Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.203807.194ON32332316340.0
KLTH0E04598g7.194ON32832815150.0
SAKL0F07458g7.194ON31532314130.0
ADL120C7.194ON31132313190.0
Ecym_43827.194ON31132313010.0
KLLA0D16170g7.194ON30727612791e-178
Suva_9.1787.194ON31932812771e-178
YIL021W (RPB3)7.194ON31827512631e-176
Skud_9.1487.194ON31832312561e-175
KAFR0A026507.194ON31232512551e-174
ZYRO0D15796g7.194ON30828712541e-174
Smik_9.1697.194ON31827512541e-174
CAGL0J02420g7.194ON31228912531e-174
TDEL0H025307.194ON31128512511e-174
TBLA0J015207.194ON33527312371e-171
NDAI0G020007.194ON31127312311e-171
NCAS0E018307.194ON31827212311e-171
KNAG0H027007.194ON32629012121e-168
TPHA0C045107.194ON31026911971e-166
Kpol_1063.117.194ON31630011951e-165
Kpol_1018.1393.428ON3352952456e-23
ZYRO0C12364g3.428ON3352922306e-21
YPR110C (RPC40)3.428ON3352942262e-20
KLLA0D14861g3.428ON3342872253e-20
TPHA0D039203.428ON3352972244e-20
Suva_16.4383.428ON3352942227e-20
KNAG0A076003.428ON3342942228e-20
Smik_16.3533.428ON3352942219e-20
KAFR0A055203.428ON3342992201e-19
KLTH0F12056g3.428ON3502742192e-19
Kpol_473.33.428ON3202952182e-19
NCAS0A115203.428ON3351992182e-19
TBLA0F017003.428ON3331962166e-19
TDEL0F031003.428ON3351962156e-19
ADR031C3.428ON3641972167e-19
Ecym_44503.428ON3342952131e-18
NDAI0A047703.428ON3352962131e-18
Skud_16.3973.428ON3352942131e-18
Kwal_23.39983.428ON3342882131e-18
SAKL0F06028g3.428ON3341962113e-18
CAGL0B04125g3.428ON3342002086e-18
CAGL0G08954g1.371ON59082760.51
TBLA0G031103.157ON36045684.2
CAGL0K06303g5.576ON3247108694.7
Skud_5.2307.401ON1389100686.1
NCAS0G040601.476ON122158677.3
ZYRO0F11946g8.708ON44444668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20380
         (323 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   634   0.0  
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   588   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   548   0.0  
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   512   0.0  
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   505   0.0  
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   497   e-178
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   496   e-178
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   491   e-176
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   488   e-175
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   488   e-174
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   487   e-174
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   487   e-174
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   487   e-174
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   486   e-174
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   481   e-171
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   478   e-171
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   478   e-171
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   471   e-168
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   465   e-166
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   464   e-165
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    99   6e-23
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    93   6e-21
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    92   2e-20
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    91   3e-20
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    91   4e-20
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    90   7e-20
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    90   8e-20
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    90   9e-20
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    89   1e-19
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    89   2e-19
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    89   2e-19
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    89   2e-19
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    88   6e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    87   6e-19
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    88   7e-19
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    87   1e-18
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    87   1e-18
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    87   1e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    87   1e-18
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    86   3e-18
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    85   6e-18
CAGL0G08954g Chr7 complement(857016..858788) [1773 bp, 590 aa] {...    34   0.51 
TBLA0G03110 Chr7 (822149..823231) [1083 bp, 360 aa] {ON} Anc_3.1...    31   4.2  
CAGL0K06303g Chr11 (611434..621177) [9744 bp, 3247 aa] {ON} simi...    31   4.7  
Skud_5.230 Chr5 complement(363859..368028) [4170 bp, 1389 aa] {O...    31   6.1  
NCAS0G04060 Chr7 complement(754763..758428) [3666 bp, 1221 aa] {...    30   7.3  
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...    30   8.6  

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/323 (95%), Positives = 307/323 (95%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESXXXXXXXX 300
           DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPES        
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESGFGYGNGG 300

Query: 301 XXXXXXXXDFHNSGPSSGFDDAW 323
                   DFHNSGPSSGFDDAW
Sbjct: 301 AGGGPGAGDFHNSGPSSGFDDAW 323

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/328 (86%), Positives = 298/328 (90%), Gaps = 5/328 (1%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           MAEEGPQVKIREATKDNVDFILSNVD+ MANSLRRVMIAEIPT+AIDSVEVETNTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFISHRLGL+PLQSSDINDLIYCRDCYCED+CDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKD NGVLICKLRKGQELKLKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNED+AFDY AKPTTFYMNVE+VGSLTV
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPES-----XXX 295
           DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGG AG+ +QDGGAM  EP+S        
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQDGGAMPVEPDSGFAYGSGG 300

Query: 296 XXXXXXXXXXXXXDFHNSGPSSGFDDAW 323
                         F ++GPSSGFDDAW
Sbjct: 301 PSSGSGMGGGPGAPFGHTGPSSGFDDAW 328

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/323 (81%), Positives = 286/323 (88%), Gaps = 8/323 (2%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M EEGPQVKIREATKD+VDFILSNVD+A+ANS RRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DINDL+YCRDCYCED+CDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKLKC+AKKGI+KEHAKWSPA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D AAEWPQSKNCEYEDPPNEDD FDY AKP TFYM+VE+VGSLT 
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESXXXXXXXX 300
           DQVVIRG+KTLQDKVADILFSLKKMDQ++VNFGGA G A+    AM  E E         
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENE--------M 292

Query: 301 XXXXXXXXDFHNSGPSSGFDDAW 323
                   D +N GPS+GFDDAW
Sbjct: 293 SDPYTSNQDQYNGGPSAGFDDAW 315

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/323 (76%), Positives = 272/323 (84%), Gaps = 12/323 (3%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPT+AIDSVE+E+NTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFISHRLGLVPLQS DI+ L+YCRDC+CED+CDRCSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ANGVLICKLRKGQEL+LKCVAKKGIAKEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKL+HTDYWHE D  AEWP SKNCE+EDPPNEDD FDY AKP TFYMNVESVGS+  
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESXXXXXXXX 300
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG  G    D   M  + +         
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTG----DAAPMEVDQDPYSATSGRF 296

Query: 301 XXXXXXXXDFHNSGPSSGFDDAW 323
                     +N    + +DDAW
Sbjct: 297 NE--------YNDNAHAAYDDAW 311

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/323 (75%), Positives = 274/323 (84%), Gaps = 12/323 (3%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPT+AIDSVE+ETNTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFISHRLGL+PLQS DI+ L+YCRDCYCED+CDRCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ANG+L+CKLRKGQEL+LKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW E DA +EWP SKNCE+EDP N+DD FDY AKP  FY+NVESVGS+T 
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESXXXXXXXX 300
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG    +E     +  +P S        
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT--SENAPMEVDHDPYSGTNGQYNE 298

Query: 301 XXXXXXXXDFHNSGPSSGFDDAW 323
                     +N   ++ +DDAW
Sbjct: 299 ----------YNDNTNTAYDDAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  497 bits (1279), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 227/276 (82%), Positives = 260/276 (94%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+A+ANSLRRVMI+EIPT+AIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI+ ++YCRDCYCED+CDRCSV L L A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
            S+L GRNIGHPIIQD++ANGVLICKLRKGQE+++KC+AKKGI+KEHAKWSP+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E DA  EWPQSKNCE+EDPPNED+ FDYRAKP TFY+NVESVGS+T 
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAA 276
           +QVV+RG+KTLQDKVADILFSLKKMDQ+KVNF   A
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGA 276

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  496 bits (1277), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 239/328 (72%), Positives = 269/328 (82%), Gaps = 14/328 (4%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREA+KDNVDFIL++VD+AMANSLRR+MIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHP+IQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE DAFDY+A+  TFYMNVESVGS+TV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGG-----AAGLAEQDGGAMAAEPESXXX 295
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF       A+ +   +   M    E    
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 296 XXXXXXXXXXXXXDFHNSGPSSGFDDAW 323
                           N+G S G+D+AW
Sbjct: 301 ANASQ---------MGNTGSSGGYDNAW 319

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 229/275 (83%), Positives = 251/275 (91%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREA+KDNVDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE D FDY+A+  TFYMNVESVGS+ V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGA 275
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF   
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASG 275

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  488 bits (1256), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/323 (73%), Positives = 266/323 (82%), Gaps = 5/323 (1%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREA+KD VDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE D FDY+A+  TFYMNVESVGS+ V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESXXXXXXXX 300
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF  A+G  + +                  
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNF--ASG--DNNAAPNMLGTNEDVVMTGAE 296

Query: 301 XXXXXXXXDFHNSGPSSGFDDAW 323
                      N+G SSG+D+AW
Sbjct: 297 QDPYSNASQMGNTG-SSGYDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/325 (72%), Positives = 269/325 (82%), Gaps = 15/325 (4%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI  L Y RDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHPIIQDK+ NGVLICKLRKGQELKL C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHT+YW+E D   EWP SKNCEYEDPPNE+D FDY+AK  TFYMNVE+VGS++V
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF--GGAAGLAEQDGGAMAAEPESXXXXXX 298
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVN+  G  A + + D     AE ++      
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDA------ 294

Query: 299 XXXXXXXXXXDFHNSGPSSGFDDAW 323
                     +  NS  +  +D+AW
Sbjct: 295 -------FYSNMPNSNANGIYDNAW 312

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 256/287 (89%), Gaps = 1/287 (0%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREAT++NVDFILS+V++AMANSLRRVMIAEIPT+AIDSVEVETNTSVLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI  L YCRDC+CED+CD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRN+GHPIIQDK+ NGVLICKLRKGQEL LKCVAKKGIAKEHAKW P+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHT+YWHE D A EWP SKN EYEDPPNE + FDYRA   TFYMNVESVGSL+ 
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGL-AEQDGGAM 286
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF   A + A  DG  M
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDGDTM 287

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 228/275 (82%), Positives = 250/275 (90%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREA+KDNVDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYED PNE D FDY+A+  TFYMNVESVGS+ V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGA 275
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF   
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASG 275

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/289 (79%), Positives = 261/289 (90%), Gaps = 3/289 (1%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREAT+DNVDFILSNVD+A+ANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EF++HRLGL+PLQS+DI  L Y RDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKL+HTDYW+E D   EWPQSKNCEYEDPPN+D+ FDY+AK  TFYMNVE+VGS+ V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF--GGAAGLA-EQDGGAM 286
           DQVV+RG+ TLQ KVA I+ +L +MDQ+KVNF  G A G   E+DG AM
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAM 289

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 256/285 (89%), Gaps = 1/285 (0%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+E GPQVKIREATKDNVDFILS VD+AMANSLRR+M+AEIPT+AIDSVE+ETNT+VLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI  L YCRDC+CED+CD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQEL +KCVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D + EWP SKN EYEDPPN+DDAFDY+AK  TFYMNVE+VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGL-AEQDGG 284
           DQVV+RG+ TLQ KVA IL +L +MDQ++VNFG A    A QD G
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG 285

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  481 bits (1237), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 221/273 (80%), Positives = 248/273 (90%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQ+KIREATKDNVDFILSN+DMA+ANSLRRVMIAEIPT+AIDSVEVE NT+VLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFISHRLGL+PLQS+DI+ L YCRDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHPIIQDK+ NGVLICKLRKGQELK+ CVAKKGIAKEHAKW   AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D   EWP SKNC+YEDPP E + FDY+AK  TFYMNVE+VGS+T 
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG 273
           DQV+IRG+ TLQ K A IL +L +M+Q+KVNFG
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFG 273

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 220/273 (80%), Positives = 248/273 (90%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSN+D+A+ANS RRVMIAEIPT+AIDSV++ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHPIIQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E D   EWP SKNCEYEDPPNE + FDY+AK  TFYMNVE+VGS++V
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG 273
           DQVV+RG+ TLQ KVA IL +L +MDQ+K+ + 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYA 273

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 221/272 (81%), Positives = 247/272 (90%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+E GPQVKIREATKDNVDFILSNVD+A+ANS RRVMIAEIPT+AIDSV++ETNT+VLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNLLGRNIGHPIIQD++ NGVLICKLRKGQELK+ C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTDYW+E DA  EWP SKNCEYEDPPNE + FDY+AK  TFYMNVE+VGS+ V
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF 272
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVNF
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNF 272

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 220/290 (75%), Positives = 251/290 (86%), Gaps = 5/290 (1%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M EEGPQVKIREA +DNVDFILSNV++AMANSLRRVM+AEIPT+AIDSV+VETNT+VLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L YCRDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELK+ C+AKKGIAKEHAKW P +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHT YW+E DAA EWP S+NCEYEDPP E + FDY++K  TFYMNVE++GS++V
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG-----GAAGLAEQDGGA 285
           DQVV+RG+ TLQ KVA IL SL +M+Q+K NF      G  G     GGA
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGA 290

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  465 bits (1197), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 214/269 (79%), Positives = 245/269 (91%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M++EGPQVKIREATKDNVDFI+SNVD+AMAN+ RRVMIAEIPT+AIDSVEV +NT+VLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGLVPLQS+DI  L Y RDC+CED+CD+CSVVLTLQA+GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+LLGRNIGHPIIQDK+ NGVLICKLRKGQELK  C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHT+YW+E DAA EWPQSKNCEYEDPPNE   FDY+AK  TFYMNVE++G++T 
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDK 269
           DQV++RG+  LQ KVA IL +L ++DQDK
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDK 269

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  464 bits (1195), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/300 (74%), Positives = 254/300 (84%), Gaps = 8/300 (2%)

Query: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILS+VDMA+ANSLRRVMIAEIPT+AIDSVEV TNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGLVPLQS+DI  L YCRDC+CED+CD+CSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240
           DPWNKLKHTD+W E D A EWPQSKNCEYEDPP+E + FDY+A+   F    E+VG+++ 
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGG----AAGLAEQDG----GAMAAEPES 292
           DQVV+RG+ TLQ KVA IL +L +MDQDKV + G     AG  E +G    G    +P S
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGNDPYS 300

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 99.0 bits (245), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 134/295 (45%), Gaps = 59/295 (20%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           ++ I        +F L N+D ++AN+ RR+MI+E+P++A++ V    NTSVL DE ++HR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLVPLQS------------------SDINDLIYCRDCYCEDNCDR---CSVVLTLQAVG 105
           +GLVPL+                   +D N ++   +  C  N D    C+    L    
Sbjct: 101 IGLVPLKVDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILY--- 157

Query: 106 ESESTTNVYAKDLVIVSNLLGRNI----GHPIIQDKDANG-VLICKLRKGQELKLKCVAK 160
                +NVYA+DL       G+ +     +P++    AN  +L+CKLR GQE+ LK    
Sbjct: 158 ---KNSNVYARDLKFEPQ--GKQVESFANYPVVP---ANPDILLCKLRPGQEISLKAHCI 209

Query: 161 KGIAKEHAKWSPAAAIEFEYDPWNKL----------KHTDYWHE-----TDAAAEWPQSK 205
            GI  +HAK+SP A   +   P   +          K   Y+        D    + +  
Sbjct: 210 LGIGSDHAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDA 269

Query: 206 NCE------YEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
             +      +  P  E      R +   F +NVES G++T +++  + ++ L++K
Sbjct: 270 RKDTVSREVFRHPEFEGKVKLGRVR-NHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 134/292 (45%), Gaps = 54/292 (18%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I   T+   +F L +VD ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE--------------STT 111
           GLVPL+  D + L +      E+    D  ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           ++YA+DL       G  +      P+I  D D   +L+ KLR GQE+ L+     G+  +
Sbjct: 161 HIYARDLKFEPQ--GSQVETFAKCPVIPTDPD---ILLAKLRPGQEISLRAHCILGVGSD 215

Query: 167 HAKWSPAAAIEFEYDPWNKLKH------------------------TDYWHETDAAAEWP 202
           HAK+SP A   +   P   ++                         TD  +  DA  +  
Sbjct: 216 HAKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTV 275

Query: 203 QSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
             +   +E+  N+      R     F  NVES G++T +++  + ++ L++K
Sbjct: 276 SREVLRHEEFSNKVKLGRVRDH---FVFNVESTGAMTPEEIFFKSVRVLKNK 324

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 133/294 (45%), Gaps = 56/294 (19%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSSDINDLIYCRDCYCEDN---CDRCSVVLTLQA--------------VGESES 109
           +GLVPL+     D++   D    D+    D  ++VL+L                  E  +
Sbjct: 101 IGLVPLKVDP--DMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYN 158

Query: 110 TTNVYAKDLVIVSNLLGRNIGH----PIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIA 164
             +VYA+DL       GR        P++  D D   +L+ KLR GQE+ LK     GI 
Sbjct: 159 NAHVYARDLKFEPQ--GRQSTTFADCPVVPADPD---ILLAKLRPGQEISLKAHCILGIG 213

Query: 165 KEHAKWSPAAAIEFEYDPWNKL------------------------KHTDYWHETDAAAE 200
            +HAK+SP +   +   P   +                        + +D  +  DA  +
Sbjct: 214 GDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKD 273

Query: 201 WPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
               +   YE+  ++      R     F  NVES G++T +++  + ++ L++K
Sbjct: 274 TVSREVLRYEEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 136/287 (47%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I    +  V+F L +VD ++AN+ RR+MI+E+P++A + V    NTSVL DE ++HR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLVPLQ-SSDINDLIYCRDCYCEDNCDRCSVVLTLQ--------AVGESE------STTN 112
           GLVPL+   D+   +       E   D  ++V++L         A  + E         +
Sbjct: 102 GLVPLKVDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNAH 161

Query: 113 VYAKDLVIVSNLLGRNIGH----PII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKEH 167
           +YA+DL       G+ +      P++  D D   +L+ KLR GQE+ L+     GI  +H
Sbjct: 162 IYARDLKFEPQ--GKQVEQFAKCPVVAADPD---ILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWSPAAAIEFEYDPWNKLKHTDYWHETDAAAE-WPQS------KNCEYEDPPNED---- 216
           AK+SP +   +   P  ++       +     + +P+       K   Y   P +D    
Sbjct: 217 AKFSPVSTASYRLLPHIQITQPITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTVSR 276

Query: 217 -----DAFDYRAK----PTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
                D F  + K       F  NVES G++T +++  + ++ L++K
Sbjct: 277 EVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 129/297 (43%), Gaps = 57/297 (19%)

Query: 4   EGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFI 63
           E   + I   T+   +F L ++D ++AN+ RR+MIAE+P++A + V    NTSV+ DE +
Sbjct: 38  ESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVL 97

Query: 64  SHRLGLVPLQS------------------SDINDLIYCRDCYCEDNCDRCSVVLTLQAVG 105
           +HR+GL+PL+                   +D N ++   D  C  N D        + + 
Sbjct: 98  AHRIGLIPLRVDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLY 157

Query: 106 ESESTTNVYAKDLVI-----VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAK 160
            +    +VYA+DL        + L        I  D     +LI KLR GQE+ L+    
Sbjct: 158 RN---AHVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCI 209

Query: 161 KGIAKEHAKWSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFD 220
            GI  +HAK+SP A   +   P   +         ++A  + +          ++D+AF 
Sbjct: 210 LGIGGDHAKFSPVATASYRLLPHINITSPI---SGESAKRFQKCFPSGVIGINDKDEAFV 266

Query: 221 YRAKPTT-----------------------FYMNVESVGSLTVDQVVIRGMKTLQDK 254
             A+  T                       F  NVES G++T +++  + ++ L++K
Sbjct: 267 KDARKDTVSREVLRHEEFQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 134/294 (45%), Gaps = 56/294 (19%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           +V I      + +F L N+D ++AN+ RR+MI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSSDINDLIYCRDCYCEDN---CDRCSVVLTLQAV------GESEST------- 110
           +GLVPL+     D++   D    D+    D  +VVL+L            +ST       
Sbjct: 101 IGLVPLKVDP--DMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYN 158

Query: 111 -TNVYAKDLVIVSNLLGRN----IGHPII-QDKDANGVLICKLRKGQELKLKCVAKKGIA 164
             +VYA+DL       GR        P++  D D   +L+ KLR GQE+ LK     G+ 
Sbjct: 159 NAHVYARDLKFEPQ--GRQSTTFANCPVLPADPD---ILLAKLRPGQEISLKAHCILGVG 213

Query: 165 KEHAKWSPAAAIEFEYDPWNKL------------------------KHTDYWHETDAAAE 200
            +HAK+SP +   +   P   +                        + +D  +  DA  +
Sbjct: 214 GDHAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKD 273

Query: 201 WPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
               +   YE+  ++      R     F  NVES G++T +++  + ++ L++K
Sbjct: 274 TVSREVLRYEEFTDKVKLGRVR---NHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 90.1 bits (222), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 134/294 (45%), Gaps = 59/294 (20%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           +KI   ++   +F L ++D ++AN+ RR+MI+E+P++A + V V  NTSV+ DE ++HR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE--------------STT 111
           G++PL+  D + L +      E+    D  +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           +VYA+DL       G+ +      P++  D D   +L+ KLR  QE+ L+     GI  +
Sbjct: 161 SVYARDLRFEPQ--GKQLETFADCPVVPSDPD---ILLAKLRPNQEISLRVHCILGIGSD 215

Query: 167 HAKWSPAAAIEFEYDPW-NKLKHTDYWHETDAAAEWPQS--------------------- 204
           HAK+SP A   +   P  N L+           A +PQ                      
Sbjct: 216 HAKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVS 275

Query: 205 ----KNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
               +  E++D        D+      F  NVES G++T +++  + ++ L++K
Sbjct: 276 REVLRYEEFKDKVKLGRVRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 133/294 (45%), Gaps = 56/294 (19%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSSDINDLIYCRDCYCEDN---CDRCSVVLTLQA--------------VGESES 109
           +GLVPL+     D++   D    D+    D  ++VL+L                  E  +
Sbjct: 101 IGLVPLKVDP--DMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYN 158

Query: 110 TTNVYAKDLVIVSNLLGRN----IGHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIA 164
             +VYA+DL       G+        P++  D D   +L+ KLR GQE+ LK     GI 
Sbjct: 159 NAHVYARDLKFEPQ--GKQSTTFADFPVVPADPD---ILLAKLRPGQEISLKAHCILGIG 213

Query: 165 KEHAKWSPAAAIEFEYDPWNKL------------------------KHTDYWHETDAAAE 200
            +HAK+SP +   +   P   +                        + +D  +  DA  +
Sbjct: 214 GDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKD 273

Query: 201 WPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
               +   Y++  ++      R     F  NVES G++T +++  + ++ L++K
Sbjct: 274 TVSREVLRYDEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 131/299 (43%), Gaps = 59/299 (19%)

Query: 3   EEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEF 62
            E   VKI    +   +F L ++D ++AN+ RR+MI+E+P +A++ V    NTSV+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  ISHRLGLVPLQSSDINDLIYCRDCYCEDN---CDRCSVVLTLQAVGESE----------- 108
           ++HR+GLVPL+     D++   D    D+    D  ++VLTL                  
Sbjct: 97  LAHRIGLVPLKVDP--DMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPN 154

Query: 109 ---STTNVYAKDLVIVSNLLGRNIGHPIIQDKDANG--------VLICKLRKGQELKLKC 157
                +NVYA DL       G+ +      +  AN         +L+ KLR GQE+ L+ 
Sbjct: 155 ILYRNSNVYASDLKFEPQ--GKQV------ETFANNAVVPCDPKILLAKLRPGQEISLRA 206

Query: 158 VAKKGIAKEHAKWSPAAAIEFEYDPWNKLKH------------------TDYWHETDAAA 199
               GI  +HAK+SP A   +   P  ++                           DA  
Sbjct: 207 HCILGIGSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYV 266

Query: 200 EWPQSKNCEYEDPPNEDDAFDYRAKPTT----FYMNVESVGSLTVDQVVIRGMKTLQDK 254
           +  +      E   +E+  F+ + K       F  NVES G++T +++  + ++ L++K
Sbjct: 267 QDSRKDTVSREVYRHEE--FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 123/274 (44%), Gaps = 41/274 (14%)

Query: 19  DFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRLGLVPLQ-SSDI 77
           +F L NVD ++AN+ RR+MIAE+P++A + V    NTSV+ DE ++HR+GL PL+   D+
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLKVDPDM 128

Query: 78  NDLIYCRDCYCEDNCDRCSVVLTLQAVGESE--------------STTNVYAKDLVIVSN 123
              +       E   D  ++VLTL                        ++YA+DL     
Sbjct: 129 LSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEPQ 188

Query: 124 LLGRNI--GHPII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180
              R     +P++  D D   +L+ KLR GQE+ L+     GI  +HAK+SP +   +  
Sbjct: 189 GKQRETFAKNPVVPADPD---ILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DPWNKLKHTDYWHETDAAAEWPQS-------------KNCEYEDPPNE---DDAFDYRAK 224
            P   +            A+                 K+  ++    E    + F+ + K
Sbjct: 246 MPHINITQPITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEEFEGKVK 305

Query: 225 ----PTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
                  F  NVES G++T +++  + ++ L++K
Sbjct: 306 LGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 139/295 (47%), Gaps = 53/295 (17%)

Query: 4   EGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFI 63
           E  ++ I +  +   +  L NVD ++AN+LRR+MI+E+P++A + + +  NTSV+ DE I
Sbjct: 24  ENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVI 83

Query: 64  SHRLGLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE------------- 108
           + R+GL+PL+  D + L +  +   ED    D  ++VL+L                    
Sbjct: 84  AQRIGLIPLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSIL 142

Query: 109 -STTNVYAKDLVIVSNLLGRN----IGHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKG 162
               ++YA+DL       G+        P++  D D   +LI KLR GQE+ L+     G
Sbjct: 143 YHNAHIYARDLKFEPQ--GKQEETFADSPVVSADPD---ILIAKLRPGQEISLRAHCILG 197

Query: 163 IAKEHAKWSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYR 222
           I  +HAK+SP     +   P  K+  T+   + ++A  + +       D    D+A+   
Sbjct: 198 IGADHAKFSPVCTASYRLMP--KIIITEKI-KGESAKRFQKCFPPGVIDINENDEAYVKD 254

Query: 223 AKPTT-----------------------FYMNVESVGSLTVDQVVIRGMKTLQDK 254
           A+  T                       F  N+E+VG+++ +++ ++ +K L++K
Sbjct: 255 ARKDTMTREVLRHEEFQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 98/199 (49%), Gaps = 31/199 (15%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           +V+I    +   +F L N+D ++AN+ RR+MI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQS------------------SDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESE 108
           +GL+PL+                   +D N ++   +  C  N D        + +  + 
Sbjct: 101 IGLIPLKVDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRNS 160

Query: 109 STTNVYAKDLVIVSNLLGRNI----GHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKGI 163
           S   VYA DL       G+ I    G P++  D+D   +L+ KLR GQE+ L+     G 
Sbjct: 161 S---VYASDLKFEPQ--GKQIETFAGTPVVPCDQD---ILLAKLRPGQEISLRAHCILGT 212

Query: 164 AKEHAKWSPAAAIEFEYDP 182
             +HAK+SP +   +   P
Sbjct: 213 GGDHAKFSPVSTASYRLLP 231

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 87.8 bits (216), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 99/196 (50%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           +KI    + +  F L N+D ++AN+ RR+M+AE+P +A + V    NTSV+ DE ++HR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE--------------STT 111
           GLVPL+  D + L +      E+    D  ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           +VYA+DL       G+ +      P++  D D   +L+ KLR GQE+ L+     GI  +
Sbjct: 161 HVYARDLKFEPQ--GKQVETFANCPVVPTDPD---ILLAKLRPGQEISLRAHCILGIGSD 215

Query: 167 HAKWSPAAAIEFEYDP 182
           HAK+SP A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 99/196 (50%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I   T+   +F L ++D ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE--------------STT 111
           GLVPL+  D + L +      E+    D  ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLLGRN----IGHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           +VYA DL       GR        P++  D D   +L+ KLR GQE+ L+     G+  +
Sbjct: 161 SVYAHDLKFEPQ--GRQAELFAKCPVVPADPD---ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWSPAAAIEFEYDP 182
           HAK+SP A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 87.8 bits (216), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 100/197 (50%), Gaps = 27/197 (13%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I+   +   +F L  VD ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLVPLQSSDINDLIYCRDCY--CEDNCDRCSVVLTLQA--------------VGESESTT 111
           GLVPL+  D + L +        E   D  +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLVIVSNLLGRNIGH----PIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           ++YA+DL       G+ +      P++  D D   +L+ KLR GQE+ L+     GI  +
Sbjct: 191 HIYARDLKFEPQ--GKQLETFAKCPVVPADPD---ILLAKLRPGQEISLRVHCILGIGSD 245

Query: 167 HAKWSPAAAIEFEYDPW 183
           HAK+SP A   +   P+
Sbjct: 246 HAKFSPVATASYRLMPY 262

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 132/295 (44%), Gaps = 61/295 (20%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I        +F L ++D ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCY--CEDNCDRCSVVLTLQA--------------VGESESTT 111
           GLVPL+  D + L +        E   D  +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLVI--VSNLLGRNIGHPII-QDKDANGVLICKLRKGQELKLKCVAKKGIAKEHA 168
           ++Y++DL        L     HP++  D D   +L+ KLR GQE+ L+     G+  +HA
Sbjct: 161 HIYSRDLKFEPQGKQLDSFAKHPVLPTDPD---ILLAKLRPGQEISLRVHCILGVGGDHA 217

Query: 169 KWSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPN------EDDAFDYR 222
           K+SP     +   P     H D   ET    +  +   C    PP       + +A+   
Sbjct: 218 KFSPVCTASYRLMP-----HIDIL-ETIQGEDATKFVKCF---PPGVAAIDEKGEAYIKD 268

Query: 223 AKPTT-----------------------FYMNVESVGSLTVDQVVIRGMKTLQDK 254
           A+  T                       F  NVES G++T +++  + ++ L++K
Sbjct: 269 ARKDTVSREVLRHPEFEGKVKLGRVKDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 133/296 (44%), Gaps = 58/296 (19%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I   ++   +F L N+D +MAN+ RR+MI+E+P++A + V   TNTSV+ DE ++HR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLVPLQS------------------SDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESES 109
           G++PL+                   +D N ++   +  C  N +        + +  + S
Sbjct: 102 GMIPLKVDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNSS 161

Query: 110 TTNVYAKDLVIVSNLLGRNIGH----PII-QDKDANGVLICKLRKGQELKLKCVAKKGIA 164
              VYAKDL       G+ +      P++  D D   +L+ KLR  QE+ L+     G+ 
Sbjct: 162 ---VYAKDLKFEPQ--GKQVETFAKCPVVPSDPD---ILLAKLRPDQEISLRVHCILGVG 213

Query: 165 KEHAKWSPAAAIEFEYDPW-NKLK-----------------------HTDYWHETDAAAE 200
            +HAK+SP +   +   P  N LK                        T   +  DA  +
Sbjct: 214 GDHAKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKD 273

Query: 201 WPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDKVA 256
               +   +E+    +D          F  NVES G++T +++  + ++ L++K +
Sbjct: 274 TVSREVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 130/294 (44%), Gaps = 56/294 (19%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           +V I    +   +F L N+D ++AN+ RR+MI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSSDINDLIYCRDCYCEDN---CDRCSVVLTLQA--------------VGESES 109
           +GLVPL+     D++   D    D+    D  ++VL+L                  E  +
Sbjct: 101 IGLVPLKVDP--DMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYN 158

Query: 110 TTNVYAKDLVIVSNLLGRNIG-----HPIIQDKDANGVLICKLRKGQELKLKCVAKKGIA 164
             +VYA+DL       GR          +  D D   +L+ KLR GQE+ LK     GI 
Sbjct: 159 NAHVYARDLKFEPQ--GRQSTTFAACSVVPADPD---ILLAKLRPGQEISLKAHCILGIG 213

Query: 165 KEHAKWSPAAAIEFEYDPWNKLKHT---------------------DYWHET---DAAAE 200
            +HAK+SP +   +   P   +  +                     D   E    DA  +
Sbjct: 214 GDHAKFSPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKD 273

Query: 201 WPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTLQDK 254
               +   YE+  ++      R     F  NVES G++T +++  + ++ L++K
Sbjct: 274 TVSREVLRYEEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 124/288 (43%), Gaps = 47/288 (16%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           V+I    +   +F L NVD ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQ-SSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESE--------------STTN 112
           GL PL+   D+   +       E   D  ++VLTL                        +
Sbjct: 102 GLTPLKVDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNAH 161

Query: 113 VYAKDLVI--VSNLLGRNIGHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIAKEHAK 169
           +YA+DL        L     +P++  D D   VL+ KLR GQE+ L+     GI  +HAK
Sbjct: 162 IYARDLKFEPQGKQLETFAKNPVVPADPD---VLLAKLRPGQEISLRAHCILGIGSDHAK 218

Query: 170 WSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTT-- 227
           +SP     +   P   +            A+          D   E +A+   A+  T  
Sbjct: 219 FSPVCTASYRLMPHINITSPITGESAQKFAKCFSPGVIGIND---EGEAYVKDARHDTVS 275

Query: 228 ---------------------FYMNVESVGSLTVDQVVIRGMKTLQDK 254
                                F  NVES G++T +++  + ++ L++K
Sbjct: 276 REVLRHEEFEGKVKLGRIRDHFIFNVESAGAMTPEEIFFKSVRILKNK 323

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 99/196 (50%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRL 67
           VKI    +   +F L ++D ++AN+ RR+MI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSSDINDLIYCRDCYCEDN--CDRCSVVLTLQAVGESE--------------STT 111
           GLVPL+  D + L +  +   E+    D  ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKGIAKE 166
           N+YA+ L       G+ +      P++  D D   +L+ KLR GQE+ L+     GI  +
Sbjct: 161 NIYARHLKFEPQ--GKQLETFAKSPVVPADPD---ILLAKLRPGQEISLRAHCILGIGSD 215

Query: 167 HAKWSPAAAIEFEYDP 182
           HAK+SP     +   P
Sbjct: 216 HAKFSPVCTASYRLMP 231

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 84.7 bits (208), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (48%), Gaps = 35/200 (17%)

Query: 7   QVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHR 66
           QV   E  + N D I   +D ++AN+ RR+MIAE+P +A + V ++ NTSV+ DE ++HR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLVP------------------LQSSDINDLIYCRDCYCEDNCDR---CSVVLTLQAVG 105
           +GLVP                  L+  D N ++   +  C  N D    C+    L    
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFHDKNTIVMTLNVKCTRNPDAPKDCTDPTILY--- 157

Query: 106 ESESTTNVYAKDLVIV--SNLLGRNIGHPIIQ-DKDANGVLICKLRKGQELKLKCVAKKG 162
              +  +VYA+DL     S+ +      P++  D D   +L+ KLR GQE+ L      G
Sbjct: 158 ---NNAHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILG 211

Query: 163 IAKEHAKWSPAAAIEFEYDP 182
             K+HAK+SP A   +   P
Sbjct: 212 EGKDHAKFSPVATASYRLLP 231

>CAGL0G08954g Chr7 complement(857016..858788) [1773 bp, 590 aa] {ON}
           some similarities with uniprot|Q08157 Saccharomyces
           cerevisiae YOL019w TOS7
          Length = 590

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 29  MANSLRRVMIAEIPTIAIDSVEVETNTSVLADEFISHRLGLVPLQSSDINDLIYCRDCYC 88
           MA   R VM   +  +A  S+      SV A  F  H++GL     +  N   Y    YC
Sbjct: 1   MAERKRTVMFLVVGLLAFISMAFFIIASVTAPAF--HQIGL-----AKSNGFTYGTLGYC 53

Query: 89  EDNCDRCSVVLTLQAVGESEST 110
           +D C R S     + + + E+T
Sbjct: 54  QDGCSRASASYHPETLDDDENT 75

>TBLA0G03110 Chr7 (822149..823231) [1083 bp, 360 aa] {ON} Anc_3.157
           YOL064C
          Length = 360

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 47  DSVEVETNTSVLADEFISHRLGLVPLQSSDINDLIYCRDCYCEDN 91
           DS+  E +   L+DEF+S  L L+     + ND IY RD  CED+
Sbjct: 66  DSIVGEESADDLSDEFLSRILSLI-----NENDEIYTRDYPCEDD 105

>CAGL0K06303g Chr11 (611434..621177) [9744 bp, 3247 aa] {ON} similar
           to uniprot|Q03280 Saccharomyces cerevisiae YDR457w
           ubiqitin ligase
          Length = 3247

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 47/108 (43%), Gaps = 8/108 (7%)

Query: 149 KGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY----DPWNKLKHTDYWH-ETDAAAEWPQ 203
           K + LKL          E+ +      + FE       W+KL++T Y   +T++A+   +
Sbjct: 166 KNKALKLALAIPSSAMDENGEHFALTDLYFEKKKYPSKWSKLRYTYYASPKTNSASSNVK 225

Query: 204 SKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTVDQVVIRGMKTL 251
           S +C      N   +         F MN E +  LT+ +++ +GMK +
Sbjct: 226 SVDC---SDSNSHSSAQQGVSMLKFSMNSEELSKLTIQEILDKGMKVI 270

>Skud_5.230 Chr5 complement(363859..368028) [4170 bp, 1389 aa] {ON}
           YER105C (REAL)
          Length = 1389

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 40  EIPTIAIDSVEVE---TNTSVLADEFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCS 96
           +I  I+I  ++VE   ++ SVLAD F  HR   VP      ++ I   D    ++    +
Sbjct: 740 DIFGISITKLQVEYYLSSISVLADFFNIHRPSFVPFLVPRDSNAITVSDA---ESIAMDA 796

Query: 97  VVLTLQAVGESESTTNVYAKDLVIVSNLLGRNIGHPIIQD 136
           ++L + ++ ++ S  NV+ +D+    +LL   +G   I D
Sbjct: 797 LILLINSIKDAFSLLNVFYEDIDAFKSLLHTLMGEEGIYD 836

>NCAS0G04060 Chr7 complement(754763..758428) [3666 bp, 1221 aa] {ON}
           Anc_1.476
          Length = 1221

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 236 GSLTVDQVVIRGMKTLQDKVADI--LFSLKKMDQDKVNFGGAA-GLAEQDGGAMAAEP 290
           G+LT + +V  G+  L DK  D+  LFS +   Q+ +   GAA  L + D G +  +P
Sbjct: 490 GTLTGEDLVFEGLAGLSDKSEDVRHLFSSEDASQETILVVGAAHALVKLDDGEIVGDP 547

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 25/44 (56%)

Query: 238 LTVDQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQ 281
           +T+D   +  M+ L  +   +++++   DQD ++F G  GL +Q
Sbjct: 153 VTLDITTLTIMRVLPRETDPLVYNMTSFDQDNISFDGIGGLTDQ 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,993,795
Number of extensions: 1365502
Number of successful extensions: 3312
Number of sequences better than 10.0: 51
Number of HSP's gapped: 3373
Number of HSP's successfully gapped: 51
Length of query: 323
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 213
Effective length of database: 40,868,139
Effective search space: 8704913607
Effective search space used: 8704913607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)