Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.208397.126ON3052689951e-135
KLTH0F12562g7.126ON2931895728e-72
CAGL0C03850g7.126ON2091705467e-69
SAKL0F05368g7.126ON2311695452e-68
ZYRO0C05214g7.126ON2701405352e-66
Skud_9.1627.126ON2171645284e-66
KLLA0D14333g7.126ON2051665265e-66
Suva_9.1947.126ON2151745181e-64
KAFR0K012007.126ON2021605143e-64
TDEL0H028807.126ON3541435265e-64
NDAI0H013107.126ON2611445177e-64
Smik_9.1847.126ON2141505111e-63
Kpol_1062.577.126ON2191445102e-63
YIL010W (DOT5)7.126ON2151525093e-63
TBLA0A009407.126ON2881445136e-63
ADL018W7.126ON2441625027e-62
Ecym_83517.126ON2241405007e-62
KNAG0G010207.126ON2071424929e-61
NCAS0F008107.126ON2311534782e-58
TPHA0C043307.126ON2091424622e-56
KAFR0B029608.300ON17665750.34
YLR109W (AHP1)8.300ON17666740.43
Suva_10.1998.300ON17666740.47
Smik_12.1698.300ON17666740.50
Skud_12.1778.300ON17666720.96
ZYRO0D13640g5.569ON19647682.8
ADL268C8.610ON294103693.3
TDEL0C015907.388ON249118683.7
CAGL0A04433g7.388ON26076675.0
NCAS0H027905.569ON19647665.7
ZYRO0D07216g5.25ON100349686.0
Kpol_1004.598.300ON17672648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20839
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   387   e-135
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   224   8e-72
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   214   7e-69
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   214   2e-68
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   210   2e-66
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   207   4e-66
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   207   5e-66
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   204   1e-64
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   202   3e-64
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   207   5e-64
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   203   7e-64
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   201   1e-63
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   201   2e-63
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   200   3e-63
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   202   6e-63
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   197   7e-62
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   197   7e-62
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   194   9e-61
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   188   2e-58
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   182   2e-56
KAFR0B02960 Chr2 (620398..620928) [531 bp, 176 aa] {ON} Anc_8.30...    33   0.34 
YLR109W Chr12 (368781..369311) [531 bp, 176 aa] {ON}  AHP1Thiol-...    33   0.43 
Suva_10.199 Chr10 (377104..377634) [531 bp, 176 aa] {ON} YLR109W...    33   0.47 
Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W...    33   0.50 
Skud_12.177 Chr12 (351533..352063) [531 bp, 176 aa] {ON} YLR109W...    32   0.96 
ZYRO0D13640g Chr4 complement(1144205..1144795) [591 bp, 196 aa] ...    31   2.8  
ADL268C Chr4 complement(232705..233589) [885 bp, 294 aa] {ON} Sy...    31   3.3  
TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON...    31   3.7  
CAGL0A04433g Chr1 (436143..436925) [783 bp, 260 aa] {ON} highly ...    30   5.0  
NCAS0H02790 Chr8 complement(546364..546954) [591 bp, 196 aa] {ON...    30   5.7  
ZYRO0D07216g Chr4 (624565..627576) [3012 bp, 1003 aa] {ON} simil...    31   6.0  
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    29   8.3  

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  387 bits (995), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 201/268 (75%), Positives = 201/268 (75%)

Query: 1   MVELXXXXXXXXXXXXXXAPEDETTQKEPEVKKPKTAKSSDSSQGELEVGDEVPDVVLKN 60
           MVEL              APEDETTQKEPEVKKPKTAKSSDSSQGELEVGDEVPDVVLKN
Sbjct: 1   MVELRRSSRNRSSNGSKRAPEDETTQKEPEVKKPKTAKSSDSSQGELEVGDEVPDVVLKN 60

Query: 61  QDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPA 120
           QDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPA
Sbjct: 61  QDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPA 120

Query: 121 AQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFANGKLINKRIAVSPEVS 180
           AQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFANGKLINKRIAVSPEVS
Sbjct: 121 AQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFANGKLINKRIAVSPEVS 180

Query: 181 IRDAKTEAHXXXXXXXXXXXXXXXXXXXXXXXXXXQNVEGNGTXXXXXXXXXXXXXXXXX 240
           IRDAKTEAH                          QNVEGNGT                 
Sbjct: 181 IRDAKTEAHEAAKGDDEDNEKKDVKEEKDEDNGEDQNVEGNGTEDAEVKDDEEEDGDFNE 240

Query: 241 XXXXXXXXXXIGQEDDDEYDEGNLKKDE 268
                     IGQEDDDEYDEGNLKKDE
Sbjct: 241 NEAEDPELEEIGQEDDDEYDEGNLKKDE 268

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  224 bits (572), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 143/189 (75%), Gaps = 5/189 (2%)

Query: 1   MVELXXXXXXXXXXXXXXAPEDE-TTQKEPEVKKPKTAKSSDSSQGELEVGDEVPDVVLK 59
           MVEL              APE+E      PE KK KT    + S+GELE GDEVPDVVLK
Sbjct: 1   MVELRRSTRKKSSDAPKRAPEEEEVAPNAPETKKAKT----NGSKGELEEGDEVPDVVLK 56

Query: 60  NQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTP 119
           NQ+ EEVSLK V Q+NKVV++F+YPKASTPGCT QACGFRDNYE+LK+  AVFGLS DTP
Sbjct: 57  NQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTP 116

Query: 120 AAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFANGKLINKRIAVSPEV 179
            AQ+KF++ +SLPFDLLSDP+R+LIG LGA KSPSGTKRS+WVF  GKL  KRI+VSPE 
Sbjct: 117 NAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQGKLRTKRISVSPEA 176

Query: 180 SIRDAKTEA 188
           S+ +AK EA
Sbjct: 177 SVSEAKKEA 185

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  214 bits (546), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 3/170 (1%)

Query: 21  EDETTQKEPEVKKPKTAKSSDSS-QGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVI 79
           +++   KEP VKKP T +   SS +  LEVGD++PD+ L+NQD ++VSLK +A+ENKV+I
Sbjct: 32  KEKVNTKEP-VKKPNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVII 90

Query: 80  IFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDP 139
           IF YPKASTPGCT QACGFRDN++DLKE G V GLS DTPAAQ KF++ +SLP+DLL DP
Sbjct: 91  IFLYPKASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDP 150

Query: 140 KRELIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
            RE IG+LGAKK+P SG+ RSH+VFA+GKL  KR+ +SPE+S+ D K E 
Sbjct: 151 TREFIGMLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEV 200

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  214 bits (545), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 130/169 (76%), Gaps = 1/169 (0%)

Query: 21  EDETTQKEPEVKKPKTAKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVII 80
           EDE   K  +  + +  +  + +  ELEVGD++PD++LKNQD++++SLK++A++N++V+ 
Sbjct: 48  EDEVQDKPADKSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVF 107

Query: 81  FSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPK 140
           F+YPKASTPGCT Q CG+RDNYEDLKE  AVFGLSADT  AQ+ FQ   SLP+DLLSDPK
Sbjct: 108 FAYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPK 167

Query: 141 RELIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
           RE IGLLGAKK+P SG  RSHWVF+ GKL  KR+ +SPE S+ D K E 
Sbjct: 168 REFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEV 216

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  210 bits (535), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (83%), Gaps = 1/140 (0%)

Query: 50  GDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVG 109
           GD +PD++LKNQD +E+SLKKV+ E+K+V+IF YPKASTPGCT QACGFRDNYED+KE  
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 110 AVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFANGKL 168
           AVFGLSADT  AQ+KFQ+   LPFDLLSDP+R L+GLLGAKKSP SG  RSHWVFA+G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 169 INKRIAVSPEVSIRDAKTEA 188
            +KR+ +SPEVSI + K E 
Sbjct: 215 KHKRVKISPEVSIEEGKKEV 234

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  207 bits (528), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 101/164 (61%), Positives = 127/164 (77%), Gaps = 4/164 (2%)

Query: 29  PEVKKPKTAKSSD---SSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPK 85
           P+VK  +  KS D   S+  ELE+GD +PD+ L ++D + +SLK++A+ENK+V+ F YPK
Sbjct: 42  PKVKTSEPVKSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPK 101

Query: 86  ASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIG 145
           ASTPGCT QACGFRDNYEDLK+  AVFGLSAD   +Q+KFQ   +LP+ L+SDPKRE IG
Sbjct: 102 ASTPGCTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIG 161

Query: 146 LLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
           LLGAKK+P SG+ RSH+VF NGKL  KRI +SPEVS+ DAK E 
Sbjct: 162 LLGAKKTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEV 205

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  207 bits (526), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 126/166 (75%), Gaps = 6/166 (3%)

Query: 28  EPEVKKP---KTAKSSDSSQ--GELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFS 82
           E +V KP   K  K+ DS+    EL++GD++PD+ L NQD+E +SLK+VA +NK+V+ F+
Sbjct: 32  ESKVTKPNGKKEVKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFA 91

Query: 83  YPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRE 142
           YPKASTPGCT QACG+RDNY +LKE  AVFGLSAD P +Q+ FQ   +LPFDLLSDPKRE
Sbjct: 92  YPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKRE 151

Query: 143 LIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTE 187
            IG LGAKK+  SG  RSHW+F NGKL  KR+ VSPEVSI + K E
Sbjct: 152 FIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKE 197

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  204 bits (518), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 106/174 (60%), Positives = 128/174 (73%), Gaps = 13/174 (7%)

Query: 28  EPEVKKPKTAKSSD----------SSQG--ELEVGDEVPDVVLKNQDEEEVSLKKVAQEN 75
           EP  KK KT    D          SS G  EL+VGD++PD+ L N+D + VSLK++A+EN
Sbjct: 32  EPAKKKIKTVPKLDIEEPVKREDHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAKEN 91

Query: 76  KVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDL 135
           K+V+ F YPKASTPGCT QACGFRDNYEDLKE  AVFGLSAD+  +Q+KFQ    LP+ L
Sbjct: 92  KIVVFFVYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHL 151

Query: 136 LSDPKRELIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
           LSDPKRE IGLLGAKK+P SG+ RSH+VF +GKL  KR+ +SPEVS+ DAK E 
Sbjct: 152 LSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEV 205

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  202 bits (514), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 129/160 (80%), Gaps = 2/160 (1%)

Query: 31  VKKPKTAKSS-DSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTP 89
           + K +T +SS + S  EL++GD +PD+ L NQD +++SL++VA+ NK++++F+YPKASTP
Sbjct: 34  ISKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTP 93

Query: 90  GCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGA 149
           GCT QACGFRDNY+++K+  AVFGLSAD+  +Q++FQ+  +LPF+LLSDPKRELIG+LGA
Sbjct: 94  GCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGA 153

Query: 150 KKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
           KK+P SG  RSHWVF +GKL  + I VSPE SI ++K E 
Sbjct: 154 KKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEV 193

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  207 bits (526), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 118/143 (82%), Gaps = 1/143 (0%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           EL++GDE+PDV L+NQD ++VSL+ VA+E+K++IIF+YPKASTPGCT QACG+RDNY++L
Sbjct: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164
           KE  AVFGLS D  +AQ+KFQ   SLPFDLL DP R LIG LGAKK+  SGT RSHWVF 
Sbjct: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320

Query: 165 NGKLINKRIAVSPEVSIRDAKTE 187
           +GKL  KR+ VSPEVSI+D K E
Sbjct: 321 DGKLKYKRVKVSPEVSIQDGKKE 343

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  203 bits (517), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 121/144 (84%), Gaps = 1/144 (0%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           ELE+GD++PD+ L NQ+ +E+SLK++A+ NK+++IF++P+ASTPGCT QACGFRDNY++L
Sbjct: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164
           K+   VFGLSAD  ++Q+KF++   LP+DLLSDPKR+LIGLLGAKK+P SGT RS+W+F 
Sbjct: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227

Query: 165 NGKLINKRIAVSPEVSIRDAKTEA 188
            GKL  KRI VSPE+S+ ++K E 
Sbjct: 228 EGKLSIKRIKVSPEISVAESKKEV 251

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  201 bits (511), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 122/150 (81%), Gaps = 1/150 (0%)

Query: 39  SSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGF 98
           +S S+  EL++GD +PD+ L ++D + +SLKK+A+ENK+V+ F YPKASTPGCT QACGF
Sbjct: 55  NSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGF 114

Query: 99  RDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTK 157
           RDNY+DLK+  AVFGLS+D+  +Q++FQ   +LP+ LLSDPKRE IGLLGAKK+P SG+ 
Sbjct: 115 RDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSI 174

Query: 158 RSHWVFANGKLINKRIAVSPEVSIRDAKTE 187
           RSH+VF +GKL  KR+ +SPEVS+ DAK E
Sbjct: 175 RSHFVFVDGKLRFKRVKISPEVSVNDAKKE 204

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  201 bits (510), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 119/144 (82%), Gaps = 1/144 (0%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           E+E+GDE+PD+ L+NQD  ++SL+++A++N +++ F+YP+A TPGCT QACGFRD Y+DL
Sbjct: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164
           K+  AVFGLSAD+  +Q+KFQD +SLP+DLLSDPKRE IGLLGAKK+P SG  RSH++F 
Sbjct: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186

Query: 165 NGKLINKRIAVSPEVSIRDAKTEA 188
           +GKL  KRI +SPE+S+ D K E 
Sbjct: 187 DGKLRFKRIKISPEISVNDGKKEV 210

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  200 bits (509), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 92/152 (60%), Positives = 121/152 (79%), Gaps = 3/152 (1%)

Query: 38  KSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACG 97
           +SSD +  ELE+GD +PD+ L N+D + +SLKK+ + N+VV+ F YP+ASTPGCT QACG
Sbjct: 56  RSSDVN--ELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACG 113

Query: 98  FRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGT 156
           FRDNY++LK+  AVFGLSAD+  +Q+KFQ   +LP+ LLSDPKRE IGLLGAKK+P SG+
Sbjct: 114 FRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGS 173

Query: 157 KRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
            RSH++F +GKL  KR+ +SPEVS+ DAK E 
Sbjct: 174 IRSHFIFVDGKLKFKRVKISPEVSVNDAKKEV 205

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  202 bits (513), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 1/144 (0%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           ELEVGDEVPD  LKNQ+ E +SLKKV +EN++V+IF+YPKA+TPGCT QACG RDNY DL
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164
           K+   VFG+SAD+ +AQ+ FQ+  +LP+DLLSD  RELIG LG KK+P SG  RSH++  
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 165 NGKLINKRIAVSPEVSIRDAKTEA 188
           NGKL  KR+ +SPEVS+ D K E 
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEV 269

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  197 bits (502), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 92/162 (56%), Positives = 126/162 (77%), Gaps = 4/162 (2%)

Query: 30  EVKKPKTAKSSDSSQG---ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKA 86
           +V+ PK A ++++S G   EL+VGD +P++ LKNQD+ +V L  V ++NK+V++F+YPKA
Sbjct: 67  KVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKA 126

Query: 87  STPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGL 146
           STPGCT QACGFRDNY++L++   VFG+SAD+  +Q+ FQ    LPFDLLSDPKRELIG 
Sbjct: 127 STPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGA 186

Query: 147 LGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTE 187
           LGA+K+  +G  RSHWVF +GKL +KRI +SPE+SI D  +E
Sbjct: 187 LGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSE 228

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  197 bits (500), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 114/140 (81%), Gaps = 1/140 (0%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           ELEVGD VP++ LKNQD++EV+LK VA++NK+V+IF+YPKA+TPGCT QACGFRDNYE+L
Sbjct: 70  ELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFRDNYEEL 129

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164
           ++   +FG+S+D+  +Q+ FQ    LPFDLLSDP RELIG+LGAKK+  +G  RSHW+F 
Sbjct: 130 QKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIRSHWIFC 189

Query: 165 NGKLINKRIAVSPEVSIRDA 184
           NGKL  KR+ VSPE SI + 
Sbjct: 190 NGKLKYKRVKVSPETSISEG 209

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  194 bits (492), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 115/142 (80%), Gaps = 1/142 (0%)

Query: 47  LEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLK 106
           LE+GDE+PD+ L +Q+ E VSL +VA  NK+++IF+YP+ASTPGCT QACGFRDNY +LK
Sbjct: 58  LEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELK 117

Query: 107 EVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKK-SPSGTKRSHWVFAN 165
           +  AV+GLSADT A+Q+KFQ   +LP++LLSDPKRE IG+LGAKK S SG  RS+W+F N
Sbjct: 118 KHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFN 177

Query: 166 GKLINKRIAVSPEVSIRDAKTE 187
           GKL  K+I VSPE S+ ++K E
Sbjct: 178 GKLRIKKIKVSPEASVAESKAE 199

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  188 bits (478), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 84/153 (54%), Positives = 121/153 (79%), Gaps = 1/153 (0%)

Query: 37  AKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQAC 96
            K++DS   EL++GD++PD++L +++   VSLKKV +ENK+V+ F++PKA+TPGCT QAC
Sbjct: 73  VKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQAC 132

Query: 97  GFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SG 155
           GFRDNY++LKE  AV+G+SAD   AQ+KF+   +LP+ LLSD KR+ IGLLGAKK+P SG
Sbjct: 133 GFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSG 192

Query: 156 TKRSHWVFANGKLINKRIAVSPEVSIRDAKTEA 188
             RS+++F +GKL  KR+ +SPE+S+ +A+ E 
Sbjct: 193 VIRSYFIFVDGKLKVKRVKISPELSVEEARKEV 225

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  182 bits (462), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 112/142 (78%)

Query: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105
           E++VGDE+PD+ L+NQ+ EE+SL+ +AQ+NK++ IF YP+ASTPGCT QACGFRDN++DL
Sbjct: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119

Query: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFAN 165
           K+   + GLS D+  AQ+ F+   +LP+DLL D +++LI +LG KK PSG  RS+++F +
Sbjct: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVD 179

Query: 166 GKLINKRIAVSPEVSIRDAKTE 187
           GKL  KR+ VSPEVSI ++K E
Sbjct: 180 GKLKLKRVKVSPEVSITESKKE 201

>KAFR0B02960 Chr2 (620398..620928) [531 bp, 176 aa] {ON} Anc_8.300
           YLR109W
          Length = 176

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQAC-GFRDNYEDL--KEVGAVFGLSADTPA 120
           + V   K  +ENK V+I   P A +P C+     G+  + +DL  K V  +  L+ D P 
Sbjct: 36  QTVQWSKFIKENKTVVITGAPAAFSPTCSVSHIPGYVAHLDDLVAKNVDQIVVLTVDNPF 95

Query: 121 AQRKF 125
           A + +
Sbjct: 96  ANQAW 100

>YLR109W Chr12 (368781..369311) [531 bp, 176 aa] {ON}
           AHP1Thiol-specific peroxiredoxin, reduces hydroperoxides
           to protect against oxidative damage; function in vivo
           requires covalent conjugation to Urm1p
          Length = 176

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYED----LKEVGAVFGLSADTP 119
           + V   K+  ENK VII   P A +P CT        NY D     KEV  V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 120 AAQRKF 125
            A + +
Sbjct: 95  FANQAW 100

>Suva_10.199 Chr10 (377104..377634) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYED----LKEVGAVFGLSADTP 119
           + V   K+  ENK VII   P A +P CT        NY D     KEV  V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 120 AAQRKF 125
            A + +
Sbjct: 95  FANQAW 100

>Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYED----LKEVGAVFGLSADTP 119
           + V   K+  ENK VII   P A +P CT        NY D     KEV  V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 120 AAQRKF 125
            A + +
Sbjct: 95  FANQAW 100

>Skud_12.177 Chr12 (351533..352063) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCT-TQACGFRDNYEDL---KEVGAVFGLSADTP 119
           + V   K+  ENK VII   P A +P CT +   G+    ++L   KEV  V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTISHIPGYISYLDELVKEKEVDQVIVVTVDNP 94

Query: 120 AAQRKF 125
            A + +
Sbjct: 95  FANQAW 100

>ZYRO0D13640g Chr4 complement(1144205..1144795) [591 bp, 196 aa]
           {ON} highly similar to uniprot|P34760 Saccharomyces
           cerevisiae YML028W TSA1 and to uniprot|Q04120
           Saccharomyces cerevisiae YDR453C TSA2 Thioredoxin-
           peroxidase
          Length = 196

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGA 110
           EEVSL +   + K V++   P A T  C T+   F D Y+  K++G 
Sbjct: 23  EEVSLDQ--YKGKYVVLAFVPMAFTFVCPTEIVAFSDAYKRFKDLGV 67

>ADL268C Chr4 complement(232705..233589) [885 bp, 294 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL117C
           (IDI1)
          Length = 294

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 18/103 (17%)

Query: 21  EDETTQKEPEV----KKPKTAKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENK 76
           ++E  ++ PE+     +P T  S+ S       GDE  D V    DEE++ L      N+
Sbjct: 31  QEEVLEQFPEIIPINNRPNTHSSASS-------GDEHKDSVFTGHDEEQIKLM-----NE 78

Query: 77  VVIIFSYPKASTPGCTTQACGFRDNYED--LKEVGAVFGLSAD 117
             II  +        T + C   +N +   L    +VF  SAD
Sbjct: 79  NCIIVDWDDEPIGAGTKKLCHLMENIDKGLLHRAFSVFVFSAD 121

>TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON}
           Anc_7.388 YBL064C
          Length = 249

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 49/118 (41%), Gaps = 17/118 (14%)

Query: 79  IIFSYPKASTPGCTTQACGFRDNYEDLKEVGA-VFGLSADTPAAQRKF-------QDAHS 130
           + FS+P   TP CTT+   F     +  + G  + GLSA+   + +K+          + 
Sbjct: 68  VFFSHPADFTPVCTTELGAFSKLKPEFDKRGVKLIGLSAEDVESHKKWIKDIEEVNGLNK 127

Query: 131 LPFDLLSDPKRELIGLL------GAK---KSPSGTKRSHWVFANGKLINKRIAVSPEV 179
             F +++D  +E+  L       G K   K+P  T RS ++    K +       P V
Sbjct: 128 FEFPIIADVDKEIAFLYDMVDEEGFKQLGKAPVATIRSVFIIDPSKKLRISFTYPPSV 185

>CAGL0A04433g Chr1 (436143..436925) [783 bp, 260 aa] {ON} highly
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064c
          Length = 260

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 8/76 (10%)

Query: 79  IIFSYPKASTPGCTTQACGFRDNYEDLKEVGA-VFGLSADTPAAQRKF-------QDAHS 130
           I+FS+P   TP CTT+   F        + G  + GLS +   + RK+            
Sbjct: 78  ILFSHPADFTPVCTTEMGAFAKMKPQFDKRGVKLLGLSVEDAESHRKWIKDIEEINGIDK 137

Query: 131 LPFDLLSDPKRELIGL 146
             F +++D KR +  L
Sbjct: 138 FGFPIIADTKRHVAFL 153

>NCAS0H02790 Chr8 complement(546364..546954) [591 bp, 196 aa] {ON}
           Anc_5.569
          Length = 196

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 64  EEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGA 110
           +EVSL+K   E K V++   P A T  C T+   F D  +  +++GA
Sbjct: 23  DEVSLEK--YEGKYVVLAFIPMAFTFVCPTEIVAFSDAAKKFEDIGA 67

>ZYRO0D07216g Chr4 (624565..627576) [3012 bp, 1003 aa] {ON} similar
           to uniprot|P46677 YGR274C Saccharomyces cerevisiae TAF1
           TFIID subunit (145 kDa) involved in RNA polymerase II
           transcription initiation
          Length = 1003

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 33  KPKTAKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIF 81
           K K  K S SS  +L VGD  P  +++  +E  ++L K    NK++  +
Sbjct: 457 KGKEVKESFSSTQDLTVGDTAPVFLMEYSEEAPIALSKFGMANKLINYY 505

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 60  NQDEEE----VSLKKVAQENKVVIIFSYPKASTPGCT-TQACGFRDNYED-LKEVGAVFG 113
           NQD  +    +   +  +ENK ++I   P A +P C+ +   G+ +  ++ LK+   +  
Sbjct: 29  NQDACKMPVTIDWTQFVKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIV 88

Query: 114 LSADTPAAQRKF 125
           L+ D P AQ+ +
Sbjct: 89  LTVDNPFAQQAW 100

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.128    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,815,620
Number of extensions: 878121
Number of successful extensions: 3404
Number of sequences better than 10.0: 56
Number of HSP's gapped: 3479
Number of HSP's successfully gapped: 57
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 65 (29.6 bits)