Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.204643.455ON1189118961570.0
KLTH0E05104g3.455ON1185118137080.0
SAKL0F06886g3.455ON1183118928160.0
Ecym_44043.455ON1196119327680.0
AGR251C3.455ON1193118426350.0
NDAI0A046503.455ON1199119823710.0
Kpol_1050.883.455ON1213121923320.0
Smik_16.3713.455ON1208120723260.0
NCAS0A116303.455ON1201117223170.0
Skud_16.4123.455ON1208120723060.0
YPR122W (AXL1)3.455ON1208120922960.0
TDEL0F034003.455ON1170118722410.0
ZYRO0C06336g3.455ON1189119022360.0
Suva_16.4513.455ON1218117422100.0
KLLA0D15631g3.455ON1170115921870.0
KAFR0A053703.455ON1201120321750.0
KNAG0A077403.455ON1197117020870.0
TBLA0C054503.455ON1202121820280.0
TPHA0D040603.455ON1201121519090.0
CAGL0D04686g3.455ON1181119512791e-155
TDEL0E012504.246ON9952353671e-34
Skud_12.4744.246ON10222463572e-33
YLR389C (STE23)4.246ON10272463501e-32
Suva_10.5064.246ON10232463421e-31
ZYRO0B12320g4.246ON9942553358e-31
Smik_12.4764.246ON10252313349e-31
AER053C4.246ON10132313341e-30
NCAS0J014704.246ON9952453341e-30
Ecym_32734.246ON10232313332e-30
Kwal_23.42374.246ON10012493269e-30
KNAG0B060804.246ON9962243251e-29
KAFR0A059704.246ON10112733251e-29
TBLA0I029404.246ON9652393204e-29
TPHA0B022604.246ON10412383188e-29
KLTH0D14278g4.246ON10012313142e-28
KLLA0E05105g4.246ON10042563116e-28
SAKL0H03124g4.246ON10062243062e-27
NDAI0J022404.246ON9992473001e-26
Kpol_1055.834.246ON10202413001e-26
CAGL0H06457g4.246ON10082442955e-26
TBLA0A080504.246ON9953912892e-25
TPHA0C024508.376ON4692621155e-05
CAGL0I07535g3.93ON10212181085e-04
KLLA0D18095g8.376ON469239970.009
Kpol_1024.23singletonOFF454236960.012
YLR163C (MAS1)8.376ON462233960.012
Kpol_YGOB_1024.238.376ON464236960.012
AGL138C8.376ON470230940.017
Smik_12.2258.376ON462227940.020
Skud_12.2308.376ON462237910.045
KLTH0F08954g8.376ON458241890.068
TBLA0H010108.376ON499227870.15
TDEL0F050008.376ON456226860.16
AFR334W3.93ON1029212860.23
Kwal_56.226883.93ON1040202860.23
Suva_10.2608.376ON462233820.46
CAGL0H02739g8.376ON465226810.68
YOL098C3.93ON1037219820.69
TBLA0A069405.541ON991212791.5
Suva_14.3272.284ON63286781.8
TBLA0B082403.93ON1032279772.3
Smik_15.583.93ON1038208772.5
Kwal_23.33458.376ON458226753.6
Skud_14.761.94ON222147754.2
KLLA0F22066g5.402ON3764130745.8
KAFR0H020308.376ON462226736.1
TBLA0I022303.325ON966155736.4
Skud_15.553.93ON1038215738.1
Ecym_41918.376ON462232728.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20464
         (1189 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...  2376   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...  1432   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...  1089   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...  1070   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...  1019   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   917   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   902   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...   900   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   897   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...   892   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...   889   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   867   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   865   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   855   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   847   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   842   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   808   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   785   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   739   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   497   e-155
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   145   1e-34
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   142   2e-33
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   139   1e-32
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   136   1e-31
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   133   8e-31
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   133   9e-31
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   133   1e-30
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   133   1e-30
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   132   2e-30
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   130   9e-30
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   129   1e-29
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   129   1e-29
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   127   4e-29
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   127   8e-29
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   125   2e-28
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   124   6e-28
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   122   2e-27
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   120   1e-26
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   120   1e-26
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   118   5e-26
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   115   2e-25
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    49   5e-05
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    46   5e-04
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    42   0.009
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    42   0.012
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    42   0.012
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    42   0.012
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    41   0.017
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    41   0.020
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    40   0.045
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    39   0.068
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    38   0.15 
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    38   0.16 
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    38   0.23 
Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL09...    38   0.23 
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    36   0.46 
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    36   0.68 
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    36   0.69 
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    35   1.5  
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    35   1.8  
TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON} Anc_...    34   2.3  
Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON...    34   2.5  
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    33   3.6  
Skud_14.76 Chr14 (136935..143600) [6666 bp, 2221 aa] {ON} YNL262...    33   4.2  
KLLA0F22066g Chr6 complement(2051033..2062327) [11295 bp, 3764 a...    33   5.8  
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    33   6.1  
TBLA0I02230 Chr9 complement(510907..513807) [2901 bp, 966 aa] {O...    33   6.4  
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    33   8.1  
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    32   8.7  

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score = 2376 bits (6157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1154/1189 (97%), Positives = 1154/1189 (97%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
            DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNA            LPAISDS
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  FFGDLPASGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQGSSNVVAI 300
            FFGDLPASGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQGSSNVVAI
Sbjct: 241  FFGDLPASGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQGSSNVVAI 300

Query: 301  QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS 360
            QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS
Sbjct: 301  QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS 360

Query: 361  SVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE 420
            SVSHFA             QHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE
Sbjct: 361  SVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE 420

Query: 421  LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTE 480
            LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTE
Sbjct: 421  LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTE 480

Query: 481  SQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIAY 540
            SQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIAY
Sbjct: 481  SQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIAY 540

Query: 541  VDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRSD 600
            VDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRSD
Sbjct: 541  VDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRSD 600

Query: 601  FLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLL 660
            FLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLL
Sbjct: 601  FLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLL 660

Query: 661  AGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDI 720
            AGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDI
Sbjct: 661  AGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDI 720

Query: 721  ISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFT 780
            ISSKVFREARIAVRSKYEE          SLGLLIILEECMWPIEDRLEALEEISQETFT
Sbjct: 721  ISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIEDRLEALEEISQETFT 780

Query: 781  MFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAG 840
            MFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAG
Sbjct: 781  MFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAG 840

Query: 841  TNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYA 900
            TNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYA
Sbjct: 841  TNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYA 900

Query: 901  VFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYR 960
            VFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYR
Sbjct: 901  VFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYR 960

Query: 961  VMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNFGME 1020
            VMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNFGME
Sbjct: 961  VMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNFGME 1020

Query: 1021 EEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESF 1080
            EEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESF
Sbjct: 1021 EEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESF 1080

Query: 1081 LKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSL 1140
            LKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSL
Sbjct: 1081 LKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSL 1140

Query: 1141 KNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVTYMERHTA 1189
            KNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVTYMERHTA
Sbjct: 1141 KNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVTYMERHTA 1189

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score = 1432 bits (3708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1181 (59%), Positives = 888/1181 (75%), Gaps = 4/1181 (0%)

Query: 4    ESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEA 63
            ++ ++FD+ FYTPIS S++G +LC+L+NG+LV LISDP+DT  S SVSVA+GSH DPDE 
Sbjct: 6    DAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEV 65

Query: 64   LGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGEL 123
            LGLAHLCEH ILS GSKK+P +++YHE++AQNGGSHNA            LPA +DSGEL
Sbjct: 66   LGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGEL 125

Query: 124  HFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFS 183
             FDK LD LASS K P+FSD  INKEIYAIESEHN+NKA   KQLYHA+RLLANP HPFS
Sbjct: 126  LFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFS 185

Query: 184  RFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFG 243
            RFCTGNF TLC  P+L+K N+KA L  + K  Y  + M+LCLRG QSLN L KLA ++FG
Sbjct: 186  RFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFG 245

Query: 244  DLPAS-GQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVR-AFSQGSSNVVAIQ 301
            DLPAS  ++  RP      S+   +Q + + + L ++ + +   V+ AF   +SN+VAIQ
Sbjct: 246  DLPASRDRDPTRPPLKKRPSSGVASQDL-HVRPLDFKNSKQQTQVQDAFVPDTSNLVAIQ 304

Query: 302  SSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVSS 361
            SSK PVLRL+FPVSHKSTRL+S+DI   S  WCDFFGDE VGSL  CLK   LI+G+V+S
Sbjct: 305  SSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVAS 364

Query: 362  VSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIEL 421
            V+HF+               GW +   I+ +LFD +IP+LIHDKT+DIA+CLSELN  +L
Sbjct: 365  VAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCTDL 424

Query: 422  LKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTES 481
            L FLYQ  EKS M+MCA LS+ LL   ETLDPKCLLKGSPLIECNQ  S IGDYSE+TES
Sbjct: 425  LTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSESTES 484

Query: 482  QTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIAYV 541
            +TWWIGRAIKFQN VSEFVNRQNLR VMLG+  KS+ L+SV S +KTDAYYEF Y+I+ +
Sbjct: 485  RTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQISKI 544

Query: 542  DMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRSDF 601
            DMLS++ + Y  P + F  P YD FLP V RKL LIKQALQ SS R+Q++ L ++ R+ +
Sbjct: 545  DMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVARNAY 604

Query: 602  LQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLA 661
            LQT PRLAGKNSN+E+WVKEE+ DLSF SKSI+S E+ SK++ A P  TM LE+L QLL 
Sbjct: 605  LQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLAQLLG 664

Query: 662  GTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDII 721
             +LS  LYPSEKLGYTYEISPS+KG  RL  T+SGFPEGV  ++++I+++ KS  + D +
Sbjct: 665  DSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLINSDTV 724

Query: 722  SSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTM 781
            +  +FR+AR+AVR+KYEE          +LGLLI+LEECMWP+EDRL+ALEEI  E+F  
Sbjct: 725  TPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDRLDALEEIDIESFRT 784

Query: 782  FCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAGT 841
            FCS F++ PTY+N+F QGD+S  E+I++FL   LTSHL     ++  VREP    LK GT
Sbjct: 785  FCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTHALKPGT 844

Query: 842  NIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAV 901
            N+F++R+AF +DP++SIVYFIQTG+R+DA+  + TCL EF +S+TLVPDLR KKQIGYAV
Sbjct: 845  NMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAV 904

Query: 902  FGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRV 961
            F GLRLLST++GLHITCMS+SPPEHLE QI++YL+Y+E  +L  M+EEEFQE YIRK+R 
Sbjct: 905  FSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRA 964

Query: 962  MVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNFGMEE 1021
            M E   V      AGPADL+ QIEANV SGNL EQG+AMR HK  +NQIS  RYNF  + 
Sbjct: 965  MFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDL 1024

Query: 1022 EPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFL 1081
            EP +  +LR +TL +FR FF EKISI S  RSKLSVM+ASP++A+EI++KRLFLQ+ES+L
Sbjct: 1025 EPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYL 1084

Query: 1082 KLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLK 1141
            KLKGLKI SS+L  I+E+S G+ S ++RGLF++F A GET++LCNVI+KE+SKA+VLSLK
Sbjct: 1085 KLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKAVVLSLK 1144

Query: 1142 NPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVT 1182
                       L+ + K V++A+PL E++  N FR  + VT
Sbjct: 1145 PRPTNNNSAGVLQNVRKEVSTAVPLIEVQ-ANHFRQRSPVT 1184

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1189 (47%), Positives = 766/1189 (64%), Gaps = 21/1189 (1%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS    +NFD+ FYTPIS SSR  ++ QL NGMLV LIS+P++   SC++SVATGSHNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             E LGLAH CEH ILS GSK YP  N YH+V+++NGGS NA            LP +S+S
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
             EL FDK LD+ +SS K PLF+++L+NKEIYAI SEH  NK+   K  YHA+RLLAN  H
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS+F TG+ TTL  +  LNK +++  +  + K  +   NM LC++G QSLNTL KL   
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  FFGDLPASGQNIARPS----------SSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAF 290
             F D+   G  I+RP            S  FSN G    +  FKIL   W  KY +V  F
Sbjct: 241  KFNDI--KGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIF 298

Query: 291  SQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCL 349
            +   + N V + S K P LRLIFP+ H+ TRL+  +I   S  WC+ FGDES GSL   +
Sbjct: 299  TGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFM 358

Query: 350  KGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDI 409
            K    I+ + + +SHFA               GWKN+  I+ + F+ Y+P +I   T ++
Sbjct: 359  KKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYEL 418

Query: 410  ARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEH 469
            A  LSELN IELLKFLYQ    S M+ C+NLS+ LL D+E+L P  +LKG+P+ +CN+  
Sbjct: 419  AEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEID 478

Query: 470  SRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTK-- 527
            S +G ++E+ ES+ WWIG AIKFQ+ + EF+N +N+R V++GD  +   + +  ++ K  
Sbjct: 479  SELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLN 538

Query: 528  TDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTR 587
             + YYEF+Y     D  + +L      +Y FH P  + FLP V   LSLIK AL  SS R
Sbjct: 539  IEPYYEFEYHKCRSDQSNFKLT-VEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNR 597

Query: 588  AQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASP 647
            +Q+A+L L  ++      P+L GKN  YE+WVKEE+ +L+F SKSIV+FEIIS  +   P
Sbjct: 598  SQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEP 657

Query: 648  KNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLI-K 706
              TM LEIL +LL   LS+ LYPSEK+GYTYEI+ SSKGDVR+G TVSGF EGVY +I K
Sbjct: 658  SYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEK 717

Query: 707  IIVEEIKSFSSRDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIED 766
            I+   ++   S  +I+  +FR++RIAVR+KYEE          ++GLLI+LE+ MW +E 
Sbjct: 718  IVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLES 777

Query: 767  RLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQ 826
            RLEALE    E+F  F S F  + TYMNLFIQGD +  ++IN FL  +LT HL   R+  
Sbjct: 778  RLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAV 837

Query: 827  GPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLT 886
              + EP + ILK G+N+F+    F DDPNNSIVYFIQTG+R D  +YT T    F +SLT
Sbjct: 838  KILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLT 897

Query: 887  LVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTM 946
            LVPDLR +KQ+GY V GGLR LS+++GLHIT  S+SPP  LE +I EYLSYLEK LLD +
Sbjct: 898  LVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNL 957

Query: 947  TEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNT 1006
              + F+E Y+++Y  ++ + ++ + ++   P +LM +I+ANVRSGNL+  G  M+ H+  
Sbjct: 958  KPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRI 1017

Query: 1007 KNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAE 1066
            + QIS++RYNF  E+EP++  ++ ++    +  FF +KISIYS  RSK+SVM++SPM+  
Sbjct: 1018 RAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRS 1077

Query: 1067 EISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCN 1126
            EI  +++FLQ+ESFLKLKG KIS   L  I+  S G+ + +++ LFRYF++ GE++K+C 
Sbjct: 1078 EIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICT 1137

Query: 1127 VIIKEISKALVLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQF 1175
            V++KEI++ L  SLKN   R   +      S  V    PLTEI D + +
Sbjct: 1138 VMLKEITRQLSSSLKNLGARKSPNFERPNGSPTV----PLTEIVDPDAY 1182

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1193 (46%), Positives = 769/1193 (64%), Gaps = 32/1193 (2%)

Query: 9    FDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAH 68
            FD+  YTPIS S R  ++ QLSN +L  LISDPS+T+ SC++SVATGSHNDP E  GLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELH-FDK 127
             CEH +LS GSKKYP  N++HE L +N GS NA            +P  + S ELH F++
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTT-SAELHVFEQ 128

Query: 128  ALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCT 187
             +D+LA+S K P+F DIL+NKEIYAI SEH  NK+ + K LYHA+RLLAN +HPFS F T
Sbjct: 129  LIDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFST 188

Query: 188  GNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP- 246
            GN  TL  +P +NK N+K  L  + K +++   M +C+RGSQSLN L+KLA   FGD+P 
Sbjct: 189  GNVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPG 248

Query: 247  --ASGQNIARP-------SSSSLFSNKGTAQSMPYF---KILKYEWTPKYKDVRAFS-QG 293
              A+G   + P       SS+S+ S+  T+ ++      +ILK  W P+Y     F+ + 
Sbjct: 249  SAAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPVFTPRP 308

Query: 294  SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCG 353
              N + IQS K PV+R IFPV++ STR +  +I T++  WCD  GDE  GS    L+   
Sbjct: 309  KYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLRQNN 368

Query: 354  LISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCL 413
             IS +++  S FA              +GW N+  I+ + +   +  ++      I + L
Sbjct: 369  YISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSKIGQYL 428

Query: 414  SELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLI-ECNQEH-SR 471
            SELN+I+LLKFLYQ  E+SPM+ CA L   L+ DL  + P  +LK S L+ +CN     +
Sbjct: 429  SELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCNDPRIQK 488

Query: 472  IGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAY 531
            IG YSE+  S  WW G+AIKFQ  V EF   +N++ +MLG  SK  F ++    T  D +
Sbjct: 489  IGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSNSMQLT-ADTH 547

Query: 532  YEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSA 591
            YE+DY  AY+++  ++  D     Y FH PS + FL  V  KLS IK+AL  +S +++++
Sbjct: 548  YEYDYLKAYIEITELEAIDN---EYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQSENS 604

Query: 592  SLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTM 651
            SL ++ +SD LQT P LAGKN+ YE+W KEE+++LSF SKSIVS E+IS ++  +P+ TM
Sbjct: 605  SLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAPEYTM 664

Query: 652  YLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEE 711
             LEILGQLL   +S  LYP+E+ GYTYE+S SSKGDVRLG+T+SGF EG+  ++ II++ 
Sbjct: 665  QLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNIILDS 724

Query: 712  IKSFSSRDI-ISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEA 770
            +       + IS  +FR AR+ VR+KYEE          SLGLLI+LE CMW +EDRL A
Sbjct: 725  LLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLEDRLNA 784

Query: 771  LEEISQETFTMFCSHFLTSPTYMNLFIQG-DMSCMEKINSFLKWSLTSHLEDTREYQGPV 829
            LE+I  E+F  F   F+    Y+NL +QG D+S  +K+N  +   LT H+      +  +
Sbjct: 785  LEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLETGKNIL 844

Query: 830  REPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP 889
             EP    +  G+N+ VK++   DDPNNSIVYFIQTG R++  AYT T   EF +S+TLVP
Sbjct: 845  VEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEFLMSMTLVP 904

Query: 890  DLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEE 949
            DLR KKQIGY V GGLR+LS ++GLHIT MS++PPE+LE +I+EYLSYLE  +L  +  E
Sbjct: 905  DLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESMVLMKLNNE 964

Query: 950  EFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGS-AMRLHKNTKN 1008
            +F+ +Y+ K+  +VE+N +++++KT+GPA+LM QIEANVRSG+  + GS AM+ HK  +N
Sbjct: 965  QFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGS--QNGSMAMKSHKRIRN 1022

Query: 1009 QISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEI 1068
            QIS RRYNF  E+EP+N   +R +TL E+ +FF EKIS+YS  R+K+SVM+ SPM+ +E+
Sbjct: 1023 QISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVTSPMSKDEV 1082

Query: 1069 SQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVI 1128
              K +FLQ+ESFLK+KG  I S DL  II  S G+ + +L+ LF YF   GE++KL   I
Sbjct: 1083 QSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGESIKLLTAI 1142

Query: 1129 IKEI-----SKALVLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFR 1176
            +KEI     +K    + K  +  T     L+ +S+ V  A+PL E+ DVN +R
Sbjct: 1143 VKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDVNSYR 1195

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/1184 (45%), Positives = 764/1184 (64%), Gaps = 21/1184 (1%)

Query: 9    FDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAH 68
            FD+  YTPIS S+R  ++ +L+N +L FLISDPS+TV SC+VS+ATGSHNDP E  GLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   LCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKA 128
             CEH +LS GSK++P  N +HE L++N GS NA            LP+   S  L FD+ 
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTG 188
            + +LA +LK P+F D+LINKEIYAI SEH  NK+ + K +YHA RLLA+P HPF +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  NFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
            N  TL  +P L+K ++K  L  + + ++   NM LCLRG QSLN L+K+A   F D+P S
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP-S 248

Query: 249  GQNIARP------SSSSLFSNKG-TAQSMPYFKILKYEWTPKYKDVRAFSQGS-SNVVAI 300
               +  P      SSSS   N+  + + +  F+ILK  W+ +Y     F +    N + +
Sbjct: 249  IPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMV 308

Query: 301  QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS 360
            QSSK PV+R +FP+++ STR +  ++ T++  WC+  GDE  GSL   L+    I+ +++
Sbjct: 309  QSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIA 368

Query: 361  SVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE 420
              S+FA              HGW N+  I+ I++   IP ++      +A+ +SELN+++
Sbjct: 369  YSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLD 428

Query: 421  LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGS-PLIECNQ-EHSRIGDYSEN 478
            LLKFLYQ  E+SPMD CA+L   LL DL  +D   LLK +    ECN    + +G Y EN
Sbjct: 429  LLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYREN 488

Query: 479  TESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRI 538
              S+ WW G A+KFQ  V+EF+++  +R ++LG+ SK  F  +    T TD Y+E++Y  
Sbjct: 489  QTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKIT-TDTYFEYEYVK 547

Query: 539  AYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPR 598
             ++D+  +  DD    +Y F  P  + F+  V  KLS IK AL  SS ++++++L ++ +
Sbjct: 548  IFIDLEVLGCDDI---HYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQ 604

Query: 599  SDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQ 658
            SD ++  PRLAGKNS YE+W+KEE++DLSF SKSI S E+IS S+  +P+ TM+LEILGQ
Sbjct: 605  SDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQ 664

Query: 659  LLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR 718
            LL   L   LYP+E+ GYTYE+S SSKGDVRLGLT+SGF +G+ NL+KIIV+ I + S  
Sbjct: 665  LLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQD 724

Query: 719  -DIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQE 777
             + I   +FR+ARI VR+KY+E          SLGLLI+LE CMWP+EDRLEALE+I  E
Sbjct: 725  LNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVE 784

Query: 778  TFTMFCSHFLTSPTYMNLFIQG-DMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKI 836
            +F +F   F+    Y+N+ IQG DM+  + IN +L   LT H+    +    + EP   +
Sbjct: 785  SFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATYV 844

Query: 837  LKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQ 896
            +  G+N+F KR  F DDPNNSIVYFIQTGER++   YT T L EF +S TLVPDLR KKQ
Sbjct: 845  IPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQ 904

Query: 897  IGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYI 956
            IGY V GGLR+LS ++GLHIT M+ SPPE LE +I EYL+YLE  +L  +T  +F+  Y+
Sbjct: 905  IGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYV 964

Query: 957  RKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYN 1016
             +   ++ +N + +++KT+GPA+LM QIEANV SG       AM+ HK  + QIS RRYN
Sbjct: 965  DELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQ-RNTSLAMKSHKRLRTQISYRRYN 1023

Query: 1017 FGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQ 1076
            F  ++EPV+   L+ + LSE+  FF ++ISIYS KR+KLS+M+ S M+ EE+  K L+LQ
Sbjct: 1024 FDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQ 1083

Query: 1077 VESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKAL 1136
            +ESFLK+KG  I S DL+ I++ S G+ + +L+GL  YF + GE++KL + +++E+ K L
Sbjct: 1084 IESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVKQL 1143

Query: 1137 ---VLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRN 1177
                    + S  +    +L+ +S+ VT A+ L ++ +VN +R+
Sbjct: 1144 FSKATPDSSSSTPSGTHGSLQAMSQHVTPAITLEQVPEVNSYRS 1187

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1198 (41%), Positives = 726/1198 (60%), Gaps = 27/1198 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS++  +N+D  FY P   S R  KLC+L NG+L  LISDP DT+ +CS+SVATGSHNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             +  GLAHLCEH +L+ GSK YP A  YH +L +N G+ NA            +P   +S
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GEL FDK +DV +S  K PLF+ +L NKEIYAI+SEH  N + + K LYHA+RL+AN  H
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS+F TGN  TL ++P L K N+K AL  +  R +  S M+LC+RG QS+NTLTKL + 
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  FFGDLPAS--------GQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQ 292
             FGD+ A+        G   +R S SS  S +     +  + ILK  W PKY++   F+ 
Sbjct: 241  KFGDIRANNGLKRSKFGSISSRLSISSFQSKERQPTDLEQYNILKSTWKPKYREAPCFTH 300

Query: 293  --GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLK 350
               S+N++ I+S+K   LR +FPV  K ++ SS  ++ F + WC+ FGDE+ GSL   L 
Sbjct: 301  DSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSLCYLLV 360

Query: 351  GCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIA 410
            G   I+   +  S F+               GW N+  I+ I+ D+ I   I   T+ ++
Sbjct: 361  GKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDKPTDQLS 420

Query: 411  RCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLI-ECNQEH 469
              L E N I+L++FLYQ TEKSPM+ C+N+S  L  DLE LD   L KG+P I +C    
Sbjct: 421  CFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISDCYSND 480

Query: 470  SRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTD 529
            +   D  E    Q  W+ +A +FQ  +  F+NR N+   +LG++  ++   S+RS  +  
Sbjct: 481  NNTVDMIE--YEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAH---SLRSIIRIR 535

Query: 530  AYYEFD-YRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRA 588
             +       +  ++++ ++     +  Y F  P  + F+P   + +++++Q    SS ++
Sbjct: 536  YFLLMQCMSLNILNVIYLRFPKLLSTQYTFQVPPPNAFIPPSCQDVTILQQLFLESSLKS 595

Query: 589  QSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPK 648
            + ++  L   +  L   P L  +NS+YE+W  +  +D S   KSI+SFEI ++S+  SP+
Sbjct: 596  RFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRSMIPSPE 655

Query: 649  NTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKII 708
            N++ LEIL Q+L+  +S  LYPS +LGY+YEIS S KGD++L +T+ GF EG+ +++  I
Sbjct: 656  NSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGIISILDTI 715

Query: 709  VEEIKSFSSRDIISSK-VFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDR 767
            V+ +          SK + R +R+ VR+ YE           S+GLLIILE  MW ++DR
Sbjct: 716  VKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNMWTLQDR 775

Query: 768  LEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTR-EYQ 826
            LEALEEI   +F  FC  FL  P YMNL IQG++   E+IN++L  +LT HLE +  + +
Sbjct: 776  LEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNLTHHLECSNVKNE 835

Query: 827  GPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLT 886
                     +L+ G+N + K N   DDPNNSIVYFIQTG R + R  T T   E+ +SLT
Sbjct: 836  KQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTYFTEYIMSLT 895

Query: 887  LVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTM 946
            LVPDLRNK+QIGYAVFGGLR L+++IG+HIT MS   P  LE++I+EY++YLE+ LL+++
Sbjct: 896  LVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAYLEETLLNSL 955

Query: 947  TEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSA-MRLHKN 1005
            TE +F   Y + Y  ++ N++   ++K+ GPADL+ ++ ANV+SGN +E  S  M+ HK+
Sbjct: 956  TENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELNSHFMKSHKH 1015

Query: 1006 TKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTA 1065
              N+ISN+RY F  + E V+ ++++ +T  EF  FF EK+SI S  RSK+SVMI SPM  
Sbjct: 1016 FFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKISVMIESPMAE 1075

Query: 1066 EEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLC 1125
             EI  ++ FLQ+++FLKL+G  I+S  L DI+E + GR S +++ LF+YF    E ++LC
Sbjct: 1076 MEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFRERNEALRLC 1135

Query: 1126 NVIIKEISKALVLSLKN-------PSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFR 1176
             VI+KE+ K    SLK+        S+      +     +    A+PL EIKD+N+F+
Sbjct: 1136 TVILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQDTEPAIPLKEIKDLNEFK 1193

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1219 (40%), Positives = 721/1219 (59%), Gaps = 50/1219 (4%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS+   KN+D+ FYTPIS   R +KLC+L NGMLV LISDP ++   CS+SVATGSHNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             E  GLAHLCEH IL+ GSKKYP    YHE++A+N G  NA            LP ++ +
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
                F+  +DV AS  K PLF+  L +KEIYAIESEH  N +   K  YHA RLLAN +H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS F TGN  TL + P L K N+K+ L S+ K  +K  NM+LC++G QS+N LTK+AIR
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  FFGDL--------PASGQNIAR------------PSS-------SSLFSNKGTAQSMPYF 273
            +F D+        P     I +            PSS       SS+ S   T  S+   
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSE--TNSSLLST 298

Query: 274  KILKYEWTPKYKDVRAFS-QGSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSST 332
            KIL+  W+PKY ++  F  +   N + ++S+K PVLRL+FPV     + S  ++ TF + 
Sbjct: 299  KILENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNL 358

Query: 333  WCDFFGDESVGSLADCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCI 392
            WC+  GDES  S+ + L     I+ I++  S FA               G  N+  I+  
Sbjct: 359  WCETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINS 418

Query: 393  LFDDYIPKLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLD 452
            + +  IPKL  + TE++AR LSE ++I+LL FL++ +E SPM+ C++LS  +  DL+ L 
Sbjct: 419  IMESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILK 478

Query: 453  PKCLLKGSPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGD 512
            P+CL K SP+I  N+ +  IG++ E++ES+ WW+ +A  +Q  +  ++N+  LR  +L D
Sbjct: 479  PECLFKQSPMIVGNK-YPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCD 537

Query: 513  QSKSNFLASVRSTTK--TDAYYEFDYRIAYV---DMLSIQLDDYTAPNYHFHAPSYDTFL 567
             S+  +     S  K  TD +YEFDY    V    +   Q+D ++  N  F  P+ + ++
Sbjct: 538  FSEKQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFS--NLKF--PAKNEYI 593

Query: 568  PMVARKLSLIKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLS 627
            P + R L  +++ L+  S  ++S  L L   S   +  P+LA K   YE+WV E++   S
Sbjct: 594  PELGRSLLYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPS 653

Query: 628  FSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGD 687
               K+IV+F+++S  V  +PKNTM+LEILGQ+L   LS  LYPS KLGYTYEI+ SSKGD
Sbjct: 654  TEKKTIVTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGD 713

Query: 688  VRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEXXXXXXX 746
            VRL  T+SG+ +G+  ++K +++   + +  D I SK + R ARI  R KYE        
Sbjct: 714  VRLSFTLSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCA 773

Query: 747  XXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEK 806
               S+GL+I+LE+ +WP+EDRL ALEE    +F  FC  FL S  Y+NL +QG++ C  +
Sbjct: 774  KLASVGLIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANE 833

Query: 807  INSFLKWSLTSHLEDT--REYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQT 864
            IN +L  S T+HL +   +  +        K+L+ GTN   +     DDPNN IVYFIQT
Sbjct: 834  INKYLNDSFTNHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQT 893

Query: 865  GEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPP 924
            G+R+D +A   T   E+ LSLTLVPDLRNKKQIGY VFGG+R+LS ++G+HIT MS S P
Sbjct: 894  GKRDDKKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNP 953

Query: 925  EHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQI 984
              LE +I+EYL +LE  +L  ++EE+F + +++ Y   +  +    M  TAGP +++  I
Sbjct: 954  LDLEEKIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGI 1013

Query: 985  EANVRSGNLEEQGS-AMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSE 1043
             ANV++G+     S  M  H+  KN+I+++RYNF  ++   + + ++ +TL ++  FF E
Sbjct: 1014 AANVQAGDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEE 1073

Query: 1044 KISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGR 1103
             ISI S+ RSKLSV I SPM  +EI  ++ FLQ+E FLKL G  I++  L  ++  S GR
Sbjct: 1074 NISISSVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGR 1133

Query: 1104 TSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKN------PSQRTRVDDALRGLS 1157
               + + LF YFS  GE  K C ++  E+ K + +S+K       PS +      ++  S
Sbjct: 1134 PGKLFKLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFPSSKQSDSSNIQTWS 1193

Query: 1158 KIVTSALPLTEIKDVNQFR 1176
              V  A+ LT++ DV+ F+
Sbjct: 1194 SSVKPAITLTKVNDVHIFK 1212

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1207 (40%), Positives = 709/1207 (58%), Gaps = 34/1207 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS     N+++ F+ P+S S+R  K+C+L NG+L  LISDP+DT  SCS+SV TGSHNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             +  GLAHLCEH ILS GSKKYP    +H ++A+N GS NA            LP   ++
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GE  F+  LDV AS  K PLF+ +LI+KEIYAI+SEH  N +   K  YHA+R+LAN  H
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRF TGN  +L ++P L K N+K++L ++ +  +   N++LC+RGSQS+N LTKLAI 
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  FFGDL-PAS---------GQNIARPSSS---SLFSNKGTAQSMPYFKILKYEWTPKYKDV 287
             FGD+ P S         G+   R S+S   SL S K   +++  FKIL   W  KY++ 
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDFKILDTVWEKKYQNT 300

Query: 288  RAFSQGSS-NVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLA 346
              F      N + I S+K PV+R +FPVS ++TR +  DI  +S  WC+ FGDES GSL+
Sbjct: 301  MCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 347  DCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKT 406
              L   G I+   +  S FA               GWK+I  I   +F + +P       
Sbjct: 361  HYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSFYVKNI 420

Query: 407  EDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG-SPLIEC 465
            + +   L E N I+L +FLYQS+E  PM+ C+NLS++L  +LE L P  + KG   LIE 
Sbjct: 421  DHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFKSLIEI 480

Query: 466  NQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASV--R 523
            +  +  I  Y E   +  WW G+AIKFQN +   +   N R ++LGD         +  +
Sbjct: 481  DDPN--IEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHIIENK 538

Query: 524  STTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQV 583
            S  +TD +YEF+Y    V  L+ +   Y   +Y F+ P  + FLP        ++Q    
Sbjct: 539  SEIRTDFFYEFEYYTGSVH-LAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLFLE 597

Query: 584  SSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSV 643
             S +++ A+L     S+  +  P+L  +N NYE+W+ +E+ + + ++KS+VSFE++   +
Sbjct: 598  CSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGLGI 657

Query: 644  CASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYN 703
              SP+ T++LE+L Q+L    S+ LYP+ ++GYTYEI+ SSKG V L  T+SGFPEGV+ 
Sbjct: 658  KPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGVFK 717

Query: 704  LIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMW 762
            ++K  V+ +K  ++     SK   R+ARI VRSKYE           S+GLLI+LEE +W
Sbjct: 718  IVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEFIW 777

Query: 763  PIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHL--- 819
             ++DR+ ALE    E+F  FCS F  +P  + L +QG +   ++IN +L  + T HL   
Sbjct: 778  TLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLKVC 837

Query: 820  -EDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCL 878
             E ++        P  K L  GTN F+  N   DDPNNSIVYFIQT +R+D      T L
Sbjct: 838  NEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENLALTFL 897

Query: 879  AEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYL 938
             E+  SLTLVPDLRN+KQIGY V GGLR+L+ ++G+H+T MS S   +LE +I EYLSYL
Sbjct: 898  TEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINEYLSYL 957

Query: 939  EKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG-NLEEQG 997
            E  +LD +TE +F++  +  +  +++ N + + +++AGP DL+ +I ANV++G N     
Sbjct: 958  ELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDNYTLNN 1017

Query: 998  SAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSV 1057
              M+ H+  +N+I+ +R NF  E E VN   L+ +TL ++  FF  KISIYS +RSK+S+
Sbjct: 1018 RQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISI 1077

Query: 1058 MIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSA 1117
            MIASPM  E+I+ +R+FLQ+E+FLK+KG  I + DL  I+E S G    +++ LF +F  
Sbjct: 1078 MIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRK 1137

Query: 1118 NGETMKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLTEI 1169
              E  KL  V+++EI K + ++ K          S  +   D        +   +PL E+
Sbjct: 1138 RNEAFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVIPLQEL 1197

Query: 1170 KDVNQFR 1176
             D N FR
Sbjct: 1198 PDPNFFR 1204

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1172 (41%), Positives = 719/1172 (61%), Gaps = 28/1172 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS++  K+FD+  Y P++ S+R  KLC L NG+L  LISDP+DTV SCS+SVA+GSHNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             +  GLAHLCEH IL+ GSK YP    YHE L++N G HNA            +P +   
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GEL FD+ LD+ AS  K PLF+ +L NKEIYAI+SEH+ N + V K LYHA+R+L++P H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS+F TGN  TL ++P L   N++  L  + K+ Y  S M+LCLRG QS+N LTK A+ 
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  FFGDLPASGQNIARPSSSSL------------FSNKGTAQSMPYFKILKYEWTPKYKDVR 288
             FGD+  +   + R    S+              N  T   +  F IL+  W  KY D+ 
Sbjct: 241  KFGDIKENTA-LTRSRFGSMSSISTKRSSKSSTENHSTKNDLESFNILEESWRQKYCDIP 299

Query: 289  AFSQGS-SNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLAD 347
             F + S  N++ I+SSK P LR++FPV+   TR +  +I  F   WC+ FGDE+ GSL  
Sbjct: 300  CFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLCY 359

Query: 348  CLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTE 407
             L G   I+   +  S FA               GW+N  TI+ I+    +         
Sbjct: 360  YLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYVH 419

Query: 408  DIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQ 467
            ++A  + + N+I+L++FLYQ  +K+PM+ C+NLS  L  DL+  +   + KGSP I    
Sbjct: 420  ELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDMH 479

Query: 468  EHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLG--DQSKSNFLASVRST 525
            E +  G  SE+  +Q WWI +AIKFQ+ + +F+N  N R ++LG  ++    F   +++T
Sbjct: 480  EGNVGGINSEH--NQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQNT 537

Query: 526  TKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSS 585
              T+ +YEF+Y+I+ +++ + Q    +   Y F  P  + F+P   +   +++Q    SS
Sbjct: 538  LTTEPFYEFEYKISTINLKASQ----SVNTYEFCIPHKNKFIPSACKGDGVLEQLFLESS 593

Query: 586  TRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCA 645
             ++Q ++LHL   S   +  P+L G+N  YE+W  +E+L+     KSIVSFE++S  +  
Sbjct: 594  LKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKG 653

Query: 646  SPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLI 705
            SP+NT++LEIL Q++   +S  LYP+ KLGY YEIS SSKGDV+L  T+ GF EG+  LI
Sbjct: 654  SPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLI 713

Query: 706  KIIVEEIKSFSSR-DIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPI 764
            +II++ I   ++  D  S ++ R AR+ VRS YE           SLGLLI+LEE MW +
Sbjct: 714  EIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSL 773

Query: 765  EDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTRE 824
            EDR++ALE+++  +F  FC  FL    Y+ LFIQG++S  +KIN FL  + T HL+  ++
Sbjct: 774  EDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHLDINKD 833

Query: 825  YQGPVR-EPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFL 883
               P+       ILK GTNIF +     DDPNNSIVYFIQTG R D    T T   E+ +
Sbjct: 834  TSLPLNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEYIM 893

Query: 884  SLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLL 943
            SLTLVP+LRNKKQIGY V GGLR+L+ +IG++IT MS S P  LE +I+EY++++E  +L
Sbjct: 894  SLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENGVL 953

Query: 944  DTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGS-AMRL 1002
            + +TE  F+  Y + Y  ++ +N  N+  K +GPA+L+ +I  NV+ G+ ++  S +M+L
Sbjct: 954  NRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSMKL 1013

Query: 1003 HKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASP 1062
            H+  +NQIS+++YNF  EE  ++  ++  +TLS + +FF +KISI+S  RSKLS+MI S 
Sbjct: 1014 HRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMITSS 1073

Query: 1063 MTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETM 1122
            M A++I  ++ +LQ+E+FLK+KG  I    L +I++++ G +S +++ LF YF +  E  
Sbjct: 1074 MAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNEGW 1133

Query: 1123 KLCNVIIKEISKALVLSLK---NPSQRTRVDD 1151
            KLC V++KE+ K  + SLK   N S  T+ +D
Sbjct: 1134 KLCTVVLKEVVKMSITSLKQHYNWSLSTKKED 1165

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1207 (40%), Positives = 697/1207 (57%), Gaps = 34/1207 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS     N+++  Y P+S S+R  K+C+L NG+L  LISDP+DT  SCS+SV TGSHNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             + LGLAHLCEH IL+ GSK+YP A  +H ++A+N GS NA            LP    +
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GE  F+  LDV AS  K PLF+ +LI+KEIYAI+SEH  N +   K  YHA+RLLAN  H
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRF TGN  +L ++P L K N+K +L ++ K  Y   N+++C+RG QS+N L KLAI 
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  FFGDLP----ASGQNI---------ARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDV 287
             FGD+       G N          +R   S+   +K   + +  FKIL+  W  KYK+ 
Sbjct: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300

Query: 288  RAFSQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLA 346
            + F      N + I S+K PV+R +FPVS K+TR +  DI  +S  WC+ FGDES GSL 
Sbjct: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360

Query: 347  DCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKT 406
              L   G I+   +  S FA               GW++I  I   +F   +P       
Sbjct: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420

Query: 407  EDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG-SPLIEC 465
            + +   L E N I++ +FLYQS+E  PM+ C+NLS  L  +LE L P  + KG   LIE 
Sbjct: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480

Query: 466  NQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASV--R 523
            +  +  I  Y  +  +  WWIG+AIKFQN +   +N +N R ++LG+         +  R
Sbjct: 481  DDPN--IDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKR 538

Query: 524  STTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQV 583
            S   TD +YEF+Y    VD L+   + Y    Y F+ P+ + FLP        ++Q    
Sbjct: 539  SEMYTDFFYEFEYYTGKVD-LTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLE 597

Query: 584  SSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSV 643
             S +++ A+L    +S+  +  P+L  KN NYE+WV +E+ +    +KSIVSFEI+   +
Sbjct: 598  CSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGI 657

Query: 644  CASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYN 703
              SP+ T++LE+L Q+L    S+ LYP+ ++GYTYEI+ SSKG+V L  T+SGF EGVY 
Sbjct: 658  KPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYT 717

Query: 704  LIKIIVEEIKSFSS-RDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMW 762
            + K  V+ +K  ++    +S    R+ARI VR KYE           S+GLLI+LEE MW
Sbjct: 718  IAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMW 777

Query: 763  PIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDT 822
             ++DR++ALE     +F  FC  F  +P  + L IQG++   ++IN +L  + T HL+ +
Sbjct: 778  TLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVS 837

Query: 823  REYQGPV----REPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCL 878
             E   P       P  K L  GTN FV  N   DDPNNSIVYFIQT +R D  + T T L
Sbjct: 838  NEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFL 897

Query: 879  AEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYL 938
             E+  SLTLVPDLRNKKQIGY V GGLR+L+ ++G+HIT MS  P  +LE +I EYLSYL
Sbjct: 898  TEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYL 957

Query: 939  EKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG-NLEEQG 997
            +  +L+T TE +F+   +  +  +++ N  N+++ ++GP +L+ +I ANV++G N     
Sbjct: 958  QLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNN 1017

Query: 998  SAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSV 1057
              M+ H+  +N+I  RR++F  E E  +   L+ +TL  +  FF  KISIYS +RSKLS+
Sbjct: 1018 RQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSI 1077

Query: 1058 MIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSA 1117
            MI SPM  E+I  +++FLQ+E+FLK+KG  I S DL  I++ S G    +++ LF  F  
Sbjct: 1078 MITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRR 1137

Query: 1118 NGETMKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLTEI 1169
              E  KL  V+++EISK +++S K         P  +    D  +     +   +PL  +
Sbjct: 1138 RNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGL 1197

Query: 1170 KDVNQFR 1176
             D N FR
Sbjct: 1198 PDPNVFR 1204

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1209 (40%), Positives = 710/1209 (58%), Gaps = 38/1209 (3%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS     N+++ FY P+S S+R  K+C+L NG+L  +ISDP+DT  SCS++V TGSHNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             +  GLAHLCEH ILS GSKKYP    +H ++A+N GS NA            LP   ++
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GE  F+  LDV AS  K PLF+ +LI+KEIYAI+SEH  N +   K  YHA+R+LANP H
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRF TGN  +L ++P L K  +K++L ++ +  +   N++LC+RG QS+N LTKLA+ 
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  FFGDLPASGQNIARP---------SSSSLF----SNKGTAQSMPYFKILKYEWTPKYKDV 287
             FGD+        R           S SL     S+K     +  FKIL   W  KYK+ 
Sbjct: 241  KFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYKNT 300

Query: 288  RAFSQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLA 346
              F Q    N + I S+K P++RL+FPVS K+TR +  DI  +S  WC+ FGDES GSL+
Sbjct: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 347  DCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKT 406
              L   G ++G  +  S FA               GW+NI  I  I+ +  +P       
Sbjct: 361  YYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVMNI 420

Query: 407  EDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG-SPLIEC 465
            + +   L E N I+L+ FLYQS+E  PM+ C+ LS  L  DLE L P  + KG   LIE 
Sbjct: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480

Query: 466  NQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRST 525
            +  +  I  Y     +  WW G+AIKFQN +  F+N  N+R ++LG+    N    +++ 
Sbjct: 481  DDPN--IEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNK 538

Query: 526  TK--TDAYYEFDYRIAYVDMLSIQLDD--YTAPNYHFHAPSYDTFLPMVARKLSLIKQAL 581
            +   TD +YEF+Y  A V + S   D+  ++  +Y F+ P+ + FLP        ++Q  
Sbjct: 539  SDICTDFFYEFEYYTANVHLAS---DNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLF 595

Query: 582  QVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISK 641
               S +++ A+L     S+  +T P+L  +N NYE+W+ +E+ + +  +KS+VSFE++  
Sbjct: 596  LECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGL 655

Query: 642  SVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGV 701
             +  SP+ T++LE+L Q L    S+ LYP+ ++GYTYEI+ SSKG+V L  T+SGFPEGV
Sbjct: 656  GIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGV 715

Query: 702  YNLIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEEC 760
            + ++K  V+ +K  ++     SK   R+ARI VR+KY+           S+GLLI+LE+ 
Sbjct: 716  FTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKY 775

Query: 761  MWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLE 820
            +W +EDR+ ALE    E+F  FC  F  +P ++ LF+QG +   + IN +L  + T HL+
Sbjct: 776  IWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLK 835

Query: 821  DTREYQGP-VR---EPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYT 876
             + E   P +R    P  K L  GTN F+  N   DDPNNSIVYFIQT +R+D +  T T
Sbjct: 836  ISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLT 895

Query: 877  CLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLS 936
             L E+  SLTLVPDLRNKKQIGY V GGLR+L+ ++G+HIT MS S   +LE +I EYLS
Sbjct: 896  FLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLS 955

Query: 937  YLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG-NLEE 995
            YL+  +L+  TE +F+   +  +  +++ N   + + +AGP DL+ +I ANV++G N   
Sbjct: 956  YLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTL 1015

Query: 996  QGSAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKL 1055
                MR H+  +N+I+  R NF  + E ++   L+ +TL ++ +FF  KISIYS +RSKL
Sbjct: 1016 NNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKL 1075

Query: 1056 SVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYF 1115
            S+MI SPM  +EI+ +++FLQ+E+FLK+ G  I + DL  I+E S G    +++ LF YF
Sbjct: 1076 SIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYF 1135

Query: 1116 SANGETMKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLT 1167
                E  KL  V+++EI K + ++LK          SQ     +  +  +   +  +PL 
Sbjct: 1136 RRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQ 1195

Query: 1168 EIKDVNQFR 1176
            E+ + N FR
Sbjct: 1196 ELPEPNFFR 1204

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1187 (41%), Positives = 706/1187 (59%), Gaps = 32/1187 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS+   K+ ++ F+TP+S S+R  KLCQL NG+L+ LISDP+++V +CS++VA GS+ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
            D+  G+AHLCEH +L+GGSKKYP    YH+++ +N GS+NA            LP  + +
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
             E  F+KA+D+ AS    PLF   LINKEIYAI++EH+ N + V K LYHA+RLL + SH
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRF TGN ++L     L    ++  L++  +  Y  S M++CLRG  S+N L KLAI 
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  FFGDLPASGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAF-SQGSSNVVA 299
             FG+L     N      ++L  N G       F IL+  W         F S    N + 
Sbjct: 241  KFGELRPHKAN--EKVQAALTPNDG-------FNILQTRWGHTKAANNCFPSCLERNTIC 291

Query: 300  IQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIV 359
            + S K P++R +FPV  K TR +  D   F   W + FGDES GS    L   G I+   
Sbjct: 292  VDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFCHFLVEKGWITNCY 351

Query: 360  SSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAI 419
            + +S F+               GW NI  I   L    +PK   + T  +AR LSE  +I
Sbjct: 352  AYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHTVQLARFLSEQFSI 411

Query: 420  ELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENT 479
            +L++FLY + E SPM  C+NL   L  D+  LD  C+  GSP++    E S  G +SEN 
Sbjct: 412  DLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSPMVL--NEQSTQGLFSENE 469

Query: 480  ESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLG---DQSKSNFLASVRSTTKTDAYYEFDY 536
            ESQ WWIG+AIKFQ+ + EF+N  N+R ++LG   D S S   A+      TD +Y+F Y
Sbjct: 470  ESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLST-TATQGKIAGTDPFYDFAY 528

Query: 537  RIAYVDMLSIQLDDYTAPN-YHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHL 595
               +   LS++       N Y F  P  + F P  A     + + L  SST++Q ASL  
Sbjct: 529  ---FTCKLSLRKPHANILNDYKFSIPPKNEFKPSWAENFPSLMRKLYYSSTKSQQASLGF 585

Query: 596  IPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEI 655
              +SD     P+L  +N NY++WV  +    S  SK+IVSFEI    +  SP+NTM LEI
Sbjct: 586  AIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPSPENTMNLEI 645

Query: 656  LGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSF 715
            L Q++  TL++ LYPS KLG+T+EI PSS+GDVRLGL +SG+ + +  +I+ +   I+  
Sbjct: 646  LAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIESLSSIIRRL 705

Query: 716  SS-RDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEI 774
             S +   S ++FR+ARI+VRS Y++          S+GLL+++E+ MW ++DR++A+E I
Sbjct: 706  KSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQDRIDAIECI 765

Query: 775  SQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTR-EYQGPVREP- 832
              +TF  F + F     ++ LFIQGD+S  + IN+ L  +LT+HL  T+ ++Q   REP 
Sbjct: 766  DLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGTQTDFQ---REPE 822

Query: 833  --GAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPD 890
                K+L   TN +V+     DDP NS VY+IQTG R+D  AYT T L+ + +S TL P+
Sbjct: 823  YCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALSAYMMSFTLKPE 882

Query: 891  LRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEE 950
            LRNK+QIGY V GGLRLL  ++GLHI+ MS   P  LE +I EYL YLE+ +L  MTE+ 
Sbjct: 883  LRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLEREVLTPMTEDT 942

Query: 951  FQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSA-MRLHKNTKNQ 1009
            F+  Y++ +  +     +++++K +GPADLM QI ANV+SG+ +   S+ M+ HK  +NQ
Sbjct: 943  FRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNSSFMKKHKRLRNQ 1002

Query: 1010 ISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEIS 1069
            I++ RY F   +  +N  +L+ +T+  +  FF E+ISI+S  R+KLSVM+ SPMT EEI 
Sbjct: 1003 IADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVMVKSPMTDEEIV 1062

Query: 1070 QKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVII 1129
             ++++ QV++FLKL GL I ++ L ++++ S G+   + + L++ F +  ET KLC V++
Sbjct: 1063 NRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSRHETWKLCTVML 1122

Query: 1130 KEISKALVLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFR 1176
            +E+ K L ++LK   QR     A    S   T A  LT IKD+N +R
Sbjct: 1123 RELLKMLTVNLKFRHQRQTNMAASEWGS---TPATGLTLIKDINIYR 1166

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1190 (41%), Positives = 705/1190 (59%), Gaps = 27/1190 (2%)

Query: 7    KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
            K +D+ F TP S   R  KLC+L NG+L  LISDP++   +CS+SVA+GSHNDP E  GL
Sbjct: 7    KYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDPSEIPGL 66

Query: 67   AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
            AHLCEH +L+ GS+KYP   YYHE++ +NGGS NA            LP I  S +  FD
Sbjct: 67   AHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFD 126

Query: 127  KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            +ALDV AS    PLF+  LINKE YAIESEH++N +  GK  Y A+RLLAN +HPFSRF 
Sbjct: 127  EALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFS 186

Query: 187  TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
            TGN +TL ++P L   N+K  L  + K  +  S M+LCLRG QS+++L KLA+  F  + 
Sbjct: 187  TGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIK 246

Query: 247  ASGQNIARPSSSSLF-----SNKGTAQSMPYFKILKYEWTPKYKDVRAF-SQGSSNVVAI 300
             + Q        S       SN+    +     I K  W PKY+    F S      + I
Sbjct: 247  NNPQRYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKNTWLPKYRGQLCFTSDEQEKFIFI 306

Query: 301  QSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVS 360
            +SSK P +R IFP   ++TR +S DI   +  W + FGDES GS +  L+  G ++   +
Sbjct: 307  KSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYA 366

Query: 361  SVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIE 420
             VS  A             + G++N+  I  +LF+  IP L    T ++A+ +S+ N I+
Sbjct: 367  FVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQNCID 426

Query: 421  LLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYSENTE 480
            L++FLYQ+ E SPM+ C NLS+ +  DLE LDP  + KGSP++  +++H  IG+Y EN E
Sbjct: 427  LIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHNIGNYGENKE 485

Query: 481  SQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDY---- 536
            S  WWIG+AIKFQ+ + +F+ + N+R V+ G+  +S          + D +YEF+Y    
Sbjct: 486  SDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQLEELSSQEFQVDLFYEFEYFKRD 545

Query: 537  RIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLI 596
             I + D+L    D      Y+F  P  D  +P +A+  S +K+ L  SS ++QSA L   
Sbjct: 546  GIPFKDILEWNND------YNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFT 599

Query: 597  PRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEIL 656
              ++ L+  P L  +N  +E+WV  ++ D S   KSIVSFEI    + A P+NTM LEIL
Sbjct: 600  IHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEIL 659

Query: 657  GQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFS 716
            GQ++   LS  +YPS KLG+T EI+ S+KGD+RLG T+SGF + + + +K I+E IK  S
Sbjct: 660  GQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRIS 718

Query: 717  SR-DIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEIS 775
               D +S +  R ARI VR+KYE           S+GL I+LE+ MW +EDRLEALE+I 
Sbjct: 719  QDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDID 778

Query: 776  QETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHL-EDTREYQGPV-REPG 833
             + F  FC  FL S  Y++LF+QGD+SC +++N +L  S T HL     E QG       
Sbjct: 779  MDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVET 838

Query: 834  AKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRN 893
             K+L+ GTN  V+     DDPNNSI+YFIQTG R D   +T T    F +SL L  +LRN
Sbjct: 839  TKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRN 898

Query: 894  KKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQE 953
            K+Q+GY V GGLRLLS S+GLHIT MS   P  LE +I+EYL YLE   L  + E+ F +
Sbjct: 899  KRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLES-QLQKLDEQTFHQ 957

Query: 954  HYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGS-AMRLHKNTKNQISN 1012
             Y+R Y  +++        +++GPADL+ ++ ANV+ G+ E   S  M+ HK  + QI  
Sbjct: 958  EYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQ 1017

Query: 1013 RRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKR 1072
             +Y+F  E E ++ D++  ++L ++ SFF   ISI+S  RSK+S+MI+S +  ++I  K+
Sbjct: 1018 EQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMISSSIAEKDIINKK 1077

Query: 1073 LFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEI 1132
            +FLQ+E+FLK+KG  I + +L DI+E S G+   +   L+  F    + ++LC+VI+ E+
Sbjct: 1078 IFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAEL 1137

Query: 1133 SKALVLSLKNPSQRTRVDDA----LRGLSKIVTSALPLTEIKDVNQFRNL 1178
             K L  SL++       DD     L+  S  V  AL L  I+D+N F+ +
Sbjct: 1138 FKMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFKRV 1187

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1174 (40%), Positives = 683/1174 (58%), Gaps = 36/1174 (3%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS     N+++ FY P+S  +R  K+C+L NG+L  +ISDP+D+  SCS+SV TGSHNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
            ++  GLAHLCEH IL+ GSKKYP    +H ++A+N GS NA            LP    +
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GEL F+  LDV AS  K PLF+ +LI KEIYAI+SEH  N +   K  YHA+R+LAN  H
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS F TGN  +L ++P L K N+K +L ++ K  +   NM+LC+RGSQS+N LTKLAI 
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  FFGDLPASG-----------------------QNIARPSSSSLFSNKGTAQSMPYFKILK 277
             FGD+                           Q+ ++  S +  S+  ++ ++   KI  
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 278  YEWTPKYKDVRAFSQGSS-NVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDF 336
              W  KY  V  F   S  N + I SSK P++R +FPVS K+TR +  DI  +S  W + 
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 337  FGDESVGSLADCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDD 396
            FGDES GSL+  L   G  +   + +S FA             + GW+++ +I   +F  
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 397  YIPKLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCL 456
             +P       + +   L E N I++ +FLYQ++E  PM+ C++LS  L  +LE L P  +
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 457  LKG-SPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSK 515
             KG   LIE N  +  I  Y  N  +  WW G+AIKFQN +  F+N +N R ++LGD   
Sbjct: 481  FKGFKSLIEINDPN--IEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKS 538

Query: 516  SNFLASV--RSTTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARK 573
             N    +   S   T+ +YEF+Y +  V  LS     ++   Y F+ P+ + FLP     
Sbjct: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVH-LSEDHKYHSQSPYEFNFPTKNPFLPDFVND 597

Query: 574  LSLIKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSI 633
               ++Q     S +++ A+L    +S+ ++  P+L  KN NYE+WV +E+ + +  + S+
Sbjct: 598  PLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSV 657

Query: 634  VSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLT 693
            VSFE+I   +  SP+ T++LE+L Q+L  T S+ LYP+ + GYTYEI+ SSKG+V L  T
Sbjct: 658  VSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFT 717

Query: 694  VSGFPEGVYNLIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEXXXXXXXXXXSLG 752
            +SGF EGV+ + K  V+ +K   +     SK   R+ARI VRSKYE           S+G
Sbjct: 718  ISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIG 777

Query: 753  LLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLK 812
            LLI+LEE MW ++DR++ALE    E+   FCS F  +P  + L IQG++   ++IN +L 
Sbjct: 778  LLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLN 837

Query: 813  WSLTSHLEDTREYQGP-VR---EPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGERE 868
             + T HL+   E   P +R    P  K +  GTN F+  N   DDPNNS+ YFIQT +R+
Sbjct: 838  NNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRD 897

Query: 869  DARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLE 928
            +    T T L E+  S TLVPDLRNKKQIGY V  GLR+L+ +IG+HIT MS S    LE
Sbjct: 898  NIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLE 957

Query: 929  VQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANV 988
             +I EYLSYLE  +L+  TE  F+   +  +  +++ N  N+++  +GP++L+ +I ANV
Sbjct: 958  TKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANV 1017

Query: 989  RSG-NLEEQGSAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISI 1047
            ++G +       M+ H+  +N IS +R +F  E E V+   L+ +TL ++  FF  +ISI
Sbjct: 1018 QNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077

Query: 1048 YSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGI 1107
            YS +RSKLS+MI SPM  EEI+ +++FLQ+E+FLK+KG  I S DL  I+E S G    +
Sbjct: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137

Query: 1108 LRGLFRYFSANGETMKLCNVIIKEISKALVLSLK 1141
            L+ LF +F    E  KL  V++KEISK + ++ K
Sbjct: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFK 1171

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1159 (40%), Positives = 694/1159 (59%), Gaps = 51/1159 (4%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            M+  + +  D+  YTPIS S+R  +  QLSNG+   LISDP ++  S   SVATGSHNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISD- 119
            DE  GLAHLCEH I+S  SKK+P  ++YH++L +  G+ NA            +P  ++ 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  SGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPS 179
            +G+  FD+ + V+A  L +P+F    INKEI AI++EH  NK LV K LYH ++ LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSRFCTGNFTTLCTLPSL--NKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKL 237
              FSRF TGN  TL   P +     N+K  L   +   +   N+S+ +RGSQSL+ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  AIRFFGDLPASGQNIARPSSSSLFSNKGTAQSMPY----FKILKYEWTPKYKDVRAFSQG 293
                FGD                F  K T +S  +    FK L+  W  +Y +   FS+ 
Sbjct: 241  VQTTFGD----------------FRTKSTIKSQSFSIESFKKLQKVWAARYTE-PLFSKQ 283

Query: 294  ---SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLK 350
               + N + IQSSK P+LRL+FPVSH+    S S++  FS  W D FGDES GS+     
Sbjct: 284  EPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFS 343

Query: 351  GCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKN-IPTIMCILFDDYIPKLIHDKTEDI 409
               +++  V+ +S F                GWK  + +++  LF  ++P       ++I
Sbjct: 344  ARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEI 403

Query: 410  ARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEH 469
            A+ L+E N I LL+F+YQ  + S MD C++L + LL   +  DP+ +L  S    CN++ 
Sbjct: 404  AQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSCNRKG 460

Query: 470  SRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLAS--VRSTTK 527
            S IG Y E+ +S+ WW  +A KF + V  +++  N + + LGD   ++FL S  V +  K
Sbjct: 461  SDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVK 520

Query: 528  TDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTR 587
             D +Y F Y ++ + +  +++    +P   F  PS   FL  + + LS +KQ+L     +
Sbjct: 521  FDEHYRFQYELSLIKLNHVKM----SPK-DFRLPSSTAFLFGLEKNLSALKQSLTAVLRK 575

Query: 588  AQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASP 647
            +Q ++L +I +S  LQT PRL  KN NYE+WVKEE   L +SS+S+++ E+I+  +  S 
Sbjct: 576  SQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSA 634

Query: 648  KNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKI 707
            KNTM LEIL QLL   ++ +LYPSE++GY Y+I+ +++GDVRL +T++GFP+GV  +++I
Sbjct: 635  KNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQI 694

Query: 708  IVEEIKSFSSRDI-ISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIED 766
            I++++      D  I++ +FR +RI VR+KYEE          SLG+LI+LE+ +  +E+
Sbjct: 695  IMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEKELTTLEE 754

Query: 767  RLEALEEISQETFTMFCSH-FLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREY 825
            RL+ALE+I  E+F MFC   ++    YMNL IQGD+S  E +N ++   +  HL      
Sbjct: 755  RLDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGPNVN 813

Query: 826  QGPV---REPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFF 882
            Q  V   REP    L  G+N F++  +F +DP NS+VYFI+TG+R +   YT + L E+F
Sbjct: 814  QTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYF 873

Query: 883  LSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCL 942
            +S+TLVPDLRNKKQIGY V GGLRLL+ ++G+HI+ MSN PP  +E +IEEYL YLE  +
Sbjct: 874  MSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEEYLYYLETNV 933

Query: 943  LDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG----NLEEQGS 998
            L  MTE EFQ++ ++KY  ++++N + ++ K AGPA+LM QIEA+V SG    NL+ QG 
Sbjct: 934  LGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGY 993

Query: 999  AMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVM 1058
             +  HK  K++IS R Y F   E  V+  +L  +TL EF+  F EKISI SL+R KLSV 
Sbjct: 994  TVGQHKKLKDEISFRTYAFS--ETKVDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVR 1051

Query: 1059 IASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSAN 1118
              +PMT  +I    + +Q++ FLK KG  I+  +L +I+  + G+ + + + LF +F   
Sbjct: 1052 FKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQ 1111

Query: 1119 GETMKLCNVIIKEISKALV 1137
            G++++LC +++KEI K ++
Sbjct: 1112 GQSLRLCTLVLKEIVKQIL 1130

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1203 (40%), Positives = 709/1203 (58%), Gaps = 32/1203 (2%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS+   ++ D+   TP+S S+R  KLC L NG+   LISDP+DT  +CS++VATGSHNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
                GLAHL EH IL+ GSK+YP    YHE++++N GS NA            LP     
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GEL FDK LDV AS  K PLF+  +INKEIYAIE+EH  N +   K LYH++RLLAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS+F TGN  +L     L   +IK+ L ++   ++K + M+LCLRG  S+N LTKLAI 
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  FFGDLPASGQNIARPSSSSLFSNKGTAQSMPYF------KILKYEWTPKYKDVRAFSQGS 294
             F D+  S  ++ R    S+ S + + Q    +       IL+  W+ +Y ++  F   S
Sbjct: 241  KFSDI-KSQNDLQRNKFGSISSKRDSRQPRQGYSKIESSNILENIWSKRYANLPCFVNES 299

Query: 295  SNV--VAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGC 352
              V  + I+S K P++R +FP+S +ST  +  +I  FS+ WC  FGDES GSL   L   
Sbjct: 300  KKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSLMHFLVEK 359

Query: 353  GLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARC 412
            G  +   S VS FA               G   I  I+ +LF+  +  L    T  +A  
Sbjct: 360  GWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTTKHTTLMADF 419

Query: 413  LSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRI 472
            L+E N IE ++FLY+  EK PM+ C++LS  L  +++ LD K L KGSP I   Q +S  
Sbjct: 420  LNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSI--TQLYSGK 477

Query: 473  GDYSEN-TESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLAS---VRSTTKT 528
              YSE+ T+ +  W   AIKFQN +  F+N +NLR + LG  +K   L +    R   +T
Sbjct: 478  NQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKEKKRIEFET 537

Query: 529  DAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRA 588
            D +YEFD+   + D       D    NY F  PS + F+P   R  + ++QA Q SS ++
Sbjct: 538  DFFYEFDFYRTFTDFRKCS-SDIETENYIFTLPSSNLFIPKSCRSYTYLQQAFQESSLKS 596

Query: 589  QSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFS--SKSIVSFEIISKSVCAS 646
            + ASL    + + +   P L   + NYE+W     ++ S S  SK+IV+FE+IS ++  S
Sbjct: 597  KLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIVTFELISTNMIPS 656

Query: 647  PKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIK 706
             ++T++LEIL QLL   +S+ LYPS KLGY+Y+I+ SSKGDVRL  T+SGF EG+  +++
Sbjct: 657  AESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEGLLLVLE 716

Query: 707  IIVEEIKSFSSRD---IISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWP 763
             I++ +   +       +++++ R+AR+ VR KY+E          S+GLLI+LE  +W 
Sbjct: 717  EIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILLESFLWT 776

Query: 764  IEDRLEALEEISQETFTMFCSHFL-TSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDT 822
            +EDR++ALE+    +F  F + FL  S  Y  LFIQG++    +I+ +L  +LT HL+  
Sbjct: 777  LEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHYLNDNLTHHLDIL 836

Query: 823  REYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFF 882
             E +  + +P  KIL+ G+N FV  +   +DPNN+IVYFIQ+G R D+ AYT T   E+ 
Sbjct: 837  PE-KVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIAYTLTAFTEYL 895

Query: 883  LSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCL 942
            +S+TL+PDLR+KKQIGY V GG+R+L  SIGLHIT +S +PP+ LE +I+EY+++LE+ +
Sbjct: 896  MSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKIDEYMNFLERII 955

Query: 943  LDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLE-EQGSAMR 1001
            L  +TEEEF+  Y++ Y  M+       +  TAG  +L+  I +NV +G  E    S MR
Sbjct: 956  LGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGEYEILNSSEMR 1015

Query: 1002 LHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIAS 1061
             HK   NQIS+  ++F  + E +NR+++ T+TL  +  FF +KISI+S KRSKLSVM+ S
Sbjct: 1016 EHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIHSNKRSKLSVMVTS 1075

Query: 1062 PMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGET 1121
            PM   EI  ++LFLQ+E+FLK+KG  I S+ L +I++ + G+ S +L+ L   F    E 
Sbjct: 1076 PMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVLKLLLSEFRERNEA 1135

Query: 1122 MKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLTEIKDVN 1173
             KL   ++KE+ K    +LK+        P++        +  +  V   +PL  I+D+N
Sbjct: 1136 WKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSVKPVIPLKRIEDLN 1195

Query: 1174 QFR 1176
             F+
Sbjct: 1196 IFK 1198

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1170 (38%), Positives = 676/1170 (57%), Gaps = 38/1170 (3%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            M++ + +N+D+ F  P++ S R  KLC+L NG+L  LISDP D    CSV+VATGSHNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
                GLAHLCEH + + GSKKYP  + YH+ L++ GG+HNA            +P ++  
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
            GEL FD  LD+ +S LK PLF+   +NKEIYAI+SEH+ N + + K LY A RL+AN +H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFS+F TGN  TL  +P +   N++  L ++ +  ++  N+++C++GSQS+N LTKLA+ 
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  FFGDLP---ASGQNIARPSSS---SLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQGS 294
             FG +    A+  N+ R S S   S+ SN    + +  F+IL+  W  KYKD++ F    
Sbjct: 241  NFGYIQSSRAAKGNVIRRSISKRDSIRSNGKKLKKIESFRILEKAWKAKYKDIKCFDD-R 299

Query: 295  SNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGL 354
            +N + I+S+K   +R +FPV+      +  ++  FS  W + FGDES GSL         
Sbjct: 300  NNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGSLHSYFIEKSW 359

Query: 355  ISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLS 414
            I+   + +S F                GW+N+  I+  +F   +  +  +    ++R L 
Sbjct: 360  ITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRWENLNSLSRILF 419

Query: 415  ELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSP-LIECNQEHSRIG 473
            E   IE + +LYQ  E    D C+ L+  L   L T + + L K SP LIE N +H    
Sbjct: 420  EHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNLIELNNDH---- 475

Query: 474  DYSENTESQT-WWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTK---TD 529
              SEN  + T WW  +A+KFQN ++EF+   N++  +LG + K N    + S  K   TD
Sbjct: 476  --SENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFELGSQNKDWSTD 533

Query: 530  AYYEFDYRIAYVDMLSIQLDD--YTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTR 587
            AYY FDY  ++++   I +D+   T  +Y    PS + F+P   + L+ ++Q     S R
Sbjct: 534  AYYGFDYIKSHLNFKQI-IDEPCTTVNDYSLALPSKNLFIPQFFQNLANLQQIFMEYSLR 592

Query: 588  AQSASLH-LIPRSDFLQTPPRLAGKNSNYEVWV----KEEELDLS---FSSKSIVSFEII 639
            ++ A L   +P S      PRL  ++S+YE+W+    KE E   S      +S V+F I 
Sbjct: 593  SRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDRIPKQSTVTFSIE 652

Query: 640  SKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPE 699
            S ++  S  NTM+LEILG++L   L++ LYPS +L Y YEI+ S KGDV+L  T+ GF +
Sbjct: 653  SLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGDVQLCCTICGFSD 712

Query: 700  GVYNLIKIIVEEIKSF---SSRDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLII 756
            GV  +   I+  ++     ++ +I+++ + R+ARI VRSKYE           S+GLLI+
Sbjct: 713  GVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEAASSEICVKLASMGLLIV 772

Query: 757  LEECMWPIEDRLEALEEISQETFTMFCSHFLT--SPTYMNLFIQGDMSCMEKINSFLKWS 814
            LE  MW +EDRLEALE+    +F  FC  F+   S  Y+NLF+QGDM   +++N  +   
Sbjct: 773  LERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMRYADEVNCLIHSK 832

Query: 815  LTSHLEDTREYQGPVRE--PGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARA 872
            LT HL  +R    P  +      +LK G N +V+     DDPNNSIV+F+Q G R D  A
Sbjct: 833  LTHHLNSSR-CSTPTTDYRRSTTVLKPGVNYYVEYPGQGDDPNNSIVHFVQVGLRNDRAA 891

Query: 873  YTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIE 932
            +T      + + LTLVPDLR KKQIGY V GGLR+++ ++GLHIT MS      LE +I+
Sbjct: 892  FTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVMSAGQCLDLEDKID 951

Query: 933  EYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGN 992
            EY+ YLE  +L+ +TE +F+E Y++ Y  ++  + V  M  + GP +L+ +I  NV++G+
Sbjct: 952  EYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTNLLSEIYPNVQNGH 1011

Query: 993  LEE-QGSAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLK 1051
                +G  M+ HK   N I  + Y+F    + ++R +++ +TL  + +FF EK+S  S  
Sbjct: 1012 SSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYMTFFKEKLSARSTT 1071

Query: 1052 RSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGL 1111
            RSK+S+MI SPM  EEI  +++FLQ+E+FLK+KG  I  ++L DI+  S G  + +LR L
Sbjct: 1072 RSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVNKSQGSPTQLLRHL 1131

Query: 1112 FRYFSANGETMKLCNVIIKEISKALVLSLK 1141
              +F   GE  KLC VI KE+ K L L ++
Sbjct: 1132 LAHFKTRGENWKLCRVIAKEVGKLLALGVR 1161

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1218 (38%), Positives = 696/1218 (57%), Gaps = 57/1218 (4%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS+ +TK FD+ FY P S S+R  KLC+L NG+L  LISD S T  +CS+SVATGSH+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
             +  G+AHLCEH IL+ GSKKYP    +HEVLA N GS NA            LP  +  
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
             +  F + LD+ +S  K PLF+++L NKEIYAIESEH+ N +   K LYHA RLL+N SH
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PF  F TGN  TL  + +L K+N+K  L  + K  Y + NM++C++G QSLN+LTKLA+ 
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  FFGDLPASGQ------NIARPSSSSLFSNKGTAQ------------SMPYFKILKYEWTP 282
             FGD+    +      N  +P  S   S   ++              +  FK+L   W  
Sbjct: 241  NFGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNAWLD 300

Query: 283  KYKDVRAFSQG-SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDES 341
            KY D   F    S N + + SSK P+LRL+FP+S K TR +  DI  +S+ WC  FGDE+
Sbjct: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360

Query: 342  VGSLADCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKL 401
             GS  D L     I+   +  S FA               G K +  I+ IL    +  L
Sbjct: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420

Query: 402  IHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSP 461
            + + TE++A  L+E N I +L+F+    E +PMD C+ LS  L  + +  +PK L  GS 
Sbjct: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480

Query: 462  LIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSK-SNFLA 520
             +    E     +   +  S T+WIG+AIKFQ  + EF+N +N++ V +GD  +  N L 
Sbjct: 481  FLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN 540

Query: 521  SVRSTT-KTDAYYEFDYRIAYVDMLSIQLDDYTAP-NYHFHAPSYDTFLPMVARKLSLIK 578
             V+  + KTD YYEF+Y+      L I       P +Y F  P  + +LP     L L++
Sbjct: 541  IVKEMSKKTDLYYEFEYQ-----KLKISKKSRICPRDYPFTYPIKNEYLPKFGYNLGLLR 595

Query: 579  QALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWV--KEEELDLSFSSKSIVSF 636
              L  +   +++ S ++ P+    +   +L  +N  +++WV  K  +  LS  S  IVSF
Sbjct: 596  NILLNNLESSRTVSFYM-PQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLS-ESPCIVSF 653

Query: 637  EIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSG 696
            ++++ S+  SP++TM+LE++GQLL   L   LYP+  +GYT+EISPS +GDV L  T+SG
Sbjct: 654  KLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSG 713

Query: 697  FPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLII 756
            F EG++ +IK  +      +S D+I+ K FR ARI VR KYE+          S+GLLI+
Sbjct: 714  FSEGIFKIIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLIL 773

Query: 757  LEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLT 816
            LE  MW +E+R++ALE I  E F  F   F  +  +++L+I+G++   + INS+    L 
Sbjct: 774  LERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLINSYFSDKLV 832

Query: 817  SHLEDTREYQGPVRE-----PGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDAR 871
             HL    +Y  P  +     P  K++ +GTNI+ +     DDPNNSIVYFIQTG+  + +
Sbjct: 833  HHLTKRLDY--PKEDTLQSLPSTKLI-SGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKK 889

Query: 872  AYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQI 931
              + T L  F +S +LVP+LRNKKQIGY VFGGLR LS ++GLHIT MS+  P  +E++I
Sbjct: 890  ILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEI 949

Query: 932  EEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG 991
            E+Y+SYLE  LL  + +E FQ +Y+ KY  ++        ++T+GP ++M +I ANV  G
Sbjct: 950  EKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGG 1009

Query: 992  NLEEQGSAMRLHKNTKNQISNRRYNFG---MEEEP--VNRDILRTITLSEFRSFFSEKIS 1046
            +     SA+   +  KN   N+   FG   M EE   V+ + L+ + L ++  FF   IS
Sbjct: 1010 D-----SAILNSEKIKNHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSIS 1064

Query: 1047 IYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSG 1106
              S +RSKLS+ I SPM   E+  ++LFLQ+++FLK+KG  I S++L  I+E + GR + 
Sbjct: 1065 TNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTL 1124

Query: 1107 ILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQ------RTRVDDALRGLSKIV 1160
            + + LF  F A  E+ K  ++++KEI K + +S+K   +      R+ +  +      I+
Sbjct: 1125 LFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHII 1184

Query: 1161 TSALPLTEIKDVNQFRNL 1178
            T   PL +++D+N++ +L
Sbjct: 1185 TPT-PLEKVEDINKYLHL 1201

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1215 (37%), Positives = 667/1215 (54%), Gaps = 53/1215 (4%)

Query: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
            MS+   KN+D+  Y P S      KLC+L NG+L  +ISDPS  + SCS+SVATGSHNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
                GLAHLCEH ILS GSKKYP  N YH++++++ GSHNA            +P +  S
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
             E +F++ LD+ +SS K PLF +  +NKEIYAIESEH+ N   + K LYHA+RLLAN  H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
            PFSRF TGN TTL     L K   K  L S+ K  Y  SNM+LC++G QS+N LTK A+ 
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  FFGDLPASGQNI--------------ARPSSSSLFS----NKGTAQS--MPYFKILKYEW 280
            +F  +  S +N                R S SSL      +KG  +   +  F IL   +
Sbjct: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300

Query: 281  TPKYKDVRAFSQG-SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGD 339
             PKYKD++ F +  + N + I+S+K P+LRL+FP+       +  D+  F   WC+ FGD
Sbjct: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360

Query: 340  ESVGSLADCLKGCGLISGIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIP 399
            E+  SL   LK   LI+   +  S+FA               G KN   I+  + +  I 
Sbjct: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420

Query: 400  KLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG 459
            KL      ++AR LSE N I++++F+ +  E + MD  + +S+ L  +L    P  LLK 
Sbjct: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480

Query: 460  SPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNF- 518
             P I    E + I ++ EN  S+ WW+ +A  FQ  +  +VNR+NLR + LGD     F 
Sbjct: 481  FPFINDYSE-TGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFT 539

Query: 519  -LASVRSTTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLI 577
             L        TD +Y+F+Y        + QL        +   P  +TF+P + + L+++
Sbjct: 540  TLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAIL 599

Query: 578  KQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFE 637
               L+    R +S    +I  ++ +++ P L  KNSN E WV    L  S +  SI SFE
Sbjct: 600  SANLEAILKRNESIGYPII-YNNSIESKPGLVLKNSNQETWVLNSPLQHSSTESSIFSFE 658

Query: 638  IISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGF 697
            I + S+  SP +TM+LE+LGQLL   ++  LYP+ +LGYTYEI  S  GDV+L +T+SGF
Sbjct: 659  ITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGF 718

Query: 698  PEGVYNLIKIIVEEIKSFSSRD-IISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLII 756
              G+ +L++ I++   S S ++  ++      AR+  R KYE+          S+GLLI+
Sbjct: 719  QSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIM 778

Query: 757  LEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFL--KWS 814
            LE+ MW +EDR +ALEE    +F  FCS F  S  Y+  FI G      K++  +   W 
Sbjct: 779  LEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWI 838

Query: 815  LTSHLEDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYT 874
            L+  +  +  Y           LK G N++ +      D NN I YFIQTGER +    T
Sbjct: 839  LSDTI--SLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIAT 896

Query: 875  YTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEY 934
             T L ++ +   LV +LRN+KQ+GY VFGG+R L+ +IGLHIT MS + PE LE  I+EY
Sbjct: 897  LTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEY 956

Query: 935  LSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQK-TAGP------ADLMGQIEAN 987
            +  LE   + ++ E  F+  ++  +        +N MQK T  P       +L+  + AN
Sbjct: 957  MWRLENDTIGSLNESTFKLTFLLPF--------INTMQKDTNNPFNNVTNVNLVDDVVAN 1008

Query: 988  VRSG---NLEEQGSAMRLHKNTKNQISNRRYNFGME-EEPVNRDILRTITLSEFRSFFSE 1043
            V++G   N E Q   M+LH N K +I N R    ++  E ++ +I++ +TL E+  FF  
Sbjct: 1009 VQAGDSVNFETQ--QMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRA 1066

Query: 1044 KISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGR 1103
             ISI S  RSK+S+ I S M  EEI+ ++LFLQ+ +FLK+KGL I   +L +I+E S G+
Sbjct: 1067 TISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGK 1126

Query: 1104 TSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQRTRVDDALRG--LSKIVT 1161
             S +L+ + +YF    E  KL  +IIKEI K + +++ N S  T    + +    ++ + 
Sbjct: 1127 PSKLLKEIVKYFKKKDEAKKLYFIIIKEIIKIISMTVINSSSITTKSTSKKNNWQTEPIK 1186

Query: 1162 SALPLTEIKDVNQFR 1176
            SALPL  + D+  ++
Sbjct: 1187 SALPLVLVNDIKAYK 1201

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  497 bits (1279), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 360/1195 (30%), Positives = 587/1195 (49%), Gaps = 99/1195 (8%)

Query: 6    TKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALG 65
             K F + FY P+   +R  KL QL NG+ V +ISD  +   SCS++VA GSHNDP    G
Sbjct: 5    VKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATVPG 64

Query: 66   LAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS-GELH 124
            LAHLCEH IL+ GS  +P    +H ++A+  G  NA            +P +++S G L 
Sbjct: 65   LAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEGTLA 124

Query: 125  FDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSR 184
            F++ L V +S+ K PLF+  ++NKEIYAI+SEH  NK   GK LY A+RLLAN +HPFSR
Sbjct: 125  FEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPFSR 184

Query: 185  FCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGD 244
            FCTG+  TL T PS    NI+  L S+    +   N++LC+RG QSLN L KL ++ F D
Sbjct: 185  FCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNFND 244

Query: 245  ---LP----ASGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQG-SSN 296
               LP    A G N  R S + LF      +++    IL   W P+Y  +  F  G  +N
Sbjct: 245  IKPLPVLPTAIGNN--RDSDTELFE-----ETLKRLNILYDVWAPRYTSLPCFHIGYKNN 297

Query: 297  VVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLIS 356
            V+ + S      R++ P+    TR  +     F++   +  G+E VGS    LK    + 
Sbjct: 298  VILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGSFCHFLKEISWVR 357

Query: 357  GIVSSVSHFAXXXXXXXXXXXXXQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSEL 416
                  S FA               G+  I  I+ +LF   IP  ++  ++D+AR + E 
Sbjct: 358  ECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNMPSDDLARFIKEQ 417

Query: 417  NAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEHSRIGDYS 476
              IE + F+Y     SPM+  ++LS  L  DL     K LL  SP        S + +Y 
Sbjct: 418  TIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLLMKSP--------SFLHNYE 469

Query: 477  E--NTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRS---------- 524
            E   TE   +W     KF+  +   +   N + ++    +   F  +VR+          
Sbjct: 470  EMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVII---PTSEPFTKTVRNLFKNAQQMEV 526

Query: 525  TTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVS 584
            T++TD YYEF+Y +  V   S        P Y F  P  + F+P   R L  + + L   
Sbjct: 527  TSETDPYYEFNYSVYSV---SFPESRVIFP-YQFSFPGPNEFIPPKYRNLDTLLEMLFGI 582

Query: 585  STRAQSASLHLIPR--SDFLQTPPRLAGKNSNYEVWVKEEELDLSFSS------KSIVSF 636
            S RA  + L  I R  +   ++ P+L  +  + E+W     +D  FS       KS V+ 
Sbjct: 583  SERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTA-NIVDGIFSKVVNADIKSYVTI 641

Query: 637  EIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSG 696
            +I+++ +  +P ++++L ++ +++   L   LY   KLG+++ +  +  G +   + V+G
Sbjct: 642  KIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSMSFDIVVTG 701

Query: 697  FPEGVYNLIKIIVEEIKSFSSRD--IISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLL 754
               G+  +++ + + I+   ++   I+++   R+AR+A+RS+YE           + GLL
Sbjct: 702  IMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSVKIGTTGLL 761

Query: 755  IILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQ-GDMSCMEKINSFLKW 813
            + LE  +W  E+R++ALEE   E F  F + F  +  +  +F Q    S ++KI  ++  
Sbjct: 762  VDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNIDKIARYVVQ 821

Query: 814  SLTSH--LEDTREYQGPVREPG-AKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGERE-- 868
             + +    E        VR+ G  ++LK G    +K     +DPNN +  +++    E  
Sbjct: 822  RIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFSYLEMAPLEGI 881

Query: 869  DARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLE 928
              + Y      ++   LTLVP+LRNK+Q+GYAV GGL +L+  +G+++  +S++ PEH+E
Sbjct: 882  SLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVVVSSTSPEHIE 941

Query: 929  VQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANV 988
             +IE Y +++ + L D +      +   R Y  ++ +              LM  ++ +V
Sbjct: 942  QEIESYYAHVRQYLSDNV------DQIWRDYSKIINDRD-----------PLMYLLDHDV 984

Query: 989  RSGNLEEQGSAMRLHKNTKNQISNRRYNFGME--------EEPV---NRDILRTITLSEF 1037
               N+E + S   + + +++ ++N +  F  +        + P+   + D     ++ E+
Sbjct: 985  WY-NIERENSD--IPEYSRDHVANCQRVFKYKDLIELLVVDTPISGRHPDYTPPFSMQEY 1041

Query: 1038 RSFFSEKISIYSLKRSK-----LSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSD 1092
              F    I  Y  KR       +SV + SPM   ++ Q+++  Q+ESFLKLKGL I   D
Sbjct: 1042 LQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLVIPERD 1101

Query: 1093 LHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQRT 1147
            L DII  + G+ + + + L+R F    E  K  N +  E  K++   L  PS+ T
Sbjct: 1102 LADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSI---LHIPSKTT 1153

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  145 bits (367), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 122/235 (51%), Gaps = 11/235 (4%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N +   +I DP+    + ++ V  G+ +DP+E  GLAH CEH +L  GS+K
Sbjct: 48  RSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEH-LLFMGSRK 106

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GGS NA            +         H   ALD  +     PLF
Sbjct: 107 FPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQV------NHEHLKGALDRFSGFFTGPLF 160

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           S    +KEI A++SE+  N      +LY   + L+NPSHP+ +F TGN  TL  +P    
Sbjct: 161 SKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTLNEIPKSKG 220

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNIARPS 256
            +++  L +F+ +YY  + M LC+ G + L+TL+  A   F D+P    N+ RP+
Sbjct: 221 VDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDVP----NLPRPA 271

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 129/290 (44%), Gaps = 30/290 (10%)

Query: 690 LGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSKYEEXXXXXXXXXX 749
           L +T++GF + +  L+   +E +K+F   D    ++F+E     +SK             
Sbjct: 613 LDITITGFNDKLIILLTRFLEGLKAFKP-DRKRFEIFKE-----KSKQHLNNQLYEIPYS 666

Query: 750 SLGLLI--ILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCME-- 805
            +  L   ++ E  W  E++LE +E+++ E    F         +    + G++   E  
Sbjct: 667 QVSSLYNSLVNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEE-MFFETLVHGNIKYEEAD 725

Query: 806 KINSFLKWSLTSHLEDTREYQGPVREPGAKILKAG-TNIFVKRNAFSDDPNNSIVYFIQT 864
           +I+S ++   ++ + +++     +R   + +L  G T+ +  + A + + N+ I Y IQ 
Sbjct: 726 QIDSLIQMLRSNSVSNSQIKNARIR---SYVLPLGKTHRYEAKLADTQNVNSCIQYVIQL 782

Query: 865 GEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTSIGLHITCMSN 921
           G  ++A     + +   F  +   P    LR K+Q+GY VF        +  + I   S 
Sbjct: 783 GVYDEA----LSAIGRLFAQMLHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSE 838

Query: 922 SPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKYRVMVE 964
               +LE +IE +L    K L + M++ +F+ H        ++KY+ M E
Sbjct: 839 HTTPYLEWRIESFLEQFGKTLKE-MSDRDFENHKDALCKTLLQKYKNMKE 887

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  142 bits (357), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/246 (33%), Positives = 119/246 (48%), Gaps = 8/246 (3%)

Query: 7   KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
           K FDL F  P     R  +  +L N +   LI DP     + S+ V  G+  DP+   GL
Sbjct: 58  KTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGL 116

Query: 67  AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
           AH CEH +L  GS+K+P  N Y   L+++GGS NA            +         H  
Sbjct: 117 AHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEI------NHQHLF 169

Query: 127 KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            ALD  A     PLF+    +KEI A+ SE+  N      ++Y   + L NP+HP+ +F 
Sbjct: 170 GALDRFAGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFS 229

Query: 187 TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
           TGN  TL TLP  N  N++  L  FH  +Y  + M LC+ G + L+TL+      F D+ 
Sbjct: 230 TGNIETLGTLPKENGQNVRDELLQFHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDIS 289

Query: 247 ASGQNI 252
            + + +
Sbjct: 290 NNDREV 295

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 133/320 (41%), Gaps = 30/320 (9%)

Query: 645 ASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNL 704
           AS  N+M   +  Q++   L    Y ++  G     + +++G   L +T SG+ E +  L
Sbjct: 595 ASIINSMLSTLYIQMVNDALKDLQYDADCAGLRISFNKTNQG---LDITASGYNEKLIIL 651

Query: 705 IKIIVEEIKSFSSR----DIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEEC 760
           +   ++ + SF  +    +I+  K  R  +  +   YE           SL     + E 
Sbjct: 652 LTRFLQGVISFEPKKNRFEILKDKTIRHLKNLL---YEVPYSQMSNYYNSL-----INER 703

Query: 761 MWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCME--KINSFLKWSLTSH 818
            W   ++L+  E++S E    F    +    +    I G++   E  +++S +K  +T +
Sbjct: 704 SWSTAEKLQVFEKLSYEQLINFIPT-IYEGAFFETLIHGNIKREEAMEVDSLIKSMITVN 762

Query: 819 LEDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPN-NSIVYFIQTGEREDARAYTYTC 877
           + + +     +R   + +L  G + F    A  D  N NS    IQ   + D  +   + 
Sbjct: 763 INNLQVSNNRLR---SYLLPKGKS-FRYETALKDSLNVNSC---IQHVTQLDVYSEELSA 815

Query: 878 LAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEY 934
           L+  F  L   P    LR K+Q+GY VF        +  + I   S     +LE +I  +
Sbjct: 816 LSGLFTQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRITNF 875

Query: 935 LSYLEKCLLDTMTEEEFQEH 954
                + L D M +E+F++H
Sbjct: 876 YETFGQTLKD-MKQEDFEKH 894

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 118/246 (47%), Gaps = 8/246 (3%)

Query: 7   KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
           K F+L F  P     R  +  +L N +   LI DP     + S+ V  G+  DP    GL
Sbjct: 58  KTFNLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGL 116

Query: 67  AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
           AH CEH +L  GS+K+P  N Y   L+++GGS NA                 +    H  
Sbjct: 117 AHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNY------FFEVNHQHLF 169

Query: 127 KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            ALD  +     PLF+    +KEI A+ SE+  N      ++Y   + L N  HP+ +F 
Sbjct: 170 GALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFS 229

Query: 187 TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
           TGN  TL TLP  N  N++  L  FHK +Y  + M LC+ G + L+TL+      F D+ 
Sbjct: 230 TGNIETLGTLPKENGLNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKDVA 289

Query: 247 ASGQNI 252
            +G+ +
Sbjct: 290 NNGREV 295

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 91/432 (21%), Positives = 168/432 (38%), Gaps = 55/432 (12%)

Query: 616  EVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLG 675
            ++W K++  D  +  +  +          AS  N+M   +  QL    L    Y +    
Sbjct: 568  KLWYKKD--DRFWQPRGYIYLSFKLPHTHASIINSMLSTLYTQLANDALKDVQYDAACAD 625

Query: 676  YTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR----DIISSKVFREARI 731
                 + +++G   L +T SGF E +  L+   ++ + SF  +    +I+  K  R  + 
Sbjct: 626  LRISFNKTNQG---LAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILKDKTIRHLKN 682

Query: 732  AVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPT 791
             +   YE           +     I+ E  W   ++L+  E+++ E    F         
Sbjct: 683  LL---YEVPYSQMSNYYNA-----IINERSWSTAEKLQVFEKLTFEQLINFIPTIYEG-V 733

Query: 792  YMNLFIQGDMSCME--KINSFLKWSLTSHLEDTREYQGPVREPGAKILKAGTNIFVKRNA 849
            Y    I G++   E  +++S +K  + +++ + +     +R   + +L  G   F    A
Sbjct: 734  YFETLIHGNIKHEEALEVDSLIKSLIPNNIHNLQVSNNRLR---SYLLPKG-KTFRYETA 789

Query: 850  FSDDPN-NSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGL 905
              D  N NS    IQ   + D  +   + L+  F  L   P    LR K+Q+GY VF   
Sbjct: 790  LKDSQNVNSC---IQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSS 846

Query: 906  RLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRK 958
                 +  + I   S     +LE +I  +     + L D M EE+F++H        ++K
Sbjct: 847  LNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQVLRD-MPEEDFEKHKEALCNSLLQK 905

Query: 959  YRVMVEN-------------NQVNRMQKTAGPADLMGQIEANVRSGN-LEEQGSAMRLHK 1004
            ++ M E              N  +R +K    A++  Q   +      + E  S + LH 
Sbjct: 906  FKNMAEESARYTAAIYLGDYNFTHRQKKAKLVANITKQQMIDFYENYIMSENASKLILH- 964

Query: 1005 NTKNQISNRRYN 1016
              K+Q+ N+  N
Sbjct: 965  -LKSQVENKELN 975

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  136 bits (342), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 116/246 (47%), Gaps = 8/246 (3%)

Query: 7   KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
           K FDL F  P     R  +  +L N +   LI DP     + S+ V  G+  DP+   GL
Sbjct: 59  KTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGL 117

Query: 67  AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
           AH CEH +L  GS+K+P  N Y   L+++GGS NA            +         H  
Sbjct: 118 AHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV------NHQHLL 170

Query: 127 KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            ALD  +     PLF     +KEI A+ SE+  N      ++Y   + L N  HP+ +F 
Sbjct: 171 GALDRFSGFFSCPLFQKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFS 230

Query: 187 TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
           TGN  TL   P  N  NI+  L  FHK +Y  + M LC+ G + L+TL++     F D+ 
Sbjct: 231 TGNIETLGESPKENGLNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKDVS 290

Query: 247 ASGQNI 252
            + + +
Sbjct: 291 NNDREV 296

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 145/362 (40%), Gaps = 54/362 (14%)

Query: 685  KGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR----DIISSKVFREARIAVRSKYEEX 740
            K +  L +T SGF E +  L+   ++ + SF  +    +I+  K  R  +  +   YE  
Sbjct: 633  KTNQGLDITASGFNEKLIVLLTRFLQGVVSFEPKKDRFEILKDKTIRHLKNLL---YEVP 689

Query: 741  XXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGD 800
                     SL     + E  W   ++L+  E+++ E    F         +    + G+
Sbjct: 690  YSQMSNYYNSL-----INERSWSTAEKLQVFEKLTFEQLNSFIPTIYEG-VFFETLVHGN 743

Query: 801  MSCME--KINSFLKWSLTSHLEDTREYQGPVRE---PGAKILKAGTNIFVKRNAFSDDPN 855
            +   E  +++S +K  + +++++ +     +R    P  K  +  T++         DP 
Sbjct: 744  IKHEEAIEVDSLIKSLIANNIDNLQVSNNRLRSYLLPKGKSFRYETDL--------KDPK 795

Query: 856  NSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTSI 912
            N +   IQ   + D  +   + L+  F  L   P    LR K+Q+GY VF        + 
Sbjct: 796  N-VNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTA 854

Query: 913  GLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKYRVMVEN 965
             + I   S     +LE +I  +     + L D MT+E+F +H        ++K++ M E 
Sbjct: 855  NIRILIQSEHTTPYLEWRINNFYETFGQHLKD-MTQEDFDKHKEALCNSLLQKFKNMSEE 913

Query: 966  -------------NQVNRMQKTAGPADLMG-QIEANVRSGNLEEQGSAMRLHKNTKNQIS 1011
                         N  +R +K    AD+   QI     S  + E  S + LH   K+Q+ 
Sbjct: 914  SARYTAAIYLGDYNFTHRQKKAKLVADITKQQIIDFYESYIMGENASKLILH--LKSQVE 971

Query: 1012 NR 1013
            N+
Sbjct: 972  NK 973

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  133 bits (335), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 124/255 (48%), Gaps = 12/255 (4%)

Query: 1   MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
           MS  + K  +  F  P     R  +  QL N +   LI D      + ++ V  G+  DP
Sbjct: 27  MSNNNYKKLEGQFVKP-DLDDRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDP 85

Query: 61  DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
           +   GLAH CEH +L  GS+KYP  N Y   L+++GG+ NA            +      
Sbjct: 86  EGLPGLAHFCEH-LLFMGSEKYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV------ 138

Query: 121 GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
              H   ALD  A     PLF+    +KEI A++SE+  N      +LY   + L N  H
Sbjct: 139 NHEHLFGALDRFAGFFTCPLFNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEH 198

Query: 181 PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
           P+ +F TGNF TL  +P+ N  +++  L  F+K+ Y  + M LC+ G + L+TL+  A  
Sbjct: 199 PYHKFSTGNFITLHEIPTSNGIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACS 258

Query: 241 FFGDLPASGQNIARP 255
            F D+P    NIARP
Sbjct: 259 LFQDVP----NIARP 269

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 75/359 (20%), Positives = 146/359 (40%), Gaps = 32/359 (8%)

Query: 606 PRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLS 665
           P L   +   ++W K+++          +SF++      AS  N+M   +  QL+   + 
Sbjct: 533 PLLLKDDKISKLWYKKDDRFWQPRGYIYISFKL--PHTQASIVNSMLSTLYVQLINDYIK 590

Query: 666 ATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKV 725
              Y +         S +++G   L +TV GF + +  L+   +E +KSF        ++
Sbjct: 591 DLQYDAACADLHLSFSKTNQG---LDITVVGFNDKLTILLTRFLEGLKSFKPEKN-RFQI 646

Query: 726 FRE--ARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFC 783
           F++   R      YE           SL     + E  W ++++LE L+ ++ E    + 
Sbjct: 647 FKDKCTRQLTNQLYEVPYLQVFPVYSSL-----INERTWSVKEKLEVLKRLTFEQLVTYL 701

Query: 784 SHFLTSPTYMNLFIQGDMSCME--KINSFLKWSLTSHLEDTREYQGPVRE---PGAKILK 838
              +    +   F+ G+M   E  +++S ++  + + + + +   G +R    P  +  +
Sbjct: 702 PT-IYEEMFFEAFVHGNMKYEEAIEVDSLVQMLVPNDIRNFQTKNGKLRSYFLPQGETYR 760

Query: 839 AGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKK 895
             T +   +N      N+ I +  Q G      +   +  A  F  +   P    LR K+
Sbjct: 761 YETKLQDSQNL-----NSCIQHVTQLG----VYSEEISAKASLFAQMIHEPCFDTLRTKE 811

Query: 896 QIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH 954
           Q+GY VF        +  + I   S      LE +IE +L    K L D M++++F+ H
Sbjct: 812 QLGYVVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGFGKILQD-MSDKDFEGH 869

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  133 bits (334), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 7/231 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  +L N +   LI DP     + S+ V  G+  DP++  GLAH CEH +L  GS+K
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEH-LLFMGSEK 130

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GGS NA                 +    H   ALD  +     PLF
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNY------FFEVNHQHLFDALDRFSGFFSCPLF 184

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +    +KEI A+ SE+  N      ++Y   + L N  HP+ +F TGN  TL T P  N 
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENG 244

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNI 252
            NI+  L  FHK +Y  + M LC+ G + L+TL+      F ++  +G+ +
Sbjct: 245 LNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKNVSNNGREV 295

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/376 (21%), Positives = 152/376 (40%), Gaps = 39/376 (10%)

Query: 606 PRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLS 665
           P L   +    +W K++  D  +  +  +          AS  N+M   +  QL+   L 
Sbjct: 558 PILLLSDGGSRLWYKKD--DRFWQPRGYIYLSFKLPHTHASIVNSMLSTLYIQLVNDALK 615

Query: 666 ATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR----DII 721
              Y +         S +++G   L +T SGF E +  L+   ++ + SF  +    +I+
Sbjct: 616 DLQYDAACADLRISFSKTNQG---LDITASGFNEKLIILLTRFLQGVTSFEPKKDRFEIL 672

Query: 722 SSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTM 781
             K  R  +  +   YE           +L     + E  W   ++L+  E+++ E    
Sbjct: 673 KDKTIRHLKNLL---YEVPYSQMSNYYNAL-----INERSWSTVEKLQVFEKLTFEQLIN 724

Query: 782 FCSHFLTSPTYMNLFIQGDMSCME--KINSFLKWSLTSHLEDTREYQGPVREPGAKILKA 839
           F    +    +    I G++   E  +++S +K  +T+++ + +     +R   + +L  
Sbjct: 725 FIPT-IYEGVFFETLIHGNIKHEEAVEVDSLIKSLITNNINNLQVANNRLR---SYLLPK 780

Query: 840 GTNIFVKRNAFSDDPN-NSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKK 895
           G + F    A  D  N NS    IQ   + D  +   + L+  F  L   P    LR K+
Sbjct: 781 GKS-FRYETALKDSQNVNSC---IQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKE 836

Query: 896 QIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH- 954
           Q+GY VF        +  + I   S     +LE +I  +     + L D MT+E+F++H 
Sbjct: 837 QLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQILRD-MTKEDFEKHK 895

Query: 955 ------YIRKYRVMVE 964
                  ++K++ M E
Sbjct: 896 EALCNSLLQKFKNMAE 911

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  133 bits (334), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 118/231 (51%), Gaps = 7/231 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  +L N + V L+ D +    + S+ V  G+  DP++  GLAH CEH +L  GSKK
Sbjct: 67  RKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEH-LLFMGSKK 125

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GG+ NA            +     + E  +D ALD  +     PLF
Sbjct: 126 FPNENEYASFLSKHGGASNAYTASQNTNYYFHV-----NHENLYD-ALDRFSGFFSCPLF 179

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           ++    KEI A++SE+  N      +LY   + L NP HP+ +F TGNF TL ++P    
Sbjct: 180 NESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSKG 239

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNI 252
            N++  L  F+ R Y  + M L + G + L+TL + A   F D+P  G  +
Sbjct: 240 VNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDVPNHGTKV 290

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 75/367 (20%), Positives = 146/367 (39%), Gaps = 37/367 (10%)

Query: 616 EVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLG 675
           ++W K++  D+ +  K  +   +      +S  N+M   +    +  +L    Y +E  G
Sbjct: 564 KLWYKKD--DMFWVPKGYIYISMKLPHTHSSIVNSMLCTLYVDHINDSLKDLAYNAECAG 621

Query: 676 YTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAV-- 733
               +  +++G   L L++SG+ + +  L+    E I+             RE R  V  
Sbjct: 622 LEISLRKTNQG---LDLSLSGYNDKLLVLLARFFEGIQKL---------FLREERFMVLK 669

Query: 734 -RSKYEEXXXXXXXXXXSLGLLI--ILEECMWPIEDRLEALEEISQETFTMFCSHFLTSP 790
            R   +            +G L   ++ E  W  +++L+  E+++ +    F    +   
Sbjct: 670 QRLIQKLHNHLYDTPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLANFVPT-IYEQ 728

Query: 791 TYMNLFIQGDMSCMEKINSFLKWSLTSHL--EDTREYQGPVREPGAKILKAGTNIFVKRN 848
            Y  L + G+ S  E +  +    L S L   + R  +G   +  +  + AG   +    
Sbjct: 729 MYFELLVHGNFSHEEALEVY---DLVSSLVPNEIRNSEGRNSKLRSYFIPAG-GAYHYET 784

Query: 849 AFSD--DPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLR 906
           A +D  + N+ I   IQ G   +  +   + LA+  ++      LR ++Q+GY VF    
Sbjct: 785 ALADKENVNSCIQKVIQLGAYSELLSAKGSLLAQM-VNEPCFNTLRTEEQLGYVVFSSKL 843

Query: 907 LLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKY 959
               ++ L I   S     +LE +I+          L+ M+  EF++H         +KY
Sbjct: 844 NTHGTVNLRILVQSERSSSYLESRIDTSCQKFGST-LEMMSNAEFEKHKDAICKTLQQKY 902

Query: 960 RVMVENN 966
           R + E N
Sbjct: 903 RNLGEEN 909

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  133 bits (334), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 118/245 (48%), Gaps = 8/245 (3%)

Query: 1   MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
           M+  S KN +L F  P     R  +  +L N +   LI+DP     + S+ V  GS NDP
Sbjct: 25  MTAASYKNHNLSFQKP-DLDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
           +   GLAH CEH +L  GS+K+P  N Y   L+++GG  NA            + A    
Sbjct: 84  EPLPGLAHFCEH-LLFMGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEINA---- 138

Query: 121 GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180
              H   ALD  +     PLF+    +KEI A++SE+  N      ++Y   + L+N  H
Sbjct: 139 --EHLFGALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240
           P+ +F TGN  TL  LP     NI+  L  F+   Y  + M LC+ G + L+TL +    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 FFGDL 245
            F D+
Sbjct: 257 LFNDV 261

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 85/377 (22%), Positives = 154/377 (40%), Gaps = 40/377 (10%)

Query: 606 PRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLS 665
           P L  +    ++W K+++          +SF++    +  S  N+M   +  QL+  +L 
Sbjct: 532 PHLLKETELGKLWYKKDDRFWQPRGHIYISFKLPHTHL--SLLNSMLTTLYVQLINDSLK 589

Query: 666 ATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKV 725
              Y +        ++ +++G   L +TVSGF + +  L+   ++ IKSF        ++
Sbjct: 590 DLQYDASCANLHASLTKTNQG---LDITVSGFNDKLIILLTRFLQGIKSFKPNSD-RFQI 645

Query: 726 FREARIA--VRSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFC 783
           F++  I     S YE           SL     + E  W   ++L AL++IS +    F 
Sbjct: 646 FKDKTIQHLQNSLYEVPYSQMSTLYNSL-----INERTWTTTEKLSALDKISYDQLLTFI 700

Query: 784 SHFLTSPTYMNLFIQGDMSCME--KINSFLKWSLT-SHLEDTREYQGPVRE---PGAKIL 837
                   Y    I G++   E  +I+S +K  LT +++ + +     +R    P  K  
Sbjct: 701 PTIFEE-LYFESLIHGNLKYDEAMEIDSLVKLLLTENNILNLQIQNDKLRSYILPKGKTF 759

Query: 838 KAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNK 894
           +  T++         DP N +   IQ   + D  +   +     F  +   P    LR K
Sbjct: 760 RYETDL--------KDPKN-VNSCIQHVTQIDIYSEELSAKCALFAQMIHEPCFDTLRTK 810

Query: 895 KQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH 954
           +Q+GY VF        +  + I   S     +LE +I+ +     K  L TM+E+ F +H
Sbjct: 811 EQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDNFYKIFGKS-LKTMSEDTFVKH 869

Query: 955 -------YIRKYRVMVE 964
                   ++KY+ M E
Sbjct: 870 KDALCKSLLQKYKNMNE 886

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 115/231 (49%), Gaps = 7/231 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N + VFLI D S    + ++ V  G   DP++  GLAH CEH +L  GS+K
Sbjct: 78  RNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEH-LLFMGSEK 136

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+ +GG+ NA            +    + G L+   ALD  +    +PLF
Sbjct: 137 FPNENEYSSYLSHHGGASNAYTSTQNTNYYFMV----NHGNLY--DALDRFSGFFTSPLF 190

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           S    NKE+ A++SE+  N      ++    R L NP HPF +F TGN+ TL   P    
Sbjct: 191 SVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSRG 250

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNI 252
             I+  L  F+ + Y  + M L + G + L+TL+  A   F D+P  G ++
Sbjct: 251 IEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVPDKGIDV 301

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/367 (19%), Positives = 156/367 (42%), Gaps = 49/367 (13%)

Query: 618 WVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYT 677
           WV E  + +SF      S      SV  S  +T+Y+E    ++  +L   LY +E   + 
Sbjct: 584 WVPEGHVYVSFKLPHSYS------SVVNSMLSTLYVE----MVKDSLKDLLYNAECANFE 633

Query: 678 YEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR----DIISSKVFREARIAV 733
                +++G   L L+++G+ + +  L+  I+E I++F  +    D++        ++  
Sbjct: 634 VSFVKTNQG---LDLSLTGYNDKMTLLLTSILEGIRNFDPKKERFDVLQ-------KLLC 683

Query: 734 RSKYEEXXXXXXXXXXSLGLLI--ILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPT 791
           +  Y             +G+L   ++ +  W   ++L+  ++++ E F  F    +    
Sbjct: 684 QKLYNRLYNVPYS---QIGVLYNSLINDRSWTPSEKLKVTKQLTFEHFKAFVPS-IYEQM 739

Query: 792 YMNLFIQGDMSCMEKI--NSFLKWSLTSHLEDTREYQGPVRE---PGAKILKAGTNIFVK 846
           Y    + G+    + I  NS++   + + ++ +       R    P  K  +  T +F +
Sbjct: 740 YFETLVHGNFPENQAIELNSYICSLIPNQIKHSGARNNRPRSYMLPEGKTYRYETTLFDE 799

Query: 847 RNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLR 906
            N      N+     IQ G   +      + LA+  ++      LR ++Q+GY V+   +
Sbjct: 800 ENV-----NSCFEMVIQLGMYSEDMNAKGSLLAQL-INEPCFNTLRTEEQLGYVVWSSKQ 853

Query: 907 LLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKY 959
               S  L I   S S   ++E +++++L+      L +M+E+ F++H        ++K+
Sbjct: 854 NTHASTNLRILVQSESDTVYIESRVDKFLNNFADT-LRSMSEQAFEKHKGALCNTLLQKF 912

Query: 960 RVMVENN 966
           + M E N
Sbjct: 913 KNMREEN 919

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  130 bits (326), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 122/249 (48%), Gaps = 10/249 (4%)

Query: 8   NFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLA 67
           N ++ F  P+    R  +  +L N + V LI D +    + ++ V  GS  DP+   GLA
Sbjct: 43  NHNIEFKKPLL-DDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLA 101

Query: 68  HLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDK 127
           H CEH +L  GS KYP  N Y   L+++GG  NA            +    + G LH   
Sbjct: 102 HFCEH-LLFMGSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQV----NQGNLH--G 154

Query: 128 ALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCT 187
           ALD  +     PLF+    +KEI A++SE+  N      +LY   +  ++P HP+ +F T
Sbjct: 155 ALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHPYHKFST 214

Query: 188 GNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPA 247
           GN  TL  LP     +++  L  F+ R Y  + M LC+ G + L+ L++     F D+P 
Sbjct: 215 GNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDLFKDVP- 273

Query: 248 SGQNIARPS 256
             +++  PS
Sbjct: 274 -NRDVPVPS 281

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 81/375 (21%), Positives = 151/375 (40%), Gaps = 33/375 (8%)

Query: 606 PRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLS 665
           P L  ++    +W K+++          VS +++     +S  N+M   +   L+   L 
Sbjct: 542 PLLLLQDGQSRLWYKKDDRFWVPKGHIYVSMKLVH--TYSSIVNSMLTSLYVDLVNDFLK 599

Query: 666 ATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKV 725
              Y S+    T     +++G   L L +SG+ E +  L+   +E I  F        K+
Sbjct: 600 DIQYDSQVASLTVSFRKTNQG---LDLALSGYNEKMPILLTSYLEGISRFKPNQE-RFKI 655

Query: 726 FREARIAVRSK--YEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEIS---QETF- 779
           F+   I   +   YE           SL     + E  W I+D+LE +E+++    E F 
Sbjct: 656 FQAKLIQKLNNHLYEIPYSQASDVYNSL-----INERSWTIKDKLEVVEQLTFQHLENFL 710

Query: 780 -TMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKILK 838
            T+F   F  +  + N   +  +   + + +     + + L  + + +     PG     
Sbjct: 711 PTIFEQFFFEALVHGNFSYETAVEIHKLVKALAPNDIKNCLLKSSKPRSLHIPPGRAYY- 769

Query: 839 AGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIG 898
                + +R A   + N+ I +  Q G   +  A      A+  +       LR K+Q+G
Sbjct: 770 -----YEQRLADEKNINSCIQHVNQFGTYSEELAAKAALFAQL-IDEPAFDTLRTKEQLG 823

Query: 899 YAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH---- 954
           Y VF        ++ L I   S      LE +I+ +L+ + + L D M+EEEF+ H    
Sbjct: 824 YVVFSSALNTHGTVNLRILIQSERDTAFLESRIDAFLAKMGQILQD-MSEEEFERHRTAL 882

Query: 955 ---YIRKYRVMVENN 966
               +++Y+ + E N
Sbjct: 883 CKTLLQRYKNLSEEN 897

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 110/224 (49%), Gaps = 7/224 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N +   LISDP+    + ++ V  G+  DP+E  GLAH CEH +L  GS K
Sbjct: 45  RSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEH-LLFMGSSK 103

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GGS NA            +         H   ALD  +     PLF
Sbjct: 104 FPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQV------NYEHLYGALDRFSGFFTGPLF 157

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +    +KEI A++SE+  N      +LY   + L N  HP+ +F TGN  TL T P    
Sbjct: 158 NKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKELG 217

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDL 245
            +I+  L  F+ + Y  + M LC+ G + L+T+TK     F D+
Sbjct: 218 LDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDV 261

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 96/469 (20%), Positives = 181/469 (38%), Gaps = 53/469 (11%)

Query: 512 DQSKSNFLASVRSTTKTDAYYEFDYRIAYV--DMLSIQLDDYTAP--NYHFHAPSYDTFL 567
           + S+   +     T+K + +Y  +Y +     D+L+      + P  N H H P  + F 
Sbjct: 458 ENSRITLIGKDLKTSKREKWYGTEYEVEKYSPDLLA----KISTPLLNSHLHLPHPNEF- 512

Query: 568 PMVARKLSLIKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLS 627
                    I    +V      SA   ++P  +     P L  +N   +VW K++  D  
Sbjct: 513 ---------IANNFKVDKPEGSSAD-EIVPLEE-----PLLISENETGKVWFKKD--DRF 555

Query: 628 FSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGD 687
           +  +  +          AS  N+M   +  QL+  +L    Y +           +++G 
Sbjct: 556 WQPRGYIYLTFKLPHTHASALNSMLSTLYVQLINDSLKDLQYNANCANLRASFVKTNQG- 614

Query: 688 VRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSKYEEXXXXXXXX 747
             L LT+ GF + +  L+  ++E IKSF        K+F++  +      +         
Sbjct: 615 --LDLTLYGFNDKLIILLTRLLEGIKSFKLEQP-QFKIFKDKSV---QHLKNLMYEVPYS 668

Query: 748 XXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCME-- 805
             S     ++ E  W +E++L+ +E+I+ E    F         Y    I G++   E  
Sbjct: 669 QISTVYNYLINERSWSVEEKLDVMEKITYEELINFIPTIFEE-LYFEALIHGNLKYEEAM 727

Query: 806 KINSFLKWSLTSHLEDTREYQGPVRE---PGAKILKAGTNIFVKRNAFSDDPNNSIVYFI 862
           +I S +K    S +   +     +R    P  +  +  T +   +N       NS + ++
Sbjct: 728 EIASLVKILQPSDVTRLQTKNSRMRSYLIPRGETYRYETKLKDAKNV------NSCIQYV 781

Query: 863 QTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNS 922
              +  D +    + L    +       LR K+Q+GY VF        +  + I   S  
Sbjct: 782 TQLDVYDEKLSAKSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANMRILIQSEH 841

Query: 923 PPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKYRVMVE 964
              +LE +I+ +     + LL+ M+EE+F +H        ++KY+ M E
Sbjct: 842 TTPYLEFRIDTFYQKFGE-LLNAMSEEDFSKHKNALCKSLLQKYKNMQE 889

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 128/273 (46%), Gaps = 10/273 (3%)

Query: 5   STKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEAL 64
           S K+F L F  P     R  +  +L N +   +I DP+    + ++ V  G+  DP+   
Sbjct: 46  SYKDFKLNFIKP-DLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLP 104

Query: 65  GLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELH 124
           GLAH CEH +L  GS+K+P  N Y   L+++GGS NA            +         H
Sbjct: 105 GLAHFCEH-LLFMGSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV------NHEH 157

Query: 125 FDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSR 184
              ALD  +     PLF+    +KEI A++SE+  N      ++Y   + L+N  HP+ +
Sbjct: 158 LYNALDRFSGFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHK 217

Query: 185 FCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGD 244
           F TGN  TL   P     NI+  L  F+   Y  + M LC+ G + L+TL+  A + F D
Sbjct: 218 FSTGNLITLGENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKD 277

Query: 245 LPASGQNIARPSSSSLFSNKGTAQSMPYFKILK 277
           +     N A P  SS   N+   Q +   K +K
Sbjct: 278 V--RNTNRALPEYSSKILNETHLQKIIQVKPVK 308

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 142/366 (38%), Gaps = 37/366 (10%)

Query: 616 EVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLG 675
           ++W K++  D  +  +  +   +      AS  N+M   I  QL    L    Y +    
Sbjct: 558 KLWFKKD--DRFWQPRGYIYVSLKLPHTHASVLNSMLSTIYVQLANDFLKDLQYDASCAN 615

Query: 676 YTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRS 735
                  +++G   L +T+SGF + +  L+   ++ +K F   +    K+F++       
Sbjct: 616 LNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQGVKDFKPTEE-RFKIFKDKTTQHLK 671

Query: 736 K--YEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYM 793
              YE           SL     + E  W +E++L  +E I+ E    F         Y 
Sbjct: 672 NLLYEVPYSQISGVYNSL-----INERSWSVEEKLNVVEHITFEQLLAFIPTVFEELYYE 726

Query: 794 NLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAK-----ILKAGTNIFVKRN 848
            L + G++   E I      SL + +  T E    ++    +     I K  T  F K  
Sbjct: 727 TL-VHGNLKFEEAIEI---ESLINDILITNENHNNLQVKNNRLRSYFIPKGKTYRFEKEL 782

Query: 849 AFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGL 905
             S + N+ I +  Q     D      + L+  F  +   P    LR K+Q+GY VF   
Sbjct: 783 KDSKNVNSCIQHVTQL----DVYNEELSALSGLFAQMIHEPCFDTLRTKEQLGYVVFSSS 838

Query: 906 RLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRK 958
                +  + I   S     +LE +IEE+ S     L D M+EE+F +H        ++K
Sbjct: 839 LNNHGTANIRILVQSEHTTPYLEWRIEEFYSKFGAILKD-MSEEDFDKHKDALCKSLLQK 897

Query: 959 YRVMVE 964
           Y+ M E
Sbjct: 898 YKNMGE 903

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  127 bits (320), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 115/239 (48%), Gaps = 8/239 (3%)

Query: 7   KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
           K ++L F  P     R  +  +L N + V LI D +    + S+ V  G+  DP+   GL
Sbjct: 6   KTYNLNFAKP-DLDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGL 64

Query: 67  AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
           AH CEH +L  GS+KYP  N Y   L+ NGGS+NA            +         H +
Sbjct: 65  AHFCEH-LLFMGSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEI------NYEHLE 117

Query: 127 KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            ALD  +     PLFS    +KEI A++SE+  N      ++Y   + L+N  HP+ +F 
Sbjct: 118 GALDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFS 177

Query: 187 TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDL 245
           TGN  TL T+P+    +I+  L  F+   Y  + M L + G + L+ L   A   F D+
Sbjct: 178 TGNIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDV 236

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 139/338 (41%), Gaps = 39/338 (11%)

Query: 645 ASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNL 704
           AS  N+M   +  QL+   L    Y +         S + +G   L +TVSGF   +  L
Sbjct: 543 ASITNSMLTSLYVQLVNDQLKDLQYDASCASLDISFSKTGQG---LDITVSGFNHKILIL 599

Query: 705 IKIIVEEIKSFS---SRDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILEECM 761
           ++  ++ IK+F    SR +I    F+E  I    + +           S     ++++  
Sbjct: 600 LESFLKGIKNFKLEKSRFLI----FQEKYI---QQLKNMLFQVPYGQVSHYYNYVIDDRA 652

Query: 762 WPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDM--SCMEKINSFLKWSLTSHL 819
           W I+++L  +++++ E    F         Y    + G+   S   ++N  ++  ++  +
Sbjct: 653 WSIKEKLSTMQKLTFEDLENFLPTIFNE-VYFESLVHGNFEKSDAAEVNQLVEKYISGSI 711

Query: 820 EDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDP---NNSIVYFIQTGEREDARAYTYT 876
            + +     +R   + +L+ G     +     +DP   N+ I +  Q G   D  A    
Sbjct: 712 HNPQIRNDRLR---SYVLQKGET--YRYETLLEDPENVNSCIQHVTQIGLYNDRLA---- 762

Query: 877 CLAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEE 933
            L+  F  +   P    LR K+Q+GY VF        +  + I   S    E+LE +I+E
Sbjct: 763 ALSSLFAQIINEPCFNILRTKEQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDE 822

Query: 934 YLSYLEKCLLDTMTEEEFQEH-------YIRKYRVMVE 964
           +   + K +L  M  E F+ H        ++KY+ M E
Sbjct: 823 FYKSV-KTILTQMAPETFENHKDALCKTLLQKYKNMKE 859

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  127 bits (318), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 110/238 (46%), Gaps = 14/238 (5%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N +   LISDP     + S+ V  G+  DP+   GLAH CEH +L  GS+K
Sbjct: 91  RSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEH-LLFMGSEK 149

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GG  NA            +         H   ALD  +     PL 
Sbjct: 150 FPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEV------NHEHLHGALDRFSGFFTGPLM 203

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +     KEI A++SE+  N      + Y   + ++N +HP+ +F TGN  TL   P+   
Sbjct: 204 NADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKLG 263

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGD-------LPASGQNI 252
            N +  L  F+   Y  + M LC+ G Q L+TL+  A  FF D       LP   +NI
Sbjct: 264 LNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDVKNLNKALPQYNENI 321

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 112/231 (48%), Gaps = 7/231 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  +L N +   LI DP+    + ++ V  GS  DP++  GLAH CEH +L  GS K
Sbjct: 56  RNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFCEH-LLFMGSSK 114

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GG  NA            +   S  G      AL   +     PLF
Sbjct: 115 FPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVNQESLHG------ALLRFSGFFSCPLF 168

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +    +KEI A++SE+  N      +LY   +  +NP HPF +F TGN  TL  +P    
Sbjct: 169 NKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNLKTLGDIPKSKD 228

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNI 252
            +I+  L  F+   Y  + M LC+ G + L+T+++     F D+P S + +
Sbjct: 229 VDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDVPNSDRPV 279

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 80/399 (20%), Positives = 164/399 (41%), Gaps = 41/399 (10%)

Query: 593 LHLIPRSDFLQT--------------PPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEI 638
           LHL  R++F+ +               P L  ++   +VW K++  D  +  K  +   +
Sbjct: 515 LHLPRRNEFISSNFQVDKLEDVEPLQEPLLLKQDRQSKVWYKKD--DRFWVPKGHIYVSM 572

Query: 639 ISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFP 698
                 +S  N+M   +  +L+   L    Y ++          +++G   L L++SG+ 
Sbjct: 573 KLAHTYSSVVNSMLTTLYVELINDYLKDLEYDAQVASLHISFRKTNQG---LDLSLSGYN 629

Query: 699 EGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSKYEEXXXXXXXXXXSLGLLIILE 758
           E +  L+K  +E I +F      +   F+  +  +  K             S     ++ 
Sbjct: 630 EKMAILLKRYLEGIANFQP----AEDRFKIYQDKLLQKLNNHLYEVPYSQVSDVFNSVIN 685

Query: 759 ECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSH 818
           E  W I ++LE ++++  E   +F        ++  + + G+ SC   + +    +L   
Sbjct: 686 ERAWTIANKLEVVKQLKFEHLKLFIPAIFEQFSF-EILVHGNFSCEAALEAD---NLVRA 741

Query: 819 L--EDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPN--NSIVYFIQTGEREDARAYT 874
           L   D + +Q    +P + +L  G   F  +   +DD N  + I +  Q G   +  +  
Sbjct: 742 LAPRDVQNFQLKSSKPRSVLLPQG-KTFCYQQMLADDKNINSCIQHVTQFGSYSEELSAK 800

Query: 875 YTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEY 934
            +  A+  +       LR K+Q+GY VF        ++ L +   S     +LE +I+ +
Sbjct: 801 ASLFAQL-IDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAF 859

Query: 935 LSYLEKCLLDTMTEEEFQEHYI-------RKYRVMVENN 966
           L  + + +L  M++EEF+ H +       ++Y+ + E N
Sbjct: 860 LVKMGQ-VLQEMSDEEFERHKVALCKTLLQRYKNLSEEN 897

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  124 bits (311), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 119/256 (46%), Gaps = 9/256 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N +   LISD      + ++ V  GS  DP+   GLAH CEH +L  G++K
Sbjct: 60  RKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEH-LLFMGNEK 118

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           YP  N Y   L+++GGS NA            L         +   ALD  +     PLF
Sbjct: 119 YPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL------NHENLYPALDRFSGFFSCPLF 172

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +    +KEI A++SE+  N      ++Y   + L N  HP+ +F TGN  TL  +P L  
Sbjct: 173 NKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLKG 232

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNIARPSSSSLF 261
            +I+  L  FHK  Y  + M LC+ G + L+TL       F D+P   + +  P   +  
Sbjct: 233 IDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDVPNLNKQV--PYYPARL 290

Query: 262 SNKGTAQSMPYFKILK 277
             +   + M Y K +K
Sbjct: 291 YTESQLKKMVYCKPVK 306

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 2/100 (2%)

Query: 855 NNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGL 914
           N+ I Y IQ G   +  A   + +++  +       LR K+Q+GY VF  +     +  L
Sbjct: 785 NSCIQYLIQLGAYSEELAAKASLVSQL-IHEPCFDTLRTKEQLGYIVFSAVANTHGTTNL 843

Query: 915 HITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH 954
            +   S     ++E +I ++L+   + L + M EE F++H
Sbjct: 844 RVLVQSERDSAYVESRIVKFLNSFGEALKE-MPEEAFEKH 882

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  122 bits (306), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 109/224 (48%), Gaps = 7/224 (3%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           R  +  QL N +   LI DP+    + ++ +  G+  DP+   GLAH CEH +L  GS K
Sbjct: 60  RNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLAHFCEH-LLFMGSSK 118

Query: 82  YPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
           +P  N Y   L+++GG+ NA            +      G      ALD  +    +PLF
Sbjct: 119 FPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNHEDLRG------ALDRFSGFFTSPLF 172

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
           +    +KEI A++SE+  N      ++Y   +   +P HP+ +F TGN  TL   P    
Sbjct: 173 NKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFSTGNLKTLGETPKNQG 232

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDL 245
            +I+  L  F+ ++Y  + M LC+ G + L+T+++     F D+
Sbjct: 233 LDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYELFKDV 276

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/366 (21%), Positives = 155/366 (42%), Gaps = 35/366 (9%)

Query: 616 EVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLG 675
           ++W K++  D  ++ +  +   +      +S  N+M   +  +L+   L    Y +E   
Sbjct: 556 KLWYKKD--DTFWAPRGYIYVSMKLAHTHSSIVNSMLTSLYVELINDHLKDLQYDAEVAN 613

Query: 676 YTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFRE--ARIAV 733
                S +++G   L +++ G+ E +  L+   +E IK F+ + +   K+F++   R   
Sbjct: 614 LHVSFSKTNQG---LDISLCGYNEKLTILLTRFLEGIKEFTPK-LDRFKIFQDKLVRKLN 669

Query: 734 RSKYEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYM 793
              YE           SL     + E  W  +++L+  ++++ E    F    +    Y 
Sbjct: 670 NHLYEVPYSQLSGIFNSL-----INERSWSTKEKLDLTKQLTFEHLKNFIPT-IYEQLYY 723

Query: 794 NLFIQGDMS--CMEKINSFLKWSLTSHLEDTREYQGPVRE---PGAKILKAGTNIFVKRN 848
            + + G+ S     +IN  +K  + + +++ +   G +R    P  K  +    +  ++N
Sbjct: 724 EILVHGNFSQEAATEINDLVKMMVPNDIKNLQVKNGKLRSYIIPQEKTFRMELPLADEKN 783

Query: 849 AFSDDPNNSIVYFIQTG-EREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRL 907
                 N+ I +  Q G   ED  A T   LA+  +       LR K+Q+GY VF     
Sbjct: 784 V-----NSCIQHVTQFGIYSEDLSAKT-ALLAQL-IDEPCFDTLRTKEQLGYVVFSSALS 836

Query: 908 LSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYI-------RKYR 960
              ++ L +   S     +LE +I+ +L      L + M EEEF++H +       +KY+
Sbjct: 837 THGTVNLRLLIQSERDSSYLESRIDSFLKKFGNILRE-MPEEEFEKHKVALCKTLSQKYK 895

Query: 961 VMVENN 966
            + E N
Sbjct: 896 NLREEN 901

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  120 bits (300), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 117/247 (47%), Gaps = 11/247 (4%)

Query: 2   SFESTKNFDLV---FYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHN 58
           S  S KN+ ++   F  P     R  +  +L N +   LISDP+    + S+ V  G+  
Sbjct: 28  SIMSNKNYTILNQDFQKP-DLDDRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFE 86

Query: 59  DPDEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAIS 118
           DP+   GLAH CEH +L  GS+K+P  N Y   L+++GG  NA            +    
Sbjct: 87  DPESLPGLAHFCEH-LLFMGSEKFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEI---- 141

Query: 119 DSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANP 178
                H   ALD  +     PLF+    +KEI A++SE+  N      ++Y   + L+  
Sbjct: 142 --NYEHLKGALDRFSGFFSCPLFNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLL 199

Query: 179 SHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLA 238
            HP+ +F TGN  TL  +P     N++  L  F+   Y  + M LC+ G + L+TL+   
Sbjct: 200 DHPYHKFSTGNLETLKIIPESKNVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYV 259

Query: 239 IRFFGDL 245
             FF D+
Sbjct: 260 QSFFKDV 266

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 90/463 (19%), Positives = 184/463 (39%), Gaps = 62/463 (13%)

Query: 509 MLGDQSKSNFLASVRSTTKTDAYYEFDYRIA--YVDMLSIQLDDYTAPNYHFHAPSYDTF 566
           M+   S+   ++    T   + +Y   Y++    VD+++        PN+H   P+    
Sbjct: 460 MIYSNSRITLISKNLETDSKEKWYGTKYKLEDYSVDLINKIKTPGLNPNFHLPRPN---- 515

Query: 567 LPMVARKLSLIKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDL 626
                     I     V   + +S    +IP  +     P L    S  ++W K++  D 
Sbjct: 516 --------EFIADNFHVDKPKNESD---IIPLEE-----PLLLKDTSMGKLWYKKD--DR 557

Query: 627 SFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKG 686
            +  +  +          ++  N+M   +  Q++  +L    Y +        +S +++G
Sbjct: 558 FWQPRGYIKISFKLPHTHSTLLNSMLTTLYVQMVNDSLKDLQYDASCANLHVSLSKTNQG 617

Query: 687 DVRLGLTVSGFPEGVYNLIKIIVEEIKSF---SSRDIISSKVFREARIA--VRSKYEEXX 741
              L +++SGF + +  L+   ++ IK F   S R     ++F++  I     S YE   
Sbjct: 618 ---LDISLSGFNDKLIILLTRFLQGIKDFKPTSER----FQIFKDKTIQHLKNSMYEVPY 670

Query: 742 XXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDM 801
                   +L     + E  W  E++L  + +++ +    F   F+    +   F+ G++
Sbjct: 671 SQMSSLYNAL-----INEKTWLPEEKLNMMNKLTLDQLNSFIP-FIFDELFFECFVHGNL 724

Query: 802 SCME--KINSFLKWSLTS--HLEDTREYQGPVRE---PGAKILKAGTNIFVKRNAFSDDP 854
              E  +I S +   ++S  +L +++     +R    P  K  +  T +  ++N      
Sbjct: 725 KYDEAIEIESLIDLLMSSKENLTNSQYENEKLRSYLLPKNKTYRYETLLKDRKNV----- 779

Query: 855 NNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTS 911
           N+ I + IQ     D  +   + +   F  +   P    LR K+Q+GY VF        +
Sbjct: 780 NSCIQHVIQV----DIYSEELSAICGLFAQMLHEPCFDTLRTKEQLGYVVFSSTLNNHGT 835

Query: 912 IGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH 954
             + I   S     +LE +I+E+       LL+ M++E+F +H
Sbjct: 836 ANIRILVQSEKSTPYLEWRIDEFYKKFGD-LLNGMSDEDFTKH 877

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  120 bits (300), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 110/241 (45%), Gaps = 8/241 (3%)

Query: 10  DLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHL 69
           DL F  P     R  +  +L N     LI D S    + S+ V  G+  DP    GLAH 
Sbjct: 62  DLNFIKP-DLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHF 120

Query: 70  CEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFDKAL 129
           CEH +L  GSKK+P  N Y   L ++GGS NA            +         H   AL
Sbjct: 121 CEH-LLFMGSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEI------NHEHLHGAL 173

Query: 130 DVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGN 189
           D  +     PLF+    +KEI A++SE+  N      ++Y   + L+N  HP+ +F TGN
Sbjct: 174 DRFSGFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGN 233

Query: 190 FTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASG 249
             TL  +P     +I+  L  F+   Y  + M LC+ G + L+T++      F  +P + 
Sbjct: 234 LKTLDEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLFEAVPNNN 293

Query: 250 Q 250
           +
Sbjct: 294 R 294

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 73/367 (19%), Positives = 152/367 (41%), Gaps = 37/367 (10%)

Query: 616 EVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLG 675
           ++W K++  D  +  +  +   +      AS  N +   +  QL+  +L    Y +    
Sbjct: 569 KLWYKKD--DRFWQPRGFIYITMKLPHTQASVINNLLTSLYVQLVNDSLKDLQYDAACAN 626

Query: 676 YTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRS 735
                S +++G   L +T+SGF + +  L++  +  +  +    +   K+F+E  I    
Sbjct: 627 LHLSFSKTNQG---LDITISGFNDKLIVLLQRFIYGVSVYQPSKL-RFKIFKEKTIQNLK 682

Query: 736 K--YEEXXXXXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYM 793
              YE           SL     + E  W ++ +L  +E+I+ E F  F    +    Y 
Sbjct: 683 NCLYEVPYSQISTLYSSL-----INERTWSVKQKLSIIEKITYEQFLAFLPT-IYEECYF 736

Query: 794 NLFIQGDMSCME--KINSFLKWSLTS-----HLEDTREYQGPVREPGAKILKAGTNIFVK 846
           +  + G+    E  +I+S ++  +T+     H+++TR     +  P  +  +   ++   
Sbjct: 737 DGLVHGNFRNEEAVEIDSLVQSLITTDIVNLHVKNTRLRSYVI--PNGETYRFEIDLEDA 794

Query: 847 RNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLR 906
            N      N+ + + +Q G   +  +      A+  L+      LR K+Q+GY VF    
Sbjct: 795 ENV-----NSCVQHVVQLGGYSEELSAMSGLFAQI-LNEPCFDTLRTKEQLGYVVFSSSL 848

Query: 907 LLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEH-------YIRKY 959
               +  + I   S     +LE +I+E+     + L + M+++E ++H        ++KY
Sbjct: 849 NNHGTANIRILVQSEHSTPYLEWRIDEFYKSFGETLRN-MSDDELEKHKDALCKSLMQKY 907

Query: 960 RVMVENN 966
           + M E N
Sbjct: 908 KNMKEEN 914

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  118 bits (295), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 116/244 (47%), Gaps = 8/244 (3%)

Query: 7   KNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGL 66
           K+  + F  P     R  +  QL N +   +I D +    + ++ V  G+  DP+   GL
Sbjct: 47  KDLKVQFLKP-DLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGL 105

Query: 67  AHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD 126
           AH CEH +L  GS+K+P  N Y   L+++GGS NA            + A       H  
Sbjct: 106 AHFCEH-LLFMGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNAD------HLH 158

Query: 127 KALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFC 186
            ALD  +     PLF+    +KEI A++SE+  N      ++Y   + L+N  HP+ +F 
Sbjct: 159 GALDRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFS 218

Query: 187 TGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
           TGN  TL   P     +I+  L  F+   Y  + M LC+ G + L+TL++ A   F D+ 
Sbjct: 219 TGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVK 278

Query: 247 ASGQ 250
            S +
Sbjct: 279 NSDR 282

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 118/277 (42%), Gaps = 30/277 (10%)

Query: 690 LGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIA-VRSKYEEXXXXXXXXX 748
           L +T+SGF E +  L+K  VE ++ F  +     +VF++  +  ++++  E         
Sbjct: 627 LDITISGFNEKLLILLKRFVEGVQGFEPKKE-RFEVFKDKTVHHLKNQMMEVPYSQIS-- 683

Query: 749 XSLGLL-IILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEK- 806
              GL   ++ E  WP +++LE  E++  E    F    +    Y   F+ G++   E  
Sbjct: 684 ---GLYNSVVNERTWPTKEKLEVAEKLKFEQLDNFVRA-IYDGMYYESFVHGNLESKEAR 739

Query: 807 -----INSFLKWSLTSHLEDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYF 861
                +++FLK     +++           P  K     T+++ + N      N+ I + 
Sbjct: 740 EVDSLVSTFLKKDDIKNIDVQSNRLRSYIIPKGKSYAYETDLYDENNV-----NSCIQHV 794

Query: 862 IQTGEREDARAYTYTCLAEFFLSLTLVP---DLRNKKQIGYAVFGGLRLLSTSIGLHITC 918
           +Q     D      + L+  F  +   P    LR K+Q+GY VF        +  + I  
Sbjct: 795 VQL----DVYNEKLSALSGLFAQMLHEPCFDILRTKEQLGYVVFSSSLNNHGTANIRILV 850

Query: 919 MSNSPPEHLEVQIEE-YLSYLEKCLLDTMTEEEFQEH 954
            S     +LE +I+E Y ++ EK  L  M EE+F +H
Sbjct: 851 QSEHTTPYLEWRIDEFYKTFGEK--LRNMDEEDFNKH 885

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 104/391 (26%), Positives = 164/391 (41%), Gaps = 62/391 (15%)

Query: 16  PISGSSRGSKLCQLS-NGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAI 74
           PI+   R  +  +L+ N +   +I D +    + ++ V  G+  DP    GLAH CEH +
Sbjct: 34  PIT-DERNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEH-L 91

Query: 75  LSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELHFD-------K 127
           L  GSK +P  N Y   L QNGG  NA                S +   HF+       +
Sbjct: 92  LFMGSKNFPNENDYSSYLNQNGGFSNAYTG-------------SMNTNYHFEINHANLFE 138

Query: 128 ALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCT 187
           AL   +   K PLF++    KEI+AI+SE+  N      +LY   + L+N  HP+ +F T
Sbjct: 139 ALRRFSCFFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFST 198

Query: 188 GNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPA 247
           G+  TL         NI+  L  F+ ++Y ++ M+LC+ G + L TL++ A   F ++P 
Sbjct: 199 GSKLTLLENTETLNLNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILFENVP- 257

Query: 248 SGQNIARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAFSQGSSNVVAIQSSKCPV 307
             +N+  P+ S            P + I   +     K V+   Q               
Sbjct: 258 -NKNVILPTFSQ-----------PVWTIADKKKVISVKPVKDLKQ--------------- 290

Query: 308 LRLIFPVSHKSTRLSSSDITTFSS----TWCDFFGDESVGSLADCLKGCGLISGIVSSVS 363
           L L F        +   ++TT+ S         FG +  GS++  LK   LI+GI S   
Sbjct: 291 LELTF-------HIKEDELTTWKSKPSYILSHLFGHKGNGSISSLLKNQQLITGISSGSE 343

Query: 364 HFAXXXXXXXXXXXXXQHGWKNIPTIMCILF 394
           + +             + G      I+ I+F
Sbjct: 344 NISKENSLFSLNFDLTEDGINQYEKIIKIVF 374

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 126/286 (44%), Gaps = 37/286 (12%)

Query: 684 SKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSK-YEEXXX 742
           +K +  L LT++G  + +  L+K  +E IKSF   +     + ++   ++ ++ Y+    
Sbjct: 601 NKTNQGLDLTLTGLNDKLLILLKRYLEGIKSFVPNEERFEVIKKQTIQSLTNRLYDVPYI 660

Query: 743 XXXXXXXSLGLLIILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPT-YMNLFIQ--- 798
                  SL     + E  W +E+ L+ +++I       F       PT Y  LF +   
Sbjct: 661 QMGDIYSSL-----INERSWSVEENLKVVQDIDFPQLQDFI------PTIYQELFFETLA 709

Query: 799 -GDMSC--MEKINSFLKWSLTSHLEDTREYQGPVREPGAKILKAGTNIFVKRNAFSDDPN 855
            G++     ++++S ++  + + +++++     +R   + I+ +G     K   F  D N
Sbjct: 710 FGNIQYEQAQEVDSLVRTLIPNTIKNSQVKNDRLR---SYIIPSGKTF--KYEVFQKDKN 764

Query: 856 N---SIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSI 912
           N    I Y  Q G   +  A   + LA+  +       LR K+Q+GY VF        + 
Sbjct: 765 NLNTCIQYICQFGIYSEYLAAVVSLLAQI-MHEPCFNTLRTKEQLGYIVFSSSLSNHGTC 823

Query: 913 GLHITCMSNSPPEHLEVQIE----EYLSYLEKCLLDTMTEEEFQEH 954
            L I   S    ++L+ +IE    ++LSYL++     M  EEF+ H
Sbjct: 824 NLSIMVQSEYSTDYLQFRIENFLKDFLSYLKE-----MPREEFKRH 864

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 106/262 (40%), Gaps = 45/262 (17%)

Query: 22  RGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKK 81
           +G+++ +LSNG+ V     P+ +  +  + V  GS  +  +  G AH  EH    G SK+
Sbjct: 25  QGTEISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKR 84

Query: 82  YPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPL 140
              +    E+  +N GSH NA                S    +++ K L      L   +
Sbjct: 85  ---SQKQIELDIENIGSHLNAYT--------------SRENTVYYAKTLKE-NLPLAVDI 126

Query: 141 FSDILINK--EIYAIESEHNI-------NKALVGKQLYHASRLLANPSHPFSRFCTGNFT 191
            SDIL N   E  AIE E ++          +  + ++     +A    P  R   G   
Sbjct: 127 LSDILTNSKLEKNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLGRTILG--- 183

Query: 192 TLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQN 251
            +  + S+N+ ++   +TS     YK   M L   G  +   L KLA ++FG LP     
Sbjct: 184 PIKNIKSINRSDLVHYITS----NYKGDRMVLAGAGDINHQDLIKLAEKYFGHLP----- 234

Query: 252 IARPSSSSLFSNKGTAQSMPYF 273
                SSSL +N      +P F
Sbjct: 235 ---KGSSSLVNNMN--DQLPVF 251

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 87/218 (39%), Gaps = 30/218 (13%)

Query: 51  SVATGSHNDPDEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXX 110
           +VAT   ND     G+ H  EH I  G SKKYP     ++ L    G+            
Sbjct: 47  AVATECPNDS----GVPHTLEHLIFMG-SKKYP-----YKGLLDTLGNLCMSSTNAWTAT 96

Query: 111 XXXLPAISDSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL-- 168
              +  ++ +G   F K L V    L  P  +D     E+Y I+ +   +K +V  ++  
Sbjct: 97  DQTVYTLTSAGWQGFKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQDFSDKGVVYSEMEG 156

Query: 169 ----------YHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKT 218
                         RL+  P     R  TG  T    L +L    IK     FHK+ Y  
Sbjct: 157 IESQSWFLTSLEKQRLMF-PEGSGYRSETGGLTK--NLRTLTNDEIK----EFHKKMYSP 209

Query: 219 SNMSLCLRGSQSLNTLTKLAIRFFGDLPA-SGQNIARP 255
            N+ L + G+   + L ++A R+   LP  S  +I+RP
Sbjct: 210 QNLCLIVSGNVPEDELLEIASRWDETLPTYSDASISRP 247

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 92/239 (38%), Gaps = 17/239 (7%)

Query: 11  LVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLC 70
           L + T I+G    +    L NG+ V   S P+    +  + V TGS  + ++  G AH  
Sbjct: 20  LRYSTEINGCLSKTATSVLPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFL 79

Query: 71  EHAILSGGSKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKAL 129
           EH    G   +   +    E+  +N GSH NA                + S +    KA+
Sbjct: 80  EHLAFKGTQNR---SQTGIELEIENIGSHLNAYTSRENTVYY------AKSLKQDIPKAV 130

Query: 130 DVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGN 189
           D+LA  L   +     I +E   I  E      +  + ++     +   + P  R   G 
Sbjct: 131 DILADILTRSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHTITYKNQPLGRTILGP 190

Query: 190 FTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
              + ++        ++ L  F +++Y    M L   G+   + L + A ++FG +  S
Sbjct: 191 IKNIKSIQ-------RSDLQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFGHVRKS 242

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 24/236 (10%)

Query: 22  RGSKLCQLSNGMLV---FLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGG 78
           + + + +LSNG+ +   ++ + P+ TVG   + V  GS  +  +  G AH  EH    G 
Sbjct: 9   QSTNISRLSNGLTIATEYIPNTPTATVG---IYVDAGSRAENTKNNGTAHFLEHLAFKGT 65

Query: 79  SKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLK 137
            K+   +    E+  +N GSH NA                + + + +  +A+D+L+  L 
Sbjct: 66  EKR---SQKKIELDIENIGSHLNAYTSRENTVYY------AKTLKENVPQAIDILSDILT 116

Query: 138 APLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLP 197
                   I +E   I  E      +  + ++     +A       R   G    +  + 
Sbjct: 117 KSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILG---PIKNIK 173

Query: 198 SLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASG-QNI 252
           S+ + ++K  +T    + YK   M L   G    N + K A ++FG LP+S  QNI
Sbjct: 174 SITRDDLKNYIT----QNYKGDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNI 225

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 91/233 (39%), Gaps = 17/233 (7%)

Query: 17  ISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILS 76
           IS    G++  +L NG+ +     P+ +  +  + V  GS  +  +  G AH  EH    
Sbjct: 19  ISSQIPGTRTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK 78

Query: 77  GGSKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASS 135
           G   +   +    E+  +N GSH NA                + S +    KA+D+L+  
Sbjct: 79  GTQNR---SQQGIELEIENIGSHLNAYTSRENTVYY------AKSLQEDIPKAVDILSDI 129

Query: 136 LKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCT 195
           L   +  +  I +E   I  E      +  + ++     +     P  R   G    +  
Sbjct: 130 LTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILG---PIKN 186

Query: 196 LPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
           + S+ + ++K  +T    + YK   M L   G+     L + A ++FG +P S
Sbjct: 187 IKSITRTDLKDYIT----KNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKS 235

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 24/236 (10%)

Query: 22  RGSKLCQLSNGMLV---FLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGG 78
           + + + +LSNG+ +   ++ + P+ TVG   + V  GS  +  +  G AH  EH    G 
Sbjct: 19  QSTNISRLSNGLTIATEYIPNTPTATVG---IYVDAGSRAENTKNNGTAHFLEHLAFKGT 75

Query: 79  SKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLK 137
            K+   +    E+  +N GSH NA                + + + +  +A+D+L+  L 
Sbjct: 76  EKR---SQKKIELDIENIGSHLNAYTSRENTVYY------AKTLKENVPQAIDILSDILT 126

Query: 138 APLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLP 197
                   I +E   I  E      +  + ++     +A       R   G    +  + 
Sbjct: 127 KSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILG---PIKNIK 183

Query: 198 SLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASG-QNI 252
           S+ + ++K  +T    + YK   M L   G    N + K A ++FG LP+S  QNI
Sbjct: 184 SITRDDLKNYIT----QNYKGDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNI 235

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 90/230 (39%), Gaps = 17/230 (7%)

Query: 24  SKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYP 83
           +++ QL NG+ V   + P+    S  + V  GS  +     G AH  EH    G   +  
Sbjct: 29  TRISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFKGTKNR-- 86

Query: 84  GANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFS 142
                 E+  +N GSH NA                + S +    +ALDVL+  L   +  
Sbjct: 87  -TQVGIELEIENLGSHLNAYTSRENTVYY------AKSLQEDIPRALDVLSDILTRSVLD 139

Query: 143 DILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKF 202
              + +E   I  E      +  + ++     ++  + P  R   G    +  + S+ + 
Sbjct: 140 PKAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGRTILG---PIENIKSIQQR 196

Query: 203 NIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNI 252
           ++K  +++     YK   M+L   G+   + L +   ++FG +P S   +
Sbjct: 197 DLKEYIST----NYKGDRMALVGAGAVDHDELVRYGEKYFGHIPKSDHPV 242

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 88/227 (38%), Gaps = 17/227 (7%)

Query: 23  GSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKY 82
           G++  +L NG+ +     P+ +  +  + V  GS  +  +  G AH  EH    G   + 
Sbjct: 25  GTRTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFKGTQNR- 83

Query: 83  PGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
             +    E+  +N GSH NA                + S E    KA+D+L+  L   + 
Sbjct: 84  --SQQGIELEIENIGSHLNAYTSRENTVYY------AKSLEEDIPKAVDILSDILTKSVL 135

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
               I +E   I  E      +  + ++     +     P  R   G    +  + S+ +
Sbjct: 136 DSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILG---PIKNIKSITR 192

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
            ++K  +T    + YK   M L   G+     L + A ++FG +P S
Sbjct: 193 SDLKDYIT----KNYKGDRMVLAGAGAVDHERLVQYAQKYFGHVPRS 235

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 92/237 (38%), Gaps = 17/237 (7%)

Query: 13  FYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEH 72
            ++ +S    G++  +L NG+ +     P+ +  +  + V  GS  +  +  G AH  EH
Sbjct: 15  LFSTVSPQIPGTRTSRLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEH 74

Query: 73  AILSGGSKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDV 131
               G   +   +    E+  +N GSH NA                + S +    KA+ +
Sbjct: 75  LAFKGTQNR---SQQGIELEIENIGSHLNAYTSRENTVYY------AKSLQEDIPKAVGI 125

Query: 132 LASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFT 191
           L+  L   +  +  I +E   I  E      +  + ++     +     P  R   G   
Sbjct: 126 LSDILTKSVLDNNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILG--- 182

Query: 192 TLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
            +  + S+ + ++K  +T    R YK   M L   G+     L + A ++FG +P S
Sbjct: 183 PIKNIKSITRSDLKNYIT----RNYKGDRMVLAGAGAVDHEELVEYAQKYFGHVPKS 235

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 86/241 (35%), Gaps = 17/241 (7%)

Query: 9   FDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAH 68
           F   F  P++ ++  ++   L NG+ V     P+ +  +  + V  GS  +     G AH
Sbjct: 7   FGTRFSRPLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAH 66

Query: 69  LCEHAILSGGSKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDK 127
             EH    G   +        E+  +N GSH NA                + +   +   
Sbjct: 67  FLEHLAFKGTKNR---TQVGIELEIENIGSHLNAYTSRENTVYY------AKTLTQNIPN 117

Query: 128 ALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCT 187
           A+DVL+  L   +     I +E   I  E      +  + ++     +     P  R   
Sbjct: 118 AVDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTIL 177

Query: 188 GNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPA 247
           G    + T+        +  L  +  + YK   M L   G+     L + A ++FG +P 
Sbjct: 178 GPIENIKTIQ-------RRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKYFGHIPK 230

Query: 248 S 248
           S
Sbjct: 231 S 231

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 83/227 (36%), Gaps = 17/227 (7%)

Query: 23  GSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKY 82
           G+K   LSNG+ V     P+ +  S  + V  GS  +  +  G AH  EH    G + + 
Sbjct: 59  GTKTTVLSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTR- 117

Query: 83  PGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLF 141
             +    E++ +N GSH NA               + D    +   A+D+L+  L     
Sbjct: 118 --SQRDIELVIENLGSHLNAYTSRENTVYYAK--TLKD----NIPNAIDILSDILTKSTL 169

Query: 142 SDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNK 201
               I +E   I  E      +  + ++     +     P  R   G    + T+     
Sbjct: 170 DKNAIERERSVIIRESEEVDQMYDEVVFDHLHEIVYKDQPLGRTILGPIKNINTIQ---- 225

Query: 202 FNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
              +  L ++    YK   M L   G  +   L K A ++FG +  S
Sbjct: 226 ---RNDLQNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVKKS 269

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 87/226 (38%), Gaps = 17/226 (7%)

Query: 24  SKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYP 83
           ++   L+NG+ V     P  +  +  + V  GS  + ++  G AH  EH    G   +  
Sbjct: 20  TRTSVLNNGLTVATERIPEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAFKGTKDRTQ 79

Query: 84  GANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFS 142
                 E+  +N GSH NA              ++ D       +A+D+L+  L   +  
Sbjct: 80  SG---IELEIENIGSHLNAYTSRENTVYYAK--SLRDD----IPRAVDILSDILTRSVLD 130

Query: 143 DILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKF 202
              I +E   I  E      +  + ++     +A       R   G    +  + S+ + 
Sbjct: 131 PRAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLGRTILG---PVKNIKSITRK 187

Query: 203 NIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
           ++K  +T    + YK   M L   G+   + L K A RFFG +P S
Sbjct: 188 DLKDYIT----KNYKGDRMVLAGAGAVDHDDLVKQAERFFGHIPKS 229

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 80/212 (37%), Gaps = 16/212 (7%)

Query: 65  GLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELH 124
           G+ H  EH I  G S++YP       +L   GG   +               +S +G L 
Sbjct: 57  GVPHTLEHLIFMG-SQRYPRKG----LLDTAGGITMSTTNAYTASDHTAYELVS-AGWLG 110

Query: 125 FDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLY---HASRLLANPSHP 181
           F K L V    L  P  ++     E+Y ++     +K +V  ++    H S  +A     
Sbjct: 111 FKKLLPVYLDHLLHPTLTEHAFTTEVYHLDPNDLTDKGVVYSEMEAREHESSDVAILEKG 170

Query: 182 FSRFCTGN--FTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAI 239
              F  GN   + +  L    +    A + +FH   Y   N+ L + G+   + L ++  
Sbjct: 171 RQMFPEGNGYRSEVGGLTKHLRTLTNAEVRAFHAEMYTPDNICLVICGNVPEHELLQIVE 230

Query: 240 RFFGDLPASGQNIARPSSSSLFSNKGTAQSMP 271
            F  +LP       RP     F +  ++Q  P
Sbjct: 231 EFDAELPEKTGPRRRP-----FVDSASSQIPP 257

>Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL098C
           - Hypothetical ORF [contig 184] FULL
          Length = 1040

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 75/202 (37%), Gaps = 23/202 (11%)

Query: 65  GLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDSGELH 124
           G+ H  EH I  G SKKYP     ++ L    G+               +  ++ +G L 
Sbjct: 57  GVPHTLEHLIFMG-SKKYP-----YKGLLDTAGNLCMSSTNAWTATDQTVYTLTSAGWLG 110

Query: 125 FDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL-------YHASRLLAN 177
           F   L V    +  P  SD     E+Y ++ E    K +V  ++       +  + L   
Sbjct: 111 FKNLLPVYLDHVLHPTISDHACTTEVYHVDPEDLQEKGVVFSEMEGIESQSWFITMLEKQ 170

Query: 178 ----PSHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNT 233
               P     R  TG  T+   L +L    I+     FH+  Y   N+ L + G+   + 
Sbjct: 171 RQMFPEGSGYRSETGGLTS--QLRNLTNEEIR----QFHQSMYSPENLCLIICGNVPEDE 224

Query: 234 LTKLAIRFFGDLPASGQNIARP 255
           L  +  +F   LP    +  RP
Sbjct: 225 LLSIMTKFDESLPEFKNDRYRP 246

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 90/233 (38%), Gaps = 17/233 (7%)

Query: 17  ISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILS 76
           +S    G++  +L NG+ +     P+ +  +  + V  GS  +  +  G AH  EH    
Sbjct: 19  VSSQIPGTRTSKLPNGLTIASEYIPNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAFK 78

Query: 77  GGSKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASS 135
           G   +   +    E+  +N GSH NA                + S +    KA+++L+  
Sbjct: 79  GTQNR---SQQGIELEIENIGSHLNAYTSRENTVYY------AKSLQEDIPKAVEILSDI 129

Query: 136 LKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCT 195
           L   +     I +E   I  E      +  + ++     +     P  R   G    +  
Sbjct: 130 LTKSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILG---PIKN 186

Query: 196 LPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
           + S+ + ++K  +T    + YK   M L   G+     L + A ++FG +P S
Sbjct: 187 IKSITRSDLKNYIT----KNYKGDRMVLAGAGAVDHEKLVEHAQKYFGHVPKS 235

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 86/226 (38%), Gaps = 17/226 (7%)

Query: 24  SKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYP 83
           ++   L NG+ V     P+ +  +  + V  GS  + +   G AH  EH    G   +  
Sbjct: 28  TRTSVLPNGLTVASEFIPNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFKGTQNR-- 85

Query: 84  GANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFS 142
            +    E+  +N GSH NA                + S E    KA+++L+  L   +  
Sbjct: 86  -SQTDIELEIENIGSHLNAYTSRENTVYY------AKSLEGDVPKAVNILSDILTRSVLD 138

Query: 143 DILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKF 202
              I +E   I  E      +  + ++     +A    P  R   G    +  + S+++ 
Sbjct: 139 PKAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLGRTILG---PIKNIKSISRK 195

Query: 203 NIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
           ++K+ +T      YK   M L   G+     L   A ++ G +P S
Sbjct: 196 DLKSYITE----NYKGDRMVLAAAGAVDHEKLVDYAQKYLGHIPKS 237

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 81/219 (36%), Gaps = 28/219 (12%)

Query: 60  PDEAL---GLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPA 116
           P E L   G  H  EH I  G SK YP     ++ L    G+ +             +  
Sbjct: 49  PTECLNDSGAPHTLEHLIFMG-SKSYP-----YKGLLDTAGNLSLSNTNAWTDTDQTVYT 102

Query: 117 ISDSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL-------Y 169
           +S +G   F K L      +  P  +D     E+Y I+ E+  +K +V  ++       +
Sbjct: 103 LSSAGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGDKGVVFSEMEAIETQGW 162

Query: 170 HASRL----LANPSHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCL 225
           + S L    L  P     R  TG  T    L +L    I+     FHK  Y + N+ + +
Sbjct: 163 YISGLEKQRLMFPEGSGYRSETGGLTK--NLRTLTNDEIR----QFHKSLYSSDNLCVIV 216

Query: 226 RGSQSLNTLTKLAIRFFGDLPASGQNIARPSSSSLFSNK 264
            G+   + L  +   +   LP    NI  P       NK
Sbjct: 217 CGNVPTDELLTVMEEWDNKLPEIPSNI--PKKRPFLDNK 253

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 87/212 (41%), Gaps = 21/212 (9%)

Query: 43  DTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAX 102
           DTV + +V    G   +P ++ G+AH+ EH  L  GSKKYP  + + ++L  N    N  
Sbjct: 61  DTVDTNNV-FCVGFKTNPPDSTGVAHILEHTTLC-GSKKYPVRDPFFKML--NRSLSNFM 116

Query: 103 XXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINK- 161
                        A ++S +  F    DV   +  +PL       +E + +E++   +K 
Sbjct: 117 NAMTGHDYTMYPFATTNSKD--FKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDKD 174

Query: 162 -ALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKFNIKA---------ALTSF 211
             L+ K + +      N +  +  +   NF      PSLN                L SF
Sbjct: 175 SDLIFKGVVYNEMKGQNSNADY--YFWSNFLG-SIYPSLNNSGGDPKSITTLKYEGLKSF 231

Query: 212 HKRYYKTSNMSLCLRGSQSL-NTLTKLAIRFF 242
           HKR Y  SN      G+  + +TL KL  +F 
Sbjct: 232 HKRNYHPSNSLTYSYGNFPMEDTLNKLNEKFL 263

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
            YNL020C (REAL)
          Length = 632

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 1102 GRTSGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQRTRVDDALRGLSKIVT 1161
            G    IL G F +      + +L N+I K       L ++NPSQR  V   L+ ++ +  
Sbjct: 249  GGEPAILNGQFEFLPYPNYSEQLRNLICK-------LLVQNPSQRPNVFQLLKQITNMQN 301

Query: 1162 SALPLTEIKDVNQFRNLNEVTYMERH 1187
            +  P+ +++ V   R  N +  ME H
Sbjct: 302  APYPIRDVQTVQ--RPSNHLNLMELH 325

>TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1032

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 102/279 (36%), Gaps = 36/279 (12%)

Query: 1   MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60
           M+F+   +F L  Y P       SK     +G+ +  ++  S  +     +VAT   ND 
Sbjct: 1   MTFKKLVDFKLD-YAP---QYHVSKYISQKSGLQLVHVNHSSSPLVQGYFAVATECPNDS 56

Query: 61  DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXXXXXLPAISDS 120
               G  H  EH I  G SK YP     ++ L    G+               +  ++ +
Sbjct: 57  ----GCPHTLEHLIFMG-SKSYP-----YKGLLDTAGNLCMSSTNAWTATDQTVYTLTTA 106

Query: 121 GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL------------ 168
           G   F   L V    L  P  +D     E++ I+ E   +K +V  ++            
Sbjct: 107 GWKGFKTLLPVYLDHLLFPTLTDEACITEVHHIDPETLTDKGVVYSEMDAIENQSWFVTM 166

Query: 169 YHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGS 228
               RL+      + R  TG  T    L  L    I+     FHK  Y   N+ + + G+
Sbjct: 167 LEKQRLMFKEGSGY-RSETGGLTE--NLRDLTNEEIR----EFHKNLYCPENLCIIVCGN 219

Query: 229 QSLNTLTKLAIRFFGDLPASGQNIARP---SSSSLFSNK 264
              + L  +   +  +LP +  N  RP   S  S  S+K
Sbjct: 220 VPEDELLSIVEDWDINLPVANPNHKRPFVDSKDSQISDK 258

>Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 78/208 (37%), Gaps = 29/208 (13%)

Query: 51  SVATGSHNDPDEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXX 110
           +V T   ND     G  H  EH +  G SK YP     ++ L    G+ +          
Sbjct: 47  AVPTECPNDS----GAPHTLEHLVFMG-SKSYP-----YKGLLDTAGNLSLSVTNAWTDT 96

Query: 111 XXXLPAISDSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL-- 168
              +  +S +G   F K L      +  P  +D     E+Y I+ E+  +K +V  ++  
Sbjct: 97  DQTVYTLSSAGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLSDKGVVFSEMEA 156

Query: 169 -----YHASRL----LANPSHPFSRFCTGNFT-TLCTLPSLNKFNIKAALTSFHKRYYKT 218
                ++ S L    L  P     R  TG  T  L TL S         +  FHK  Y +
Sbjct: 157 IETQGWYISNLEKQRLMFPEGSGYRSETGGLTKNLRTLTS-------EEIRQFHKSLYSS 209

Query: 219 SNMSLCLRGSQSLNTLTKLAIRFFGDLP 246
            N+ + + G+   + L  +   +   LP
Sbjct: 210 DNLCVIVCGNVPADELLSIMEEWDNTLP 237

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 80/226 (35%), Gaps = 17/226 (7%)

Query: 24  SKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYP 83
           ++   L NG+ V   + P+ +  +  + V  GS  +  +  G AH  EH    G   +  
Sbjct: 22  TRTSVLPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAFKGTKNR-- 79

Query: 84  GANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFS 142
                 E+  +N GSH NA                + +   +   A+D+L+  L   +  
Sbjct: 80  -TQVGIEMEIENIGSHLNAYTSRENTVYY------AKTLTQNIPNAVDILSDILTKSVLD 132

Query: 143 DILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKF 202
              I +E   I  E      +  + ++     +     P  R   G    + T+   +  
Sbjct: 133 TNAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNIKTIQQRD-- 190

Query: 203 NIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
                L  +    YK   M L   G    + L + A ++FG +P S
Sbjct: 191 -----LREYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFGHIPKS 231

>Skud_14.76 Chr14 (136935..143600) [6666 bp, 2221 aa] {ON} YNL262W
            (REAL)
          Length = 2221

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 4/47 (8%)

Query: 981  MGQIE--ANVRSGNLEEQGSAMRLHKNTKNQISN--RRYNFGMEEEP 1023
            MG+I+   ++   NLEE+ + +RL ++TK +  +  RR N G EEEP
Sbjct: 1208 MGKIKDIEDLFEPNLEEENAKIRLARSTKKKTGSKRRRNNLGNEEEP 1254

>KLLA0F22066g Chr6 complement(2051033..2062327) [11295 bp, 3764 aa]
           {ON} similar to uniprot|P38811 Saccharomyces cerevisiae
           YHR099W TRA1 Histone acetyltransferase component
           putative ortholog of human TRRAP which is an essential
           cofactor of c-Myc
          Length = 3764

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 53/130 (40%), Gaps = 4/130 (3%)

Query: 862 IQTGEREDAR-AYTYTCLAEFFLSLTLVPDLRN-KKQIGYAVFGGLRLLSTSIGLHITCM 919
           IQT  R   R  Y   CL        L P L    K + YA+ G   L++  +     C+
Sbjct: 862 IQTACRPHERDLYVELCLTVPVRLSVLAPYLNYLMKPLVYALVGFPELITQGLRTLELCI 921

Query: 920 SNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQK-TAGPA 978
            N  PE+L+  +E  +  + K L D +  + F  H I    V +      R ++    P 
Sbjct: 922 DNLTPEYLDPILEPVVGDVMKALFDLLKPQPFN-HQISHTTVRILGKLGGRNRRFIETPK 980

Query: 979 DLMGQIEANV 988
           DL  + E N+
Sbjct: 981 DLKTETELNI 990

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 86/226 (38%), Gaps = 17/226 (7%)

Query: 24  SKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGGSKKYP 83
           ++   L NG+ +     P+ +  +  + V  GS  +  +  G AH  EH    G   +  
Sbjct: 25  TRTSTLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTENRSQ 84

Query: 84  GANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLKAPLFS 142
            A    E+  +N GSH NA                + S +    KA+++L+  L      
Sbjct: 85  RA---IELEIENIGSHLNAYTSRENTVYY------AKSLQNDIPKAVEILSDILTKSTLD 135

Query: 143 DILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLPSLNKF 202
              I +E   I  E      +  + ++     +A    P  R   G    +  + S+++ 
Sbjct: 136 PRAIERERDVIIRESEEVDKMYDEVVFDHLHDIAYKDQPLGRTILG---PIKNIKSISRT 192

Query: 203 NIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPAS 248
           ++K    S+  + YK   M L   G+   + L   A ++FG L  S
Sbjct: 193 DLK----SYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFGHLQKS 234

>TBLA0I02230 Chr9 complement(510907..513807) [2901 bp, 966 aa] {ON}
            Anc_3.325 YBL037W
          Length = 966

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 65/155 (41%), Gaps = 32/155 (20%)

Query: 1059 IASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDII-ETSL----------GRTSGI 1107
            IA+P T   + QK         L +K   ++S +LH+I+ ET++          G  S I
Sbjct: 181  IANPRTVNCLKQKTCLAINCMCLNIKKFNLASGELHNILNETNIQHFFNLLNDEGNPSII 240

Query: 1108 LRGL--FRYFSANGETMKLCNVIIKEISKALV------------------LSLKNPSQRT 1147
            L  L    Y+S N + +K C  II  ++K L+                    L NP   T
Sbjct: 241  LTALPVLEYYSKNIDPIK-CLRIIPHLTKILLDCLTIRKQRSSSTANPSEFILPNPWLIT 299

Query: 1148 RVDDALRGLSKIVTSALPLTEIKDVNQFRNLNEVT 1182
             + + L  L      ++ +T +  +NQ  NLN+ T
Sbjct: 300  NIINVLNVLIISNNESIKVTNLDHLNQLNNLNDET 334

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 82/215 (38%), Gaps = 27/215 (12%)

Query: 51  SVATGSHNDPDEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAXXXXXXXXX 110
           +V T   ND     G  H  EH I  G SK YP     ++ L    G+ +          
Sbjct: 47  AVPTECPNDS----GAPHTLEHLIFMG-SKSYP-----YKGLLDTAGNLSMSITNAWTDT 96

Query: 111 XXXLPAISDSGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQL-- 168
              +  ++ +G   F K L      +  P  +D     E+Y I+ E+  +K +V  ++  
Sbjct: 97  DQTVYTLASAGWKGFSKLLPTYLDHILHPTLTDEACLTEVYHIDPENLSDKGVVFSEMEA 156

Query: 169 -----YHASRL----LANPSHPFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTS 219
                ++ S L    L  P     R  TG  T    L +L    I+     FH+  Y + 
Sbjct: 157 IETQSWYVSALEKQRLMFPEGSGYRSETGGLTK--NLRTLTNEEIR----KFHESLYSSD 210

Query: 220 NMSLCLRGSQSLNTLTKLAIRFFGDLPASGQNIAR 254
           N+ + + G+   + L  +  ++   LP    ++ +
Sbjct: 211 NLCIIVCGNVPTDELLTVMEKWDDTLPEIPSDVPK 245

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 84/232 (36%), Gaps = 17/232 (7%)

Query: 19  GSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAHLCEHAILSGG 78
           G+   +++ QLSNG+ V     P+ +  +  + V  GS  +     G AH  EH    G 
Sbjct: 20  GTVPRTQISQLSNGITVASEVLPNTSTATVGIFVDAGSRAENSRNNGTAHFLEHLAFKGT 79

Query: 79  SKKYPGANYYHEVLAQNGGSH-NAXXXXXXXXXXXXLPAISDSGELHFDKALDVLASSLK 137
           + +   +    E+  +N GSH NA                + S +    KA+D+L+  L 
Sbjct: 80  TNR---SQVGIELEIENIGSHLNAYTSRENTVYY------AKSLKEDIPKAMDILSDILT 130

Query: 138 APLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTGNFTTLCTLP 197
               +   I +E   I  E      +  + ++     +        R   G    + ++ 
Sbjct: 131 RSTLNPKAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALGRTILGPIENIKSIQ 190

Query: 198 SLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPASG 249
                  +  L  +    Y    M+L   GS   + L +   R+FG +  S 
Sbjct: 191 -------RKDLAEYISTNYTGDRMALVGAGSVDHDKLVEYGERYFGHIRKSA 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 119,048,907
Number of extensions: 5016136
Number of successful extensions: 14179
Number of sequences better than 10.0: 85
Number of HSP's gapped: 14322
Number of HSP's successfully gapped: 107
Length of query: 1189
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1068
Effective length of database: 39,606,813
Effective search space: 42300076284
Effective search space used: 42300076284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)