W+   +NG  E   +A + +P+   T +
Sbjct: 356 TMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRDTTQL 414

Query: 384 EVPKAKR-PIQVKFQIPYFTTSGIQVRYLKV---HEPKLQYQSYPWVRYITQSGDDYTIR 439
            + +  R PI + F+I  ++ +G+ VRY  V   H    ++++  W++Y++ SG  Y +R
Sbjct: 415 ALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSG-SYEVR 473

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  136 bits (343), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 117/462 (25%), Positives = 223/462 (48%), Gaps = 69/462 (14%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M S I      G++I+S+ YR+++  S  E F    ++     +V  P LT     +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFR---IQVINNFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYE 113
           +        ++++++ ++R+ + N A ++ FL KL  +L +Y  T  E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 114 LLDEML-DYGIPQITETKMLKQYITQKSYKLIKSVK----------KSKNVV--RPPAQL 160
           +LD ML   GI Q T+   LK  + + S K I              K +N +   P A  
Sbjct: 116 ILDNMLLGTGIIQNTD---LKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANF 172

Query: 161 TKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLG 220
           +   + R +   +KKNE F  V ES+N+L++  G +L++ + GK++++S L+G P  +  
Sbjct: 173 SLIPTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFE 230

Query: 221 LNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLM 280
           L D                       ++ D +F QC+   +    + +     DG+ +++
Sbjct: 231 LVDD--------------------QTKITDFKFDQCIEKVQ---SRTVRVAATDGELEIV 267

Query: 281 NY-----RLSTPIK--PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333
           NY     +++ P K  P++   + ++     RI +    K+   K  +A +V + IPVP 
Sbjct: 268 NYHVRDDKINIPFKITPIV---STVKDTVDYRISL----KSLFPKNLSATDVVLTIPVPP 320

Query: 334 DADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRP-I 392
           +    K   S+G  K+  E++A++W    FNG  E + +A         + +    RP I
Sbjct: 321 NTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPSI 380

Query: 393 QVKFQIPYFTTSGIQVRYLKVHE-PKLQYQSYPWVRYITQSG 433
           Q+ F+I  ++ SG+ +R L + +  K +Y++  W++YI+++G
Sbjct: 381 QLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  136 bits (342), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 157/368 (42%), Gaps = 115/368 (31%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLIT-ASGQVLRSEILGKVKVRSRLSGMPDLKLGL- 221
           VSWR +GI Y KNE FLDV E +  L+   SG V RS I G++  RS LSGMP LK+ L 
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 222 ----NDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFEN------------- 264
               NDK   +                      +QFHQCV L   E              
Sbjct: 309 KLLQNDKQFISQ---------------------VQFHQCVSLDSIEKVIKYAEEHSDELK 347

Query: 265 ---------EKIISFIPPDGDFDLMNYRLSTPIK--PLI-WCDAKIQVH-SQSRIEIHCR 311
                    E  I FIPPDGDF L +Y L   I+  P++  C  +I     + +++I   
Sbjct: 348 TLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAA 407

Query: 312 AKAQIKKKSTANNVEILIPVPE-------DADSP-KFRYSHGSLKYVPEKSAILWRIKTF 363
            +   K  ++ + +++ IP+ +       D   P KF+ S+G + Y      +LW I   
Sbjct: 408 VETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVI 467

Query: 364 NGGKEY-------------SFAAQLGL-------------------------PSMTDV-- 383
            GGK +             + AA+ GL                         P + D+  
Sbjct: 468 KGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYK 527

Query: 384 -------------EVPKAK-RPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYI 429
                        + PK     + + F+IPY T SG++V YLK+ E +LQYQS+PWVRY 
Sbjct: 528 ETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRYK 587

Query: 430 TQSGDDYT 437
           T + D+Y 
Sbjct: 588 TINDDEYA 595

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 73/141 (51%), Gaps = 10/141 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
           M+S IY  D T + ++S+  +    P+  E          Q  +   P +     ++++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG--LPNVNELGDLFRYHVRQSQN---PIIDVYNWRFVYI 55

Query: 61  QHNDIYVLTMSRSLSINVAQ---VFSFLYKLVEVLAEYL--KTVEEESIRDNFVIIYELL 115
           + + +Y + +  +    +A    + ++L +L ++  +Y+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMLDYGIPQITETKMLKQYI 136
           DE LDYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 148/333 (44%), Gaps = 75/333 (22%)

Query: 163 SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGL 221
           SVSWR +GI Y KNE FLDV E +   +  S  +++  ++ G++  +S LSGMP LK+ L
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMN 281
           N K I+                    L   +FHQCV     +  K++ F+PPDGDF L  
Sbjct: 282 N-KIIYQDKQF---------------LSSCKFHQCVMPDSVDEGKVLEFVPPDGDFVLCK 325

Query: 282 YRL-----STPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPV----- 331
           Y L       P+  LI  + K ++  + ++++    ++  KK ++   + I IP+     
Sbjct: 326 YELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKIPLKVLLE 384

Query: 332 PEDAD---SPKFRYSHGSLKYVPEKSAILWRIKTFNGGK-EYSFAAQLGLPSMTDV---- 383
             D D   + K R   G + +      +LW I    GG  +    A   L +  +     
Sbjct: 385 KYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEEYLRQQ 444

Query: 384 -EVPKAKRP--------------------------------------IQVKFQIPYFTTS 404
            E+  +  P                                      I++ F+IPY T+S
Sbjct: 445 EELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEIPYNTSS 504

Query: 405 GIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
           G++V YLK+ EP LQYQ++PWVRY T S D Y 
Sbjct: 505 GLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 1   MASCIYFCDNTGKVILSRRYRD----DVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQ 56
           M+S +Y  +   + +LS+  +     D+P S       L  +   +  V  P + +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLS-------LFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YMFIQHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEY--LKTVEEESIRDNFVIIYEL 114
           +  IQ + +Y ++ S     N+ +   +L +   +L  Y  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEMLDYGIPQITETKMLKQYI 136
           ++E +D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  130 bits (327), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 151/335 (45%), Gaps = 73/335 (21%)

Query: 161 TKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKL 219
           T  VSWR +GI Y KNE FLDV E +  L     +V+R  ++ GK+  +S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDL 279
            LN                         +   +FHQCV L    NEK + FIPPDG+F L
Sbjct: 293 ALN----------------KLLQRDAQFMSHSKFHQCVALETL-NEKELEFIPPDGEFIL 335

Query: 280 MNYRL-----STPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE- 333
             Y L      TPI  +   + K Q+  + ++ I    +   K +++ + + + IP+ + 
Sbjct: 336 CEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNVKIPLAKL 394

Query: 334 ------DADSP-KFRYSHGSLKYVPEKSAILWRIKTFNGGK---EYSFAAQLGL------ 377
                 D   P +F+ + G + +      +LW I    GG    ++S  A+  L      
Sbjct: 395 FADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFNKEEF 454

Query: 378 -------------------PSMTDV--EVPKAKRP-----------IQVKFQIPYFTTSG 405
                              P + ++  +    K P           + + F+IPY T SG
Sbjct: 455 EREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPYTTCSG 514

Query: 406 IQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIRT 440
           ++V YLK+ E +LQYQS+PWVRY T S ++Y   T
Sbjct: 515 LKVEYLKIEEEQLQYQSFPWVRYKTISDEEYAYLT 549

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 64/144 (44%), Gaps = 17/144 (11%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPAL--LLEAEQE--SSVVPPCLTHNGLQ 56
           M+SC+Y  D   + ++S+          I+  P L  L+E  QE  SS  PP + +    
Sbjct: 1   MSSCLYILDENLEPLISKN---------IKSIPNLNTLVEVFQEVYSSNAPPIVFNRNWY 51

Query: 57  YMFIQHNDIYVLTMSRSL--SINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYEL 114
           ++  + + +  L+       S N   +  ++ +   +L +YL   + +       ++  L
Sbjct: 52  FIHTKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVL 111

Query: 115 LDEML--DYGIPQITETKMLKQYI 136
                  ++G+PQ+TE  ++K YI
Sbjct: 112 ELLEESSEFGVPQMTEPSVMKDYI 135

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  128 bits (321), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 152/338 (44%), Gaps = 62/338 (18%)

Query: 161 TKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKL 219
           T +VSWR +GI Y KNE FLDV ES+  L+    +V+R  ++ G++K +S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GLN-----DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPD 274
            LN     DK                     +E +DL+    +    F N+K I FIPPD
Sbjct: 282 ALNKILQDDKQFLGHAKFHQCVSLNSINIKDLE-KDLEGPNDISNKNFVNKKEIEFIPPD 340

Query: 275 GDFDLMNYRL-----STPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILI 329
           G+F L  Y L       P+  +   D K     + R++I  + +   K++++ + + I I
Sbjct: 341 GEFVLCQYELRRHVKDPPVINMTSFDIKPNF-KKFRVQISLKIETHFKRQNSTSLMTIKI 399

Query: 330 PVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGG--------------- 366
           P+         + +  P+F+   G + +   +  ++W I    GG               
Sbjct: 400 PLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAEFFLF 459

Query: 367 --KEYSFAAQLGLPSMT---------------------DVEVPKAKRPIQ---VKFQIPY 400
             +EY    +    SM                      D E    K   Q   ++F+IPY
Sbjct: 460 NQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKTQYVFMQFEIPY 519

Query: 401 FTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTI 438
            T SG++V YLK+ E  L+YQS+PWVRY T + D+Y  
Sbjct: 520 STCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 75/148 (50%), Gaps = 18/148 (12%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVP----PSAIERFPALLLEAEQESSVVPPCLTHNGLQ 56
           M+SC++  D   + ++S+  +   P    P  I+ F       E  +   PP +T +   
Sbjct: 1   MSSCLFILDELLEPLISKNTK---PVRNLPDIIKSF------KESWTPTSPPIITVSNWH 51

Query: 57  YMFIQHNDIYVLTMSRSLS---INVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVII 111
           Y++++ + ++ +     +    +N+  +  +L +L  +L  Y K   + +  I DN +++
Sbjct: 52  YVYVKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLV 111

Query: 112 YELLDEMLDYGIPQITETKMLKQYITQK 139
            EL+DE +D+GI Q+T+  +++ YI  K
Sbjct: 112 TELMDESIDFGIIQMTDPSIIRDYIRVK 139

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  125 bits (313), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 101/353 (28%), Positives = 158/353 (44%), Gaps = 96/353 (27%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +   +     V+R  ++ G++  RS LSGMP LK+ +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRL---------------SKFENEKI 267
              I                     L +++FHQCV L                K +NE+ 
Sbjct: 310 --KILKQDVQF--------------LSNVKFHQCVSLDSIRARSNPPAVEEDGKKKNEEA 353

Query: 268 --------ISFIPPDGDFDLMNYRLSTPIK--PLIWC-DAKI--QVHSQSRIEIHCRAKA 314
                   I FIPPDG+F L  Y L   +K  P+I   + +I  ++H + +I+IH   + 
Sbjct: 354 DTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIHVIIET 412

Query: 315 QIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGG 366
             K  ++ + + + IP+         + +  PKF+   G++ +      +LW + T NGG
Sbjct: 413 HFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMNGG 472

Query: 367 ---KEYSFAAQLGL-------------------------PSMTDV-----------EVPK 387
                 S  A+  L                         P + ++           EV  
Sbjct: 473 HGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEVST 532

Query: 388 AKRP---IQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
            K+    + + F++PY T SG+++ YLK+ E +LQYQS+PWVRY T S D+Y 
Sbjct: 533 RKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 80/145 (55%), Gaps = 11/145 (7%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVP--PSAIERFPALLLEAEQESSVVP-PCLTHNGLQY 57
           M+S I+  D T + I+ +  R  +P  PS + +F  L     + + V P P L     Q+
Sbjct: 1   MSSSIFILDETLEPIICKNIRA-LPNLPSLVTKFQELY----RSNGVSPLPILNDIDWQF 55

Query: 58  MFIQHNDIYVLTMSRSLS-INVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVIIYEL 114
           + I+ + +  L++  + S  N+  VF++L +  ++L +YL    +    + DNF+++ EL
Sbjct: 56  LHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIEL 115

Query: 115 LDEMLDYGIPQITETKMLKQYITQK 139
           +DE LD+G+ Q T++ ++K Y+  K
Sbjct: 116 IDESLDFGVVQFTDSSLIKDYVRVK 140

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  122 bits (305), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/340 (27%), Positives = 158/340 (46%), Gaps = 83/340 (24%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLIT-ASGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
           VSWR +GI Y KNE FLDV E +  L+  ++G++ ++ I G++K +  LSGMP LK+ LN
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE------------NEKIISF 270
            K I                     + + +FHQCV ++  +            + K I F
Sbjct: 276 -KLIKNDEQF---------------ISNSKFHQCVSINSLKREINNEEEENTYHGKEIEF 319

Query: 271 IPPDGDFDLMNYRLSTPIK--PLIWCDAKIQVH---SQSRIEIHCRAKAQIKKKSTANNV 325
           IPPDG+F L  Y L   ++  P+I   + I++     + +I+IH   +   KK+++ + +
Sbjct: 320 IPPDGEFVLCKYELKRHVRDVPVIKL-SNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVL 378

Query: 326 EILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGG----------- 366
            I IP+         +    P+F+   G + +      ++W + +  GG           
Sbjct: 379 TIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAE 438

Query: 367 ------KEYSFAAQLGLPSMTD---VEVPK--------------------AKRPIQVKFQ 397
                 +EY    +    SM      E PK                    +++ + +KF+
Sbjct: 439 FFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFE 498

Query: 398 IPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
           +PY T SG++V YLK+ E ++ YQS+PWVRY T + D+Y 
Sbjct: 499 VPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  119 bits (297), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 153/357 (42%), Gaps = 99/357 (27%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +  L+     ++R  ++ G++  RS LSGMP LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE------------------- 263
              I                     + +  FHQCV L                       
Sbjct: 313 --KILNRDPQF--------------MSNSNFHQCVSLDSINTIEKGQEKEQNTGDSQAAA 356

Query: 264 NEKIISFIPPDGDFDLMNYRLSTPIK--PLIWC-DAKIQVH-SQSRIEIHCRAKAQIKKK 319
           + + I F+PPDG+F L  Y L   +K  P+I   D +I+    +S+I+I  + +   K  
Sbjct: 357 DAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQTNFKPT 416

Query: 320 STANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKE--- 368
           ++ + + + IP+         + +   +F+ ++G + +      +LW I+T  G +E   
Sbjct: 417 NSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGHRERNA 476

Query: 369 -------------YSFAAQLGL-------------------------PSMTDV------- 383
                         S  A+  L                         P + ++       
Sbjct: 477 SNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYNQVHDK 536

Query: 384 ---EVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
               V    R + + F+IPY T SG++V YLKV EP+LQYQS+PWVRY T + ++Y 
Sbjct: 537 HTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVNDEEYA 593

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 79/145 (54%), Gaps = 12/145 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQ-ESSVVPPCLTHNGLQYMF 59
           M+S ++  D   + ++S+  R      A+    ++L   +Q      PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDIYVLTMSRSL---SINVAQVFSFLYKLVEVLAEY--LKTVEEESIRDNFVIIYEL 114
           ++ + ++++++  +    +I++  + +FL +   +L +Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEMLDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 151/357 (42%), Gaps = 99/357 (27%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +  L+     ++R  ++ G++  R  LSGMP LK+ +N
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE------------------- 263
              I                     L +  FHQCV L   +                   
Sbjct: 320 --KILNRDAQF--------------LSNSSFHQCVSLDSIKTIEKREEKEDDDTGLQAAA 363

Query: 264 NEKIISFIPPDGDFDLMNYRLSTPIK--PLIWC-DAKIQVH-SQSRIEIHCRAKAQIKKK 319
           + K + F+PPDG+F L  Y L   +K  P+I   D +I+    + +I+I  + +   K  
Sbjct: 364 DAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKPT 423

Query: 320 STANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEY-- 369
           ++ + + + IP+         + +   +F+ + G + +      +LW I+   G +E+  
Sbjct: 424 NSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHNT 483

Query: 370 --------------SFAAQLGL-------------------------PSMTDV------- 383
                         S  A+  L                         P + ++       
Sbjct: 484 NKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHDQ 543

Query: 384 ---EVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
               V    + + + F+IPY T SG+++ YLKV EP+LQYQS+PWVRY T S D+Y 
Sbjct: 544 QIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 60/99 (60%), Gaps = 5/99 (5%)

Query: 46  VPPCLTHNGLQYMFIQHNDIYVLTMSRSL---SINVAQVFSFLYKLVEVLAEY--LKTVE 100
            PP L+ N   ++ ++ + ++ +++  +    +I++  + +FL +   +L EY  +K + 
Sbjct: 41  APPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLT 100

Query: 101 EESIRDNFVIIYELLDEMLDYGIPQITETKMLKQYITQK 139
           ++ I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 101 KDVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 149/362 (41%), Gaps = 108/362 (29%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +  L+     ++R  ++ G++  R  LSGMP LK+ +N
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE------------------N 264
                                    + + +FHQCV L                      +
Sbjct: 312 ----------------KLLNRDPQFMSNSKFHQCVSLDSINIIEEEGRDTDDAGSQTATD 355

Query: 265 EKIISFIPPDGDFDLMNYRLSTPIK--PLIWCDAKIQVHS------QSRIEIHCRAKAQI 316
            K I FIPPDG+F L  Y L   +K  P+I    K+Q         + +I+I  + +   
Sbjct: 356 TKEIEFIPPDGEFVLCQYELKRHVKDAPMI----KLQGFEIKPKLKKFKIQIITKIQTNF 411

Query: 317 KKKSTANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKE 368
           K  ++ + + + IP+         + +   +F+ + G + +      +LW I T  G +E
Sbjct: 412 KPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGHRE 471

Query: 369 ---------------YSFAAQLGL-------------------------PSMTDV----- 383
                           S  A+  L                         P + ++     
Sbjct: 472 RNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEELYKQVH 531

Query: 384 --------EVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDD 435
                   +V    + + V F+IPY T SG++V YLKV EP+LQYQS+PWVRY T S D+
Sbjct: 532 EERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTISDDE 591

Query: 436 YT 437
           Y 
Sbjct: 592 YA 593

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 78/145 (53%), Gaps = 12/145 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQ-ESSVVPPCLTHNGLQYMF 59
           M+S ++  D   + ++S+  R      AI    ++L   +Q      PP L+ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDIYVLTMSRSL---SINVAQVFSFLYKLVEVLAEY--LKTVEEESIRDNFVIIYEL 114
           ++ + ++ +++  +    +I++  + +FL +   +L +Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMLDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  110 bits (274), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/353 (24%), Positives = 151/353 (42%), Gaps = 106/353 (30%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FL+V E +   +  +  V++  ++ G+++ +  LSGMP+LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 -----DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE--NEKIISFIPPDG 275
                DK                       L + +FHQCV L+  E  + K + F+PPDG
Sbjct: 313 KIVNEDKQF---------------------LANCKFHQCVSLASLESSDHKDVEFVPPDG 351

Query: 276 DFDLMNYRL-----STPIKPLIWCDAK-----IQVHSQSRIEIHCRAKAQIKKKSTANNV 325
           +F L  Y L       P+  L+  + K      ++     IE H       K  +  + +
Sbjct: 352 EFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETH------FKTTNATSKL 405

Query: 326 EILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGK---EYSFAAQ 374
            + +P+         + + + K +   G++ +      +LW + + +GG    + S   +
Sbjct: 406 ALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVE 465

Query: 375 LGL-------------------------PSMTDV--------------EVPKAKRPIQ-- 393
             L                         P + ++                P A+  +Q  
Sbjct: 466 FALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPR 525

Query: 394 ---------VKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
                    + F++PY T+SG++V YLK+ EP+L+YQS+PWVRY T S  +Y 
Sbjct: 526 TREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 14/145 (9%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSA---IERFPALLLEAEQESSVVPPCLT-HNGLQ 56
           M+S +Y  D   + ++S+  +    PS    I +F  L        S  PP +  H+   
Sbjct: 1   MSSVLYILDENLETLISKNIK--AVPSLEYPIAQFKKLY------GSNAPPVIDYHDLFT 52

Query: 57  YMFIQHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYL--KTVEEESIRDNFVIIYEL 114
           + +IQ + +  +++   +   + +   +L    EVL  YL  K +++  + DN V+I EL
Sbjct: 53  FTYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISEL 112

Query: 115 LDEMLDYGIPQITETKMLKQYITQK 139
           ++E +D+G  Q+T++ +L  YI  K
Sbjct: 113 IEETIDFGAIQVTDSGLLADYIKMK 137

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 150/361 (41%), Gaps = 103/361 (28%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +  L+     V+R  ++ G++  R  LSGMP LK+ +N
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE------------------- 263
              I                     + +  FHQCV L                       
Sbjct: 318 --KILNRDPQF--------------MSNSSFHQCVSLDSINTIEKDEEKNSDDDAGLQAA 361

Query: 264 -NEKIISFIPPDGDFDLMNYRLSTPIK--PLIWC-DAKIQVH-SQSRIEIHCRAKAQIKK 318
            + + I FIPPDG+F L  Y L   +K  P++   D +I+    + +I+I  + +   K 
Sbjct: 362 TDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQTNFKP 421

Query: 319 KSTANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTF------- 363
            ++ + + + IP+         + +   +F+ + G + +      +LW I+T        
Sbjct: 422 TNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREHS 481

Query: 364 -NGGKEY-----------SFAAQLGL-------------------------PSMTDV--- 383
            N   +Y           S  A+  L                         P + ++   
Sbjct: 482 TNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQ 541

Query: 384 -------EVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDY 436
                   V    + + + F+IPY T SG++V YLKV EP+LQYQS+PWVRY T S ++Y
Sbjct: 542 VHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDEEY 601

Query: 437 T 437
            
Sbjct: 602 A 602

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 78/145 (53%), Gaps = 12/145 (8%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQ-ESSVVPPCLTHNGLQYMF 59
           M+S ++  D   + ++S+  R      A+    ++L   +Q      PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDIYVLTMSRSL---SINVAQVFSFLYKLVEVLAEY--LKTVEEESIRDNFVIIYEL 114
           ++ + ++ +++  +    +I++  + +FL +   +L +Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEMLDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 104/217 (47%), Gaps = 32/217 (14%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E    ++     ++R  ++ GK+  R  LSGMP LK+ LN
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNY 282
                                    L  L+FHQCV L   +N K I FIPPDG+F L  Y
Sbjct: 347 ----------------KLLQKDQQFLSQLRFHQCVSLETIQN-KEIEFIPPDGEFILCEY 389

Query: 283 RLSTPIKP-----LIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD- 336
            L   +K      LI  + K ++  + +I+I+       K +++ + + + IP+ +  + 
Sbjct: 390 ELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLKIPLEKLFND 448

Query: 337 -------SPKFRYSHGSLKYVPEKSAILWRIKTFNGG 366
                  SP+F+ + G +K+      +LW I +  GG
Sbjct: 449 YKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGG 485

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 15/80 (18%)

Query: 372 AAQLGLPSMTDV---------EVPKAK----RP--IQVKFQIPYFTTSGIQVRYLKVHEP 416
            A +  P+ T V         E+P  K    +P  + V F+IPY+  SG++V YLK+ E 
Sbjct: 574 GANIATPASTSVVKNDTSSNKEIPLKKALSNKPQYLTVDFEIPYYACSGLKVEYLKIEEE 633

Query: 417 KLQYQSYPWVRYITQSGDDY 436
           +L YQS+PWVRY T +  DY
Sbjct: 634 QLLYQSFPWVRYKTTNDKDY 653

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 74/151 (49%), Gaps = 23/151 (15%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPA---LLLEAEQESSVVPPCLTHNGLQY 57
           M SCI+  D   + ++S+  R      AI  F +   L  +    ++   P ++ N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  MFIQHNDIYVLT-------MSRSLSINVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNF 108
           + I+ + +  L        MS  +S+++     +L K   +L  +LKT  +    I DN 
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSI-----YLDKFYYLLKMHLKTDTLNRNIILDNI 109

Query: 109 VIIYELLDEMLDYGIPQITETKMLKQYITQK 139
           ++I EL+DE +D+GI Q+T+  ++K Y+  K
Sbjct: 110 LLIMELIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 100/242 (41%), Gaps = 56/242 (23%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV E +   +     ++R  ++ G++  +  LSGMP LK+ +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKF-----------------ENE 265
                                    L +  FHQCV L                    ENE
Sbjct: 355 ----------------KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENE 398

Query: 266 --------KIISFIPPDGDFDLMNYRL-----STPIKPLIWCDAKIQVHSQSRIEIHCRA 312
                   K I FIPPDGDF L  Y L       P+  L   D K ++ S+ +++IH   
Sbjct: 399 NHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIHVII 457

Query: 313 KAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSLKYVPEKSAILWRIKTFN 364
           +   K  +  + + + IP+         + +   KF+   G + +    + ++W I +  
Sbjct: 458 ETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMK 517

Query: 365 GG 366
           GG
Sbjct: 518 GG 519

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (82%)

Query: 392 IQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYT 437
           +++ F+IPY+T SG+++ YLK+ EP+LQYQS+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 83/168 (49%), Gaps = 34/168 (20%)

Query: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALL------------LEAEQESSVVPP 48
           M+SCI+  D   + IL++  R     S    F  LL            +    +S V+P 
Sbjct: 1   MSSCIFILDENLEPILNKNIR-----SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPI 55

Query: 49  CLTHN--------------GLQYMFIQHNDIYVLTMSRSLSIN-VAQVFSFLYKLVEVLA 93
             T++              G Q++ I+ + +  +++  + S+N +  +FS+L +  ++L 
Sbjct: 56  LNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLK 115

Query: 94  EYLKT--VEEESIRDNFVIIYELLDEMLDYGIPQITETKMLKQYITQK 139
            YL    +++  + DNF+++ ELLDE LD+GI Q T++ ++K YI  K
Sbjct: 116 SYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 110/264 (41%), Gaps = 57/264 (21%)

Query: 53  NGLQYMFIQHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYL--KTVEEESIRDNFVI 110
           +GL+Y  +Q  +I         + N  + F FL  +  +L +Y     ++   I  N+  
Sbjct: 72  DGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEMLDYGIPQITETKMLKQYITQKS--YKLIKSVKKS--KNVVRPP--------- 157
           +  L + M+D G P IT+   LK+ +  K+   ++I S   S  K +             
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 158 -----------AQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQV-----LRSEI 201
                      A   ++V WR  G+ Y  NE ++D+ E++N+++  +        +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 LGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSK 261
            G+V  +  LS  P ++L LN  G                     +L    FH+CVR   
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG--------------------HDLGIPAFHRCVRTEG 286

Query: 262 FE-NEKIISFIPPDGDFDLMNYRL 284
            + +   + FIPPDGDF LM Y +
Sbjct: 287 SDFHPGTLRFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 93/223 (41%), Gaps = 43/223 (19%)

Query: 84  FLYKLVEVLAEYL--KTVEEESIRDNFVIIYELLDEMLDYGIPQITETKMLKQYI----- 136
           FL +  +VL EY   + +  + + +N   +  LL  MLD G   +T++  L+Q +     
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 137 -----TQKSYKLIKSVK--KSKNVVRPPAQLTK-----SVSWRPEGITYKKNEAFLDVTE 184
                   +  L  +VK   SK +   P    K     +V WR     Y  NE ++D+ E
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMLITASGQVL---RSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXX 241
           ++N  +   G  L      + GK+ V+  LSG P ++L L   G                
Sbjct: 161 TVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKLRTSG---------------- 204

Query: 242 XXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRL 284
                 L++   H+CV L +      ++F+PPDG F L  Y +
Sbjct: 205 ----HPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 81/197 (41%), Gaps = 43/197 (21%)

Query: 111 IYELLDEMLDYGIPQITETKMLKQYITQKS--YKLIKSVKKSK-------------NVVR 155
           I  LL+ M+D   P +T+   L+  +  +    K+I S   S              N+  
Sbjct: 115 IALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGD 174

Query: 156 P---PAQLTKSVSWRPEGITYKKNEAFLDVTESINMLI-----TASGQVLRSEILGKVKV 207
           P   PA   K V WR  G+ Y  NE ++DV E++++++     T     +R  + G V  
Sbjct: 175 PAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDF 234

Query: 208 RSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKI 267
           RS LSG P + L L  +G                     +L     HQC   S       
Sbjct: 235 RSHLSGNPVIALNLRLRG--------------------HDLGMPALHQCCLDSYQGRPDQ 274

Query: 268 ISFIPPDGDFDLMNYRL 284
           + F+PPDG F LM+Y +
Sbjct: 275 LRFVPPDGKFQLMHYSI 291

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 64/142 (45%), Gaps = 42/142 (29%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASGQVLR----------SEILGKVKVRSRLSG 213
           V WR  G+ Y  NE ++D+TESI+++   +G+  R            I G+  V+  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGL--NDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKI-- 267
            P  DL+L L  ND G+                          FH+CV L   +N     
Sbjct: 271 NPTVDLQLDLAGNDLGV------------------------PAFHECVELDNHQNPSNCD 306

Query: 268 ISFIPPDGDFDLMNYR--LSTP 287
           + FIPPDG F+LM Y   L TP
Sbjct: 307 LRFIPPDGRFNLMQYSIDLDTP 328

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 69/139 (49%), Gaps = 36/139 (25%)

Query: 163 SVSWRPEGITYKKNEAFLDVTESINMLI----------TASGQVLRSEILGKVKVRSRLS 212
           +V WR   + +  NE +LD+ ESI++++           ++ +++   I+GK  V+S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRL------SKFENEK 266
           G P +++ ++  G                     +LE +  H+CV+        +FEN K
Sbjct: 261 GNPIVEMKIDMAGN--------------------DLESIFLHECVKSKDVDKDQEFENTK 300

Query: 267 IISFIPPDGDFDLMNYRLS 285
           +I F+PPDG F L +Y ++
Sbjct: 301 LIKFLPPDGSFKLFDYNIN 319

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 93/390 (23%), Positives = 156/390 (40%), Gaps = 68/390 (17%)

Query: 91  VLAEYLK--TVEEESIRDNFVIIYELLDEMLDYGIPQITETKM--LKQYITQKS--YKLI 144
           +L EY     +    I +N+  +  L D ++D GI       M  L+  I  K+     I
Sbjct: 92  LLVEYFNKTNLTTTKIMNNYDRMTILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFI 151

Query: 145 KSVKKSKNVVRPPAQLTKS--VSWRPEGITYKKNEAFLDVTESINMLITASG------QV 196
               KS    + P++   +  V WR + I   +NE ++DV E++ + +  S       ++
Sbjct: 152 NDAAKSLQKGQAPSKTVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKL 211

Query: 197 LRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDL--QFH 254
           L   I G V V S + G+P L++                           + +D+  +FH
Sbjct: 212 LNGYINGSVSVDSSIGGVPMLEVSFGG----------------------CDFKDIIPKFH 249

Query: 255 QCVRLSKF--ENEKIISFIPPDGDFDLMNYR--LSTPIKPLIWCDAKIQV-HSQSRIEIH 309
            CV +++F   +  II FIPPDG F LM Y   LS+    LI C+    + +S    EI 
Sbjct: 250 DCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEIT 309

Query: 310 CRAKAQIKKKSTANNVEILIPVPEDADSPK---FRYSHGSLKYVPEKSAILWRIKTFNGG 366
                   K    NN+++ +         K    R +HG  +Y   K+  ++  +   G 
Sbjct: 310 LNINKS-NKVPKINNLQVCLNFENREGQSKVKILRNTHGRFEY--GKNTWIFDSELLTGT 366

Query: 367 --------KEYSFAAQLGLPSMTDVEVPKAKRP--------IQVKFQIPYFT-TSGIQVR 409
                   +E +   + G        +    RP         Q + Q+P  T  S I +R
Sbjct: 367 LPVLRGCVEEETKNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIR 426

Query: 410 YLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439
                 P+ Q Q +  V+Y+T++  +Y IR
Sbjct: 427 NDSTSNPQRQ-QLFKGVKYVTKTS-NYEIR 454

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 36/148 (24%)

Query: 163 SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMP--DLKLG 220
            V WR  GI Y  NE F+D++E IN ++   G++L   I G + + + LSG P  ++KLG
Sbjct: 209 GVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKLG 267

Query: 221 LNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE--NEKI------ISFIP 272
           L D                      +   +  FH+C+   K    N+ I      ++F+P
Sbjct: 268 LLDH--------------------KLSHLNTTFHRCILEDKANSINDLIAGKFTKLTFVP 307

Query: 273 PDGDFDLMNYRLSTPIKPLIWCDAKIQV 300
           PDG   L  Y L     PL+  D+ + +
Sbjct: 308 PDGRTRLCQYTL-----PLVKRDSNLGI 330

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 83/194 (42%), Gaps = 43/194 (22%)

Query: 114 LLDEMLDYGIPQITETKMLKQYITQKS--YKLIKSVKKS-KNVV--RPPAQL-------- 160
           L+  M+D   P I E   L++ +  +    K+I S   S  N +  R  +Q+        
Sbjct: 118 LISCMVDANEPAIMELNQLQEMVPSRGDLSKVINSTASSLSNRISQRDASQMFRISDLTG 177

Query: 161 -----TKSVSWRPEGITYKKNEAFLDVTESINMLI---TASGQV--LRSEILGKVKVRSR 210
                 K V WR  G+ Y  NE ++DV E+I++++     SGQ+  +R  I G V  RS 
Sbjct: 178 SLGTKDKLVPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSH 237

Query: 211 LSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISF 270
           L+G P + L LN  G                     +L     H C +     + + + F
Sbjct: 238 LTGNPVVALKLNLHG--------------------HDLGVPALHPCCQAQYTGSPENLQF 277

Query: 271 IPPDGDFDLMNYRL 284
           +PPDG F LM Y +
Sbjct: 278 VPPDGKFRLMQYTI 291

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 102/235 (43%), Gaps = 44/235 (18%)

Query: 79  AQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVIIYELLDEMLDYGIPQIT--ETKMLKQ 134
              F+FL  L + L EY     +    I +N+  I  +    +D G P +    +  +++
Sbjct: 89  TDTFTFLQLLDQTLLEYFDKDKLTVTKIVNNYDRITMIFYMSIDSGEPCVGSLNSNRIRR 148

Query: 135 YITQKS--YKLIKSVKKS-KNVVRPPAQ-----------LTKSVSWRPEGITYKKNEAFL 180
            I  KS   K+I +   + +  VR P Q             + V WR   + Y  +E ++
Sbjct: 149 VIPVKSDLSKMINNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYV 208

Query: 181 DVTESINMLI-----TASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXX 235
           D+ E+++++        S Q++   I G+V V+S LSG P +++ ++  G          
Sbjct: 209 DIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMDLAGN--------- 259

Query: 236 XXXXXXXXXXIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKP 290
                      E+     HQCV + +  +   + FIPPDG+ +L+NY +   + P
Sbjct: 260 -----------EMYAPSMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNP 302

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 63/146 (43%), Gaps = 26/146 (17%)

Query: 161 TKSVSWRPEGITYKKNEAFLDVTESINMLI------------------TASGQVLRSEIL 202
            K V WR   + Y  NE ++DV E I+++                    +  +++R++I+
Sbjct: 253 NKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADII 312

Query: 203 GKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLS-- 260
           G++ VRS LS  P +++ L D+                     + +    FH CV +   
Sbjct: 313 GELNVRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLFKQLNLGLPM----FHDCVEIDYE 368

Query: 261 KFENEKI--ISFIPPDGDFDLMNYRL 284
           K  N+    I FIPPDG F LM Y +
Sbjct: 369 KGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 65/140 (46%), Gaps = 40/140 (28%)

Query: 166 WRPEGITYKKNEAFLDVTESINML----ITASGQVLRSE----------ILGKVKVRSRL 211
           WR + + +  NE ++D+ ES++++    I  S ++ RS+          + G   V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKF----ENEKI 267
           +G P ++L L   G                     ++    FH+CV + ++    +N  I
Sbjct: 263 NGNPLVELQLELSGN--------------------DIGHPSFHECVDIDEYLKNIDNSSI 302

Query: 268 IS--FIPPDGDFDLMNYRLS 285
            S  FIPPDG F LM+Y ++
Sbjct: 303 SSLKFIPPDGKFTLMDYTIT 322

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 93/476 (19%), Positives = 168/476 (35%), Gaps = 110/476 (23%)

Query: 33  PALLLEAEQESSVVPPCLTHNGLQYMFIQHN-DIYVLTMSRSLSINVAQVFSFLYKLVEV 91
           P LLL  E +S  +         +Y  + +N + Y LT   S+ ++      FL  L E+
Sbjct: 39  PELLLANEMKSRSLGGGSAIMVCKYRSVVNNMNYYCLTSDDSVEVDC-----FLEYLDEL 93

Query: 92  LAEYLKTVEEESIR---DNFVIIYELLDEMLDYG---------------IPQITETKMLK 133
           + EY    +E S++   +NF  +  LL  +++ G               +P + +   L+
Sbjct: 94  ILEYFDK-DEVSVKKLVNNFDRLSLLLHSVVNGGEINVGFLYNNRIQNVVPPVHD---LR 149

Query: 134 QYITQKSYKLIKSVKKSKNVVRPPAQLTKSVS---------WRPEGITYKKNEAFLDVTE 184
           + + + ++ ++     +            S S         WR  GI   K E ++D+ E
Sbjct: 150 KILNETAHTIMNQSSGAMRSAGSGVAFNASSSSRGEDMVVPWRRNGIKDAKEELYVDLKE 209

Query: 185 SINMLITASG---------------QVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX 229
            + +    S                +++   I G + VR  L+G P + L  +  G    
Sbjct: 210 EVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNPTVSLMFDTMGN--- 266

Query: 230 XXXXXXXXXXXXXXXXIELEDLQFHQCVRLS-------------KFENEKIISFIPPDGD 276
                            +L    FH CV                 F+ ++++ F+PPDG 
Sbjct: 267 -----------------DLGIPSFHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGK 309

Query: 277 FDLMNYRLS----TPIKPLIWCDAKIQVH---------SQSRIEIHCRAKAQIKKKSTAN 323
           F L  Y +       +   +  D  IQV           +  + +H R    +       
Sbjct: 310 FRLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDGLGLNKDEFEVRLHVRESIAVVDPVEDL 369

Query: 324 NVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTD- 382
            V +      D++    R +HG+     E     WR  +     E S      L    D 
Sbjct: 370 VVTLQFSNGNDSNVKMLRATHGTFVGQDEDRQCSWRFDS----DEISAGTLPVLRGCIDD 425

Query: 383 -VEVPKAKR----PIQVKFQIPYFTTSGIQVRYLKVH--EPKLQYQSYPWVRYITQ 431
              V + KR     + V++  P    SG +V  L V    P+++ + +  VR +T+
Sbjct: 426 SKHVQQKKRSCLTSVAVRYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 70/155 (45%), Gaps = 35/155 (22%)

Query: 164 VSWRPEGIT-YKKNEAFLDVTESINMLITASGQVLR---SEILGKVKVRSRLSGMPDLKL 219
           V WR    + ++ NE ++D+ E+ ++++      LR    +I G V VRS L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENE---KIISFIPPDGD 276
            LN  G                     E+     H+CV ++  + E     I+FIPPDG 
Sbjct: 259 KLNTMGN--------------------EIGIPSLHECVEIND-DGEFTPSNITFIPPDGK 297

Query: 277 FDLMNY--RLSTPIKPLIWCDAKIQVHSQSRIEIH 309
           F L+ Y   L + +K      + I+++S   I +H
Sbjct: 298 FRLLEYSINLDSQLKK-----SGIRMNSIGMISVH 327

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 60/143 (41%), Gaps = 43/143 (30%)

Query: 166 WR-PEGITYKKNEAFLDVTESINMLITA-----------------SGQV--LRSEILGKV 205
           WR  + I   +NE + DV E I ++                    SG +  +R  I G V
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 206 KVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCV-RLSKFEN 264
            +R  L+G P +++ L   G+                    ++    FH CV + S  + 
Sbjct: 287 DMRCFLTGNPLVEIALKQGGL--------------------DIGIPGFHDCVDKTSLLKQ 326

Query: 265 EKI--ISFIPPDGDFDLMNYRLS 285
           EKI  +SFIPPDG F LM Y ++
Sbjct: 327 EKISKLSFIPPDGRFTLMQYNIN 349

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 35/155 (22%)

Query: 164 VSWRPEGIT-YKKNEAFLDVTESINMLITASGQVLR---SEILGKVKVRSRLSGMPDLKL 219
           V WR    + ++ NE ++D+ E+ +++       LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKI---ISFIPPDGD 276
            LN  G                    I +  L  H+CV + K + E +   I+FIPPDG 
Sbjct: 259 KLNTMG------------------NDIGVPTL--HECVEI-KDDGEFLPSNITFIPPDGK 297

Query: 277 FDLMNYR--LSTPIKPLIWCDAKIQVHSQSRIEIH 309
           F L+ Y   L + +K      + I+++S   + +H
Sbjct: 298 FRLLEYSVDLDSQVKQ-----SGIRINSIGLMSLH 327

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 52/126 (41%), Gaps = 25/126 (19%)

Query: 164 VSWRPEGITYKKNEAFLDVTESINMLITASG----QVLRSEILGKVKVRSRLSGMPDLKL 219
           V WR   ++   NE ++D+ E++ + +  S      V    I GK+ ++  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVR-LSKFENEKIISFIPPDGDFD 278
            L+  G                       +    H+C+   S   +   + FIPPDG F 
Sbjct: 255 NLHSAGH--------------------AFKPSALHRCLDPSSSSFDSSSLRFIPPDGKFT 294

Query: 279 LMNYRL 284
           L+ Y +
Sbjct: 295 LLEYTI 300

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 107/262 (40%), Gaps = 62/262 (23%)

Query: 66  YVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKT--VEEESIRDNFVIIYELLDEMLDYGI 123
           Y    S S S      F+FL  +  +L EY     +  + I +N+  I  + +  ++ G 
Sbjct: 74  YWCLASTSKSKGPLDCFTFLETIDRILLEYFDKDKLSIKKIVNNYDRISLIFNCCVEAGE 133

Query: 124 PQIT-------------ETKMLKQYITQKSYKLIKSVKKSKN---------VVRPPAQLT 161
           P ++             E   L ++I+  ++ L ++V+  +          + R    L 
Sbjct: 134 PNVSDMLYVNKIKEAVPERSDLSKFISSTAHNLQQAVQLPQQRQQQLQQNQISRGSNSLI 193

Query: 162 KS---VSWRPEGIT-YKKNEAFLDVTESINMLITASGQVLR---SEILGKVKVRSRLSGM 214
           ++   V WR    + ++ NE ++D+ E+ +++       LR     I G V VRS L+  
Sbjct: 194 ENEEIVPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDN 253

Query: 215 PDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFENEKI-----IS 269
           P + + LN  G                    I +  L  H CV +    N+ +     I+
Sbjct: 254 PLVAVKLNTMG------------------NDIGIPSL--HDCVEI----NDGVFSPSNIT 289

Query: 270 FIPPDGDFDLMNYR--LSTPIK 289
           FIPPDG F L+ Y   LS+ +K
Sbjct: 290 FIPPDGKFRLLEYSVDLSSQVK 311

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 62/135 (45%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
            GK +LSR++ D      +E    F  L+ +   E + V        ++Y++   +D Y+
Sbjct: 12  NGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYKPFDDYYL 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + ++   S N+ Q  S L    + +  YL + +E  I +N   I    DE++  G  +  
Sbjct: 68  IIITNRQS-NIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENL 126

Query: 128 ETKMLKQYITQKSYK 142
               ++ Y+T +S++
Sbjct: 127 TMAQVETYLTMESHE 141

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 62/134 (46%), Gaps = 8/134 (5%)

Query: 12  GKVILSRRYRD---DVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYVL 68
           GK +LSR++RD   D     +  F  L+ ++  + + V        ++Y++   +D Y++
Sbjct: 109 GKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYKPFDDYYII 164

Query: 69  TMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQITE 128
            ++   S N+ Q    L    + +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 165 LITNRQS-NIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVITMGYKENLS 223

Query: 129 TKMLKQYITQKSYK 142
              +  Y++ +S++
Sbjct: 224 ISQINTYLSMESHE 237

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 26/125 (20%)

Query: 164 VSWRPEGIT-YKKNEAFLDVTESINMLITASGQVLR---SEILGKVKVRSRLSGMPDLKL 219
           V WR    + ++ NE +LD+ E+ +++       +R     I G + VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKFE--NEKIISFIPPDGDF 277
            LN  G                    I +  L  H+CV ++     +   I+FIPPDG F
Sbjct: 259 KLNTMG------------------NDIGIPSL--HECVEINDGGVFSPSNITFIPPDGKF 298

Query: 278 DLMNY 282
            L+ Y
Sbjct: 299 RLLEY 303

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 65/135 (48%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
           +GK +LSR++R+      +E    F +L+     E + V      N ++Y++   +D Y+
Sbjct: 12  SGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVE----GNHVRYVYRPFDDYYI 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + ++   S N+ +  S L  L + +   L + +E  I D+   I    DE++  G  +  
Sbjct: 68  ILITNRQS-NIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENL 126

Query: 128 ETKMLKQYITQKSYK 142
            +  +  Y+T +S++
Sbjct: 127 SSTQVTTYLTMESHE 141

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 56/149 (37%), Gaps = 50/149 (33%)

Query: 164 VSWRPEGITYKKNEAFLDVTESI-----NMLITASG-------------------QVLRS 199
           V WR   I   KNE ++D+ E I     N +    G                   +++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRL 259
            I G + VRS L+G P +++ LN  G                     ++     H CV L
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG--------------------NDMGTPSLHPCVEL 358

Query: 260 S---KFENEKIIS---FIPPDGDFDLMNY 282
                 +++K++    FIPPDG F L  Y
Sbjct: 359 EGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 51/138 (36%), Gaps = 36/138 (26%)

Query: 164 VSWRPEGITYKKNEAFLDVT------------ESINMLITASGQVLRSEILGKVKVRSRL 211
           V WR   +  ++NE ++DV              S +    A  Q++   I G V  R  L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 212 SGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXXXIELEDLQFHQCVRLSKF----ENEKI 267
           S  P +++  N+ G                     +L     H CV L        +   
Sbjct: 266 SRDPIVEVTFNNHG--------------------CDLGTPALHDCVELDGVPEGPADHTT 305

Query: 268 ISFIPPDGDFDLMNYRLS 285
           + FIPPDG F LM Y ++
Sbjct: 306 LKFIPPDGKFRLMEYSVT 323

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 62/134 (46%), Gaps = 8/134 (5%)

Query: 12  GKVILSRRYRD---DVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYVL 68
           GK +LSR++R+   D     +  F  L+ ++  + + V        ++Y++   +D Y++
Sbjct: 13  GKPLLSRQFREISKDRVTELLSNFQGLVAKSSSQHTFVE----DEHVRYVYKPFDDYYII 68

Query: 69  TMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQITE 128
            ++   S N+ Q    L    + +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 69  LITNRQS-NIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEVITMGYKENLS 127

Query: 129 TKMLKQYITQKSYK 142
              +  Y++ +S++
Sbjct: 128 MTQINTYLSMESHE 141

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 71/153 (46%), Gaps = 10/153 (6%)

Query: 4   CIYFCDNTGKVILSRRYRD---DVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60
            +     +GK ++SR+++D   D     +  F  L+  + ++ + V        ++Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVE----EEHVRYVYK 60

Query: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120
             +D Y++ ++   S N+ Q    L    + +  +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YGIPQITETKMLKQYITQKSY--KLIKSVKKSK 151
            G  +      +  +++ +S+  KL + ++++K
Sbjct: 120 LGCKENLSLSQINTFLSMESHEEKLQEIIERNK 152

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
            GK +LSR++R+      +E    F  L+     + + V        ++Y++   +D Y+
Sbjct: 12  NGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFVE----DEHVRYVYKPFDDYYI 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + ++   S N+ Q  S L    + +  YL + +E  + DN   I    DE++  G  +  
Sbjct: 68  ILITNRQS-NIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVVMGYKENL 126

Query: 128 ETKMLKQYITQKSYK 142
               +  Y++ +S++
Sbjct: 127 TAAQVSTYLSMESHE 141

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYS--HGSLKYVPEKSA 355
           I  H+Q  +E   +    +  KS A  + + + +PE AD P++ ++   G+L +   +S+
Sbjct: 129 ITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLF-STRSS 187

Query: 356 ILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQV 394
           I  RI          ++   G+ ++   E+P    PI V
Sbjct: 188 INLRI---------PYSIPNGIANLITREIPHGFNPIGV 217

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 6/133 (4%)

Query: 12  GKVILSRRYR--DDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYVLT 69
           GKV L R Y   D    S I R  A ++ A +    +   L +   + ++ ++  +Y + 
Sbjct: 14  GKVRLMRWYSAYDSKGKSKISRELATMVLARKAK--MCNILEYQDHKVVYKRYASLYFIC 71

Query: 70  MSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML--DYGIPQIT 127
              S S N       +++ VE +  Y   V E  I  NF   YE+L+E+L  D  + + +
Sbjct: 72  GISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNEVLVCDGSMTETS 131

Query: 128 ETKMLKQYITQKS 140
           +  +L+  +T  S
Sbjct: 132 KQAILRSVMTMDS 144

>CAGL0M10131g Chr13 (1008833..1010461) [1629 bp, 542 aa] {ON}
           similar to uniprot|P35201 Saccharomyces cerevisiae
           YKL089w required for normal chromosome segregation
          Length = 542

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 17/93 (18%)

Query: 96  LKTVEEESIRDNFVIIYELLDEMLDYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVR 155
           L + +E+ I +N      L DE+ +  +P    T++       K Y ++  V++SK V  
Sbjct: 256 LSSDDEDYISENSTGHNRLEDEIDNPSLP----TRL------SKPYDIVDGVRRSKRVKI 305

Query: 156 PPAQLTKSVSWRPEGITYK--KNEAFLDVTESI 186
           PP +      WR E I YK  +NE  LD+ + I
Sbjct: 306 PPLEY-----WRNEKIQYKRRRNEPVLDIDKVI 333

>Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88]
           FULL
          Length = 132

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 12/85 (14%)

Query: 255 QCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEI------ 308
           QC R SK    K+++++    +F  M YR S+       C    +V + +RI+I      
Sbjct: 36  QCARKSKATVAKLVNWLIFSTEFTSMRYRKSSN------CKENSKVCNSTRIDIRLLGWS 89

Query: 309 HCRAKAQIKKKSTANNVEILIPVPE 333
           H    ++  K S    + + IP PE
Sbjct: 90  HRSQSSKFIKMSKMQLMALFIPTPE 114

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRD---DVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
            GK +LSR++ +   D     +  F  L+     + + V        ++Y++   +D Y+
Sbjct: 12  NGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYVYKPFDDYYL 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + M+   S N+ Q  S L    + +  YL + +E  I +N   I    DE++  G  +  
Sbjct: 68  ILMTNRQS-NIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIVMGHKENL 126

Query: 128 ETKMLKQYITQKSYK 142
             + +  YI+ +S++
Sbjct: 127 TIQQVNNYISMESHE 141

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 62/135 (45%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
           TGK +LSR++R+      +E    F +L+     + + V        ++Y++   +D Y+
Sbjct: 12  TGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVE----DEHVRYVYRPFDDYYI 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + ++   S N+    S L    + +  YL + +E  I +N   I    DE++  G  +  
Sbjct: 68  ILITNRQS-NIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVVMGYKENL 126

Query: 128 ETKMLKQYITQKSYK 142
               +  Y++ +S++
Sbjct: 127 SITQVNTYLSLESHE 141

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 37/85 (43%)

Query: 139 KSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFLDVTESINMLITASGQVLR 198
           +  KL    K++       +  T++    PE      N   + + E++N  IT  G +  
Sbjct: 243 RGMKLTGQSKRNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISS 302

Query: 199 SEILGKVKVRSRLSGMPDLKLGLND 223
           SE+ G +++R     +   KL L+D
Sbjct: 303 SELKGVLELRVNDRSLAHAKLTLDD 327

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 11  TGKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYV 67
            GK +LSR++R+      +E    F  L+     + +     L    ++Y++   ++ Y+
Sbjct: 12  NGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYRPFDNYYI 67

Query: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQIT 127
           + ++   S N+ Q  S L      +  YL + +E  I DN   I    DE++  G  +  
Sbjct: 68  ILITNRQS-NIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVTMGYKENL 126

Query: 128 ETKMLKQYITQKSYK 142
               ++ Y+  +S++
Sbjct: 127 SISQVETYLAMESHE 141

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 82  FSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML--DYGIPQITETKMLKQYITQK 139
              ++K VE + +Y   V E  I  NF   Y++L+EM+  D  + + ++T +LK   T  
Sbjct: 84  LEIIHKYVETMDQYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLKDVRTMD 143

Query: 140 S 140
           S
Sbjct: 144 S 144

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 71/176 (40%), Gaps = 27/176 (15%)

Query: 15  ILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYVLTMSRSL 74
           + ++R      PSA++RF   L+               N L+++ IQ N    L+  + +
Sbjct: 210 VETKRISSSYSPSALKRFSQTLV---------------NSLEFLNIQENS--TLSEVKGI 252

Query: 75  SINVAQVFSFLYKLVEVLAEYLKTVEEESI--RDNFVIIYELLDEMLDYGIPQITETKML 132
             ++      L +  E L   +  +++  +   DN   I + LD + +YG+ ++      
Sbjct: 253 DFDIEH----LRQKKETLLGKISNIKQNQLLLEDNLKQIDDRLDFLEEYGLEEVGAGSEE 308

Query: 133 KQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFLDVTESINM 188
              ++ KS +       +KN       +TK++S        ++ + F D   SI +
Sbjct: 309 NVVVSNKSEETTSKNGSNKN----EGDITKTISSETSNTLPRRRQQFRDDNSSIKL 360

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 8/134 (5%)

Query: 12  GKVILSRRYRDDVPPSAIE---RFPALLLEAEQESSVVPPCLTHNGLQYMFIQHNDIYVL 68
           GK +LSR++++      IE    F  L+ ++  + + V        ++Y++   +D Y++
Sbjct: 13  GKPLLSRQFKELTKERVIELLSNFQGLVSKSSSDHTYVED----EHVRYVYRPFDDYYLI 68

Query: 69  TMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQITE 128
            ++   S N+ Q  S L    + +  YL + +EE I  N   I    DE++  G  +   
Sbjct: 69  LVTNRQS-NIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMGNKENLT 127

Query: 129 TKMLKQYITQKSYK 142
              +  Y+  +S++
Sbjct: 128 VSQVNTYLAMESHE 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,035,197
Number of extensions: 1806617
Number of successful extensions: 5403
Number of sequences better than 10.0: 111
Number of HSP's gapped: 5408
Number of HSP's successfully gapped: 175
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)