Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.203687.196ON41241221860.0
KLTH0E04554g7.196ON47941220310.0
SAKL0F07502g7.196ON41240818100.0
KLLA0D16214g7.196ON41838917560.0
TDEL0H025107.196ON41839816880.0
Smik_9.1687.196ON43140516840.0
Skud_9.1477.196ON43140516690.0
Suva_9.1777.196ON43540516680.0
Ecym_43807.196ON41840516620.0
YIL022W (TIM44)7.196ON43140516560.0
Kpol_1063.97.196ON41739616520.0
NCAS0A125207.196ON43239616250.0
CAGL0J02442g7.196ON41240816090.0
ZYRO0D15840g7.196ON40739616040.0
ADL118C7.196ON41840216000.0
NDAI0B017807.196ON43440416000.0
TPHA0C045307.196ON41638715930.0
KNAG0H026907.196ON41941515560.0
KAFR0A026407.196ON42139615110.0
TBLA0J015007.196ON42138913111e-180
Suva_10.835.226ON466127830.12
Skud_12.715.226ON462127810.20
YLR005W (SSL1)5.226ON461127800.24
Smik_12.675.226ON458127790.37
KLTH0B02794g5.226ON470188770.55
KNAG0B051505.226ON469130770.62
Kwal_33.152465.226ON469188741.3
KLLA0E09615g5.226ON488126722.5
KAFR0J007105.226ON46960703.7
NCAS0B041808.203ON26553685.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20368
         (412 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   846   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   786   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   701   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   681   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   654   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   653   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   647   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   647   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   644   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   642   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   640   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   630   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   624   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   622   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   620   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   620   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   618   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   603   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   586   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   509   e-180
Suva_10.83 Chr10 (165557..166957) [1401 bp, 466 aa] {ON} YLR005W...    37   0.12 
Skud_12.71 Chr12 (151308..152696) [1389 bp, 462 aa] {ON} YLR005W...    36   0.20 
YLR005W Chr12 (160049..161434) [1386 bp, 461 aa] {ON}  SSL1Compo...    35   0.24 
Smik_12.67 Chr12 (147119..148495) [1377 bp, 458 aa] {ON} YLR005W...    35   0.37 
KLTH0B02794g Chr2 (217284..218696) [1413 bp, 470 aa] {ON} highly...    34   0.55 
KNAG0B05150 Chr2 complement(987516..988925) [1410 bp, 469 aa] {O...    34   0.62 
Kwal_33.15246 s33 complement(1030094..1031503) [1410 bp, 469 aa]...    33   1.3  
KLLA0E09615g Chr5 (851587..853053) [1467 bp, 488 aa] {ON} simila...    32   2.5  
KAFR0J00710 Chr10 complement(129877..131286) [1410 bp, 469 aa] {...    32   3.7  
NCAS0B04180 Chr2 (753256..754053) [798 bp, 265 aa] {ON} Anc_8.20...    31   5.1  

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MVRPVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 60
           MVRPVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS
Sbjct: 1   MVRPVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 60

Query: 61  GKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKT 120
           GKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKT
Sbjct: 61  GKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKT 120

Query: 121 AAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRS 180
           AAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRS
Sbjct: 121 AAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRS 180

Query: 181 NDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGN 240
           NDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGN
Sbjct: 181 NDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGN 240

Query: 241 KIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSE 300
           KIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSE
Sbjct: 241 KIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSE 300

Query: 301 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRD 360
           APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRD
Sbjct: 301 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRD 360

Query: 361 VKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           VKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT
Sbjct: 361 VKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/412 (91%), Positives = 398/412 (96%)

Query: 1   MVRPVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 60
           M+RP RP+ +VV  R L+QT +ACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS
Sbjct: 68  MLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDAS 127

Query: 61  GKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKT 120
           GK+GES+AYKKAREAYL AQKGSTIVGKT+KKTGDSVE+IAAKAWESEI KSTR+AVNKT
Sbjct: 128 GKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKT 187

Query: 121 AAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRS 180
           AAKLDESFEPVRHTRVYKDVSEVM+S NSSRYGGFI+KEQRRLKLEQDIASGKRPKAV+S
Sbjct: 188 AAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKS 247

Query: 181 NDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGN 240
           N+EAGTALVAT IEAKESFGKKVDDFKEKTVVGRKL D K KLWDESENPLIVL+RTIGN
Sbjct: 248 NEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGN 307

Query: 241 KIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSE 300
           K+GGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKG+E+VLKQWFSE
Sbjct: 308 KVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSE 367

Query: 301 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRD 360
           APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLL PQDLPVLVVGCRAQEIHLYRD
Sbjct: 368 APYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRD 427

Query: 361 VKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           VKTGEVAAGTQSNILMSSYAMVFTRDPE+ID+KETEGWKILEFVRGGSRQFT
Sbjct: 428 VKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/408 (81%), Positives = 374/408 (91%), Gaps = 1/408 (0%)

Query: 5   VRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLG 64
           ++P   +   R +S T+R  QG  RSPLQIFRETFKQEW+KS+ELQDNIK LQDASGKLG
Sbjct: 6   IKPQLVLASRRTISSTVRLPQGQ-RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLG 64

Query: 65  ESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKL 124
           ESDAYKKAREAYL+AQKGSTIVGKT+KKTG++VE IA KAWESE+ K+TRKA+N TA K+
Sbjct: 65  ESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKI 124

Query: 125 DESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEA 184
           DESFEPVR T+VYKDVSEV++ G SSRYGGFITKEQRRLK EQD+ASGKRPKAV+SNDEA
Sbjct: 125 DESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEA 184

Query: 185 GTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGG 244
           GTALVATNIEAKESF KK++DFKEKT  GRK+H+ KV+LWDESENPLIVLLRTIGNK+GG
Sbjct: 185 GTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGG 244

Query: 245 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYN 304
           +FAETESARVMGQFKM+D NFN+ESF  HLREYIIPE+LEAYVKGDE VLKQWFSEAPYN
Sbjct: 245 IFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 304

Query: 305 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTG 364
           VYAAQQK FR+Q LFADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEIHLYR  KTG
Sbjct: 305 VYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTG 364

Query: 365 EVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           E+AAGT+SNIL+SSYAMVFTRDPE++D+KETEGW+ILEFVRGGSRQFT
Sbjct: 365 EIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/389 (83%), Positives = 359/389 (92%)

Query: 24  CQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLKAQKGS 83
              NPRSPLQIFRETFKQEW+KS+ELQDNIKALQDASGKLGES+AYKKAREAY+KAQKGS
Sbjct: 30  AMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGS 89

Query: 84  TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVYKDVSEV 143
           TIVGKT+KKTG++VE IA+KAW+SEI+KSTRK VNKTA KLDESFEPVR T+VYKDVSEV
Sbjct: 90  TIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEV 149

Query: 144 MESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAKESFGKKV 203
           ++ G+SSRYGGFITKEQRRL  E+ IASGKR +AV+SND AGTALVATNIE+KESFGKK+
Sbjct: 150 IDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKI 209

Query: 204 DDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMGQFKMMDG 263
           +DFKEKT VGRKLH++K+KLWDESENPL+V+LRT+  KIGGLFAETESARV GQFKMMD 
Sbjct: 210 EDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDP 269

Query: 264 NFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQGLFADGR 323
            FN+E F  HLREYIIPE+LEAYVKGDE VLKQWFSEAPYNVYAAQQK FREQ LFADG+
Sbjct: 270 TFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGK 329

Query: 324 ILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVF 383
           ILDIRGV+IVSAKLL PQD+PVLVVGCRAQEIHLYR  KTGE+AAG +S+ILMSSYAMVF
Sbjct: 330 ILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVF 389

Query: 384 TRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           TRDPE +D+KETEGWKILEFVRGGSRQFT
Sbjct: 390 TRDPETVDDKETEGWKILEFVRGGSRQFT 418

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/398 (77%), Positives = 355/398 (89%)

Query: 15  RKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKARE 74
           R L  T      NPRSP+QIFR+TFK+EWKKSQELQDNIK LQDASG+LGES+AYK+ARE
Sbjct: 21  RALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAYKRARE 80

Query: 75  AYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHT 134
           AY++AQKGSTIVGKT+KKTG++VE IA+KAW+SEI+++TR+A +KTA K+DE FEPVR T
Sbjct: 81  AYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGFEPVRQT 140

Query: 135 RVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIE 194
           ++YKDVSEVM+ GNSSRYGGFITKEQRRLK EQD+ SGKR KAV+ N++AGTALVAT+IE
Sbjct: 141 KIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVATDIE 200

Query: 195 AKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARV 254
           AK+SFGKKV+DFKEKTV+GR LH  K  LWDES NPLIV LR I  KIGG FAETE+ARV
Sbjct: 201 AKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEAARV 260

Query: 255 MGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFR 314
           +GQFKMMD  F +ESF  HLREY+IPE+LEAYVKGDEKVLK+WFSEAPYNVYAAQQK FR
Sbjct: 261 LGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQKAFR 320

Query: 315 EQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNI 374
           EQ LFADG+ILDIRGV+IVSAK+L PQD+PVLVVGCRAQEIHLYR  KTGEVAAG +SNI
Sbjct: 321 EQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHESNI 380

Query: 375 LMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           +MSSYAMVFTRDPE ID++ETEGW+ILEFVRGGSRQFT
Sbjct: 381 MMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/405 (76%), Positives = 361/405 (89%), Gaps = 3/405 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           +  V+FS   +   R   GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGKLGES+
Sbjct: 30  IARVLFS---TSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESE 86

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
           AYKKAREAYLKAQ+GSTIVGKT+KKTG+++E IA KAWESE+ K+TRKA + TA KLDES
Sbjct: 87  AYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDES 146

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SNDEAGTA
Sbjct: 147 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTA 206

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           +VATNIE+KESFGKKV+DFKEKTVVGR +   K KLWDESENPLIV++R I NK+GG FA
Sbjct: 207 VVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFA 266

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETES+RV  QFKMMD  F++ESF  HLREYI+PE+LEAYVKGD KVLK+WFSEAP+NVYA
Sbjct: 267 ETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYA 326

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQK+F+EQ ++ADGRILDIRGV++VSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 327 AQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIA 386

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 387 AGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/405 (75%), Positives = 360/405 (88%), Gaps = 3/405 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           V  V+FS   +   RA  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGKLGES+
Sbjct: 30  VARVLFS---TSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESE 86

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
           AYKKAREAYL+AQ+GSTIVGKT+KKTG+++E IA KAWESE+ K+TRKA + TA +LDES
Sbjct: 87  AYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDES 146

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SNDEAGTA
Sbjct: 147 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTA 206

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           +VATNIE+KESFGKKV+DF+EKT +GR +   K +LWDESENPLIV++R + NK+GG FA
Sbjct: 207 VVATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFA 266

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETES+RV  QFK+MD  F++ESF  HLR+YI+PE+LEAYVK D KVLK+WFSEAPYNVYA
Sbjct: 267 ETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYA 326

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQK+FREQ ++ADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 327 AQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIA 386

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 387 AGNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/405 (75%), Positives = 359/405 (88%), Gaps = 3/405 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           +   +FS   +   RA  GNPRSPLQIFR+TFK+EW KSQELQ+NIK LQDASGKLGES+
Sbjct: 34  IARALFS---TSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGESE 90

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
           AYKKAREAYL+AQ+GSTIVGKT+KKTG++VE IA +AW+SE+ K+TRKA + TA KLDES
Sbjct: 91  AYKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDES 150

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SNDEAGTA
Sbjct: 151 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTA 210

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           +VATNIE+KESFGKKV+DFKEKT VGR +   K +LWDESENPLIV++R + NK+GG FA
Sbjct: 211 VVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFA 270

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETES+RV  QFKMMD  F++E+F  HLREYI+PE+LEAYVKGD KVLK+WFSEAP+NVYA
Sbjct: 271 ETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYA 330

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQK+F+EQ +FADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 331 AQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIA 390

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 391 AGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/405 (75%), Positives = 350/405 (86%), Gaps = 1/405 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           +   V +R+ S T  +  G  +SPLQIFRETFK EWKKSQELQDNIKALQDASG+LGESD
Sbjct: 15  IAKAVPARQFSTTGLSWNGQ-KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESD 73

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
           AYKKAREAYLKAQ+GST+VGKT+KKTG+++E +  KAW+S+I K+TR+ V+KTA KLDES
Sbjct: 74  AYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDES 133

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVRHTRVYKD+SE+++ G SSRYGGFI KE RR K E D+ASG+R  AVRSNDEAGTA
Sbjct: 134 FEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTA 193

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           +VATN E KESFGKK+ DFKEKT +GRKLH+ KVKLWDE+ENPLI +LRTI NKIGGLFA
Sbjct: 194 MVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFA 253

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETESARV  QFK++D  FNSE F  HLREYIIPEVLEAYVKGDE VLKQW SEAPYNVYA
Sbjct: 254 ETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYA 313

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQK FREQ LF DGR+LDIRGV+IVSAKLL PQD+P LVVGCR QEIHLYR  KTGE+A
Sbjct: 314 AQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIA 373

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           AG +SNI+MSSYAMV TRDPE++ +KETEGWK+LEF+RGGSRQFT
Sbjct: 374 AGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/405 (76%), Positives = 362/405 (89%), Gaps = 3/405 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           V  V+FS   + T RA  GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGKLGES+
Sbjct: 30  VARVLFS---TSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESE 86

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
           AYKKAREAYLKAQ+GSTIVGKT+KKTG+++E IA KAWESE+ K+TRKA   TA KLDES
Sbjct: 87  AYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDES 146

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SN++AGTA
Sbjct: 147 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTA 206

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           +VATNIE+KESFGKKV+DFKEKTVVGR +   K KLWDESENPLIV++R I NK+GG FA
Sbjct: 207 VVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFA 266

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETES+RV  QFK+MD  F++ESF  HLREYI+PE+LEAYVKGD KVLK+WFSEAP+NVYA
Sbjct: 267 ETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYA 326

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQK+F+EQ ++ADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 327 AQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIA 386

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 387 AGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/396 (77%), Positives = 353/396 (89%), Gaps = 1/396 (0%)

Query: 17  LSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAY 76
            S + R  QG PR+P+QIFR+TFK+EW+KS++LQDNIKALQDASG+LGES+AYKKAREAY
Sbjct: 23  FSTSSRVLQG-PRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKAREAY 81

Query: 77  LKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRV 136
           LKAQKGSTIVGKT++KTG++VE IA+KAW+SEI KSTRKA + TA K+DESFEPVR T+V
Sbjct: 82  LKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKTQV 141

Query: 137 YKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196
           YKDVS+V++ G+SSRYGGFI KEQRRLK E D+ SGKR +AV+SNDEAGT++VATNIEAK
Sbjct: 142 YKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIEAK 201

Query: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256
           ES GKK++DFKE T  GR +H  KVKLWDE+ENPLIV LR +  KIGG FAETES+RV+ 
Sbjct: 202 ESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRVLS 261

Query: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316
           QFK+MD  F+++SF  HLREYIIPEVLEAYVKGDE VLK+WFSEAPYNVYAAQQK FR+Q
Sbjct: 262 QFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFRKQ 321

Query: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376
            LF DGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEIHLYR VKTGE+AAG +SNILM
Sbjct: 322 QLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNILM 381

Query: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           SSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 382 SSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/396 (76%), Positives = 351/396 (88%), Gaps = 1/396 (0%)

Query: 18  SQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYL 77
           + T R+  G  R+P+QIFR+TFK+EW KSQELQ+NIKAL DASGKL ES+ +K A++AYL
Sbjct: 37  TTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDAYL 96

Query: 78  KAQKGS-TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRV 136
           KA KGS TI+ KTM+KTG++VE +A+KAW+SEI+KSTR+A  KTA  LD+SFEPVR T+V
Sbjct: 97  KAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQV 156

Query: 137 YKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196
           YKD+SEV++ G+SSRYGGFITKE+RRLK E D+ASGKR +A++SN+EAGTALVAT+IEAK
Sbjct: 157 YKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAK 216

Query: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256
           +SFGKKV+DFKEKTVVG+ +   KVKLWDESENPLIV LR I NKIGG F ETESARV  
Sbjct: 217 QSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARVYT 276

Query: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316
           QFKMMD  F +E F  HLREYI+PE+LEAY+KGDEKVLK+WFSEAP+NVY+AQQKVFREQ
Sbjct: 277 QFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQ 336

Query: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376
           GLF+DGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LYR VKTGE+AAG QSNILM
Sbjct: 337 GLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILM 396

Query: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           SSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 397 SSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/408 (73%), Positives = 349/408 (85%), Gaps = 1/408 (0%)

Query: 5   VRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLG 64
           VR    V+ +R+   T      NPRSPLQIFRETFK+EW+KSQELQDNIK LQDASG+LG
Sbjct: 4   VRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLG 63

Query: 65  ESDAYKKAREAYLKAQKGS-TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAK 123
           ES+AYKKAREAYLKA KGS TIVGKT++KTG++VE +A KAW+S+I+K+TR   +KTA K
Sbjct: 64  ESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKK 123

Query: 124 LDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDE 183
           LDESFEPVR T++YKDVSEV++ G+SS YGGFITKEQRRLK E+D+ASGKR +AV+SNDE
Sbjct: 124 LDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDE 183

Query: 184 AGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIG 243
           AG+ALVAT+IEAKES GKK++DFKEKT VGR L   KV LWDESENPLIV LR I  KIG
Sbjct: 184 AGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIG 243

Query: 244 GLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPY 303
           G FAETESARV  QFKM+D  F +  F  HLR+YI+PEVLEAYVKGDEKVLK+WFSEAP+
Sbjct: 244 GFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPF 303

Query: 304 NVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKT 363
           NVY AQQK+F++Q LF+DG+ILDIRGV++VSAKLL PQD+PVLVVGCRAQEIHLYR  KT
Sbjct: 304 NVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKT 363

Query: 364 GEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQF 411
           GE+AAG +SNILMSSYAMVFTRDPE ID+ ETEGWKILEF+RG SR F
Sbjct: 364 GEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/396 (73%), Positives = 354/396 (89%), Gaps = 2/396 (0%)

Query: 17  LSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAY 76
            S + R+ QG  RSPLQIFR+TFK+EW+KSQELQ+NIK LQDASG+LG+S+  K+AREAY
Sbjct: 14  FSTSSRSLQG--RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAY 71

Query: 77  LKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRV 136
           L+AQKGSTIVGKT++KTG++VE IA+KAWESEI+KSTR A + TA KLD+SFEPVR+T++
Sbjct: 72  LRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNTKI 131

Query: 137 YKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196
           YKDVSEVME  ++SRYGGF+TKEQR++K E++IASGKR +A+RSN+EAGTALVATNIEAK
Sbjct: 132 YKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAK 191

Query: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256
           ES GKKV+DF+EKT +GR +   KV+LW+E+ENPLIV+LR I NK+GG FAETE+A+V+G
Sbjct: 192 ESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIG 251

Query: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316
           QFK++D +F SE F   LR+Y+IPEVLEAY KGDEK LK+WFSEAP+NVYAAQQK FR+Q
Sbjct: 252 QFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQ 311

Query: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376
            LFAD RILDIRGVDIVSAKLL PQD+PVL+VGCRAQEI LYR +K+GEVAAG +SNILM
Sbjct: 312 KLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILM 371

Query: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           SSYAMVFTRDPE+++++ETEGW+I+EFVRGGSRQFT
Sbjct: 372 SSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 351/402 (87%), Gaps = 1/402 (0%)

Query: 11  VVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYK 70
           V+ +R  S T  A  G P+SPLQ+FRETFK+EWKKSQELQDNIKALQDA G+LGESDAYK
Sbjct: 18  VLAARGFSATRWAGNG-PKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76

Query: 71  KAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEP 130
           KAREAYLKAQKGSTIVGKT+K+TG+++E I  +AWESEI K+TRK V+KTA KLDESFEP
Sbjct: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136

Query: 131 VRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVA 190
           VR T+VYKD+SE+++ G SSRYGGF+ KE+RR K E+D+A+GKR   VRSN+EAG+ALVA
Sbjct: 137 VRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVA 196

Query: 191 TNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETE 250
           T+ EA ES GKK+ DFKEKTVVGRKLH+ KV+LWDE+ENPLI LLRTI NK+GGLFAETE
Sbjct: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256

Query: 251 SARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQ 310
           SARV  QFK++D  FN+E F  HLREYIIPEVLEAYVKGDE+VLKQWFSEAPYNVY+AQQ
Sbjct: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316

Query: 311 KVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGT 370
           K  R+Q LFADGRILDIRGV+I+SAKLL PQD+P +VVGCRAQEIHL+R   TGE+AAG 
Sbjct: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376

Query: 371 QSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           +SNI++SSYAMV TRDPE +D+KETEGWKILEFVRGGSR FT
Sbjct: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/404 (73%), Positives = 352/404 (87%), Gaps = 1/404 (0%)

Query: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67
           VG V+FS   + T+    G  R+P+QIFR+TFK+EW+KSQELQDNIKAL DASGKL ES+
Sbjct: 31  VGKVLFSTTRT-TLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESE 89

Query: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127
            +K A++AYLKA KGSTIV KT+KKTG++VE +A+KAW+SEI K+TR A  KTA  +D+S
Sbjct: 90  TFKMAKDAYLKAHKGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKS 149

Query: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187
           FEPVR T++YKDVSEV++ G+SSRYGGFITKE+R+LK E+D+ASGKR +AV+SNDEAGTA
Sbjct: 150 FEPVRKTQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTA 209

Query: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247
           LVATNIEAKESFGKKV+DFKEKTVVG+ +   K+KLWDESENPLIV LR I NKI G F 
Sbjct: 210 LVATNIEAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFD 269

Query: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307
           ETESA+V  QFK+MD  F ++ F  HLR+YI+PE+LEAY+KGDEKVLK+WFSEAP+NVYA
Sbjct: 270 ETESAKVYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYA 329

Query: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367
           AQQKVFREQGLF+DGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEI+LY+  K+GE+A
Sbjct: 330 AQQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIA 389

Query: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQF 411
           AG +SNI+MSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSR F
Sbjct: 390 AGDESNIVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPF 433

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/387 (74%), Positives = 345/387 (89%)

Query: 26  GNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLKAQKGSTI 85
           G  ++P+QIFRETFK+EW+KSQELQDNIK LQDASG+LG+S+AYKKA+EAY+KAQ+ STI
Sbjct: 30  GGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVKAQQSSTI 89

Query: 86  VGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVYKDVSEVME 145
           V KT+KKTG++VE +A K W+SEI KSTRK V++ A K+DESFEPVR T+VYK+VSEV++
Sbjct: 90  VSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYKEVSEVID 149

Query: 146 SGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAKESFGKKVDD 205
            G SSRYGGFI+KEQRR K E D+ASGKR +A +SN+EAGTA+VATN+E+KESFGKK+DD
Sbjct: 150 DGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKESFGKKIDD 209

Query: 206 FKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMGQFKMMDGNF 265
           FKEKTVVG+ +  FKV++WDE+ENPLIV+LRTI NKI G FAETES+RV  QFK+MD  F
Sbjct: 210 FKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQFKLMDPTF 269

Query: 266 NSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQGLFADGRIL 325
           ++ +F  HLR+YIIPEVLEAYVKGDE VLK+WFSEAP+NVYAAQQK  R+Q LF DGRIL
Sbjct: 270 SNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQLFTDGRIL 329

Query: 326 DIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTR 385
           DIRGVDIVSAKLLAPQD+PVLVVGCRAQE+HLYR VKTGE+ AG +SNI+MSSYAMVFTR
Sbjct: 330 DIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSSYAMVFTR 389

Query: 386 DPEDIDNKETEGWKILEFVRGGSRQFT 412
           DP++ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 390 DPDNIDDDETEGWKILEFVRGGSRQFT 416

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/415 (70%), Positives = 356/415 (85%), Gaps = 5/415 (1%)

Query: 3   RPVRPV--GNVVFSRKLSQTIRACQG---NPRSPLQIFRETFKQEWKKSQELQDNIKALQ 57
           + VRP   G  V +R    T R       +PRSPL IFR+TFK+EW+KSQELQ+NI+ LQ
Sbjct: 5   KTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQ 64

Query: 58  DASGKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAV 117
           DASGK+GE++AY+KAREA+L+AQKGSTIVGKT+KKTG++VE IA+KAW+SEI+K++RKA 
Sbjct: 65  DASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAA 124

Query: 118 NKTAAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKA 177
            KTA KLDE FEPVR T++YKDVSEV++ G+S+ YGGF T+E+R+ + E+ +ASG+R +A
Sbjct: 125 VKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVRA 184

Query: 178 VRSNDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRT 237
           V+SNDEAGTALVAT +E+KES GKK++DFKEKT VGR LH  K +LWDESENPLIV +R 
Sbjct: 185 VKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRK 244

Query: 238 IGNKIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQW 297
           +  K+G  FAETES RV  QFK+MD NFNS +F  HLREY++PE+LEAYV+GDEKVLK+W
Sbjct: 245 VSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKW 304

Query: 298 FSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHL 357
           FSEAPYNVYAAQQK+F+E+ LFADGRILDIRGV+IVSAKLL PQDLPVLVVGCRAQEI+L
Sbjct: 305 FSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINL 364

Query: 358 YRDVKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           Y+ VKTGE+AAG++SNILMSSYAMVFTRDPE + ++ETEGWKILEFVRGGSRQFT
Sbjct: 365 YKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/396 (70%), Positives = 337/396 (85%), Gaps = 2/396 (0%)

Query: 19  QTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLK 78
            T R      R+PLQIFRETFK+EW+KS ELQ +IK LQDASGK+ ES+AYKKAR+AYLK
Sbjct: 26  HTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLK 85

Query: 79  AQKGS-TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVY 137
           A +GS TI+ KT+KKTGD++E IA KAWESEISK+TR+  ++TA KLDESFEPVR+T++Y
Sbjct: 86  AHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIY 145

Query: 138 KDVSEVM-ESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196
           KDVSEV+ + G+S RYGGFI K++RRLK E  + SGKR +AV+SNDEAGTALVATN+++ 
Sbjct: 146 KDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSH 205

Query: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256
           ES G+K ++FKE+T+VG+ LH+FKV  WDESENPLIVLLR I  KI G F ETES+RV  
Sbjct: 206 ESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYS 265

Query: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316
           QFK++D  FN+ESF  HLREYI+PE+LEAY+KGDEKVLK WFSEAP+NVY+AQQKVFR+Q
Sbjct: 266 QFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQ 325

Query: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376
            LF DG ILDIR V+IVSAKLL PQD+PVLVV CRAQEI++YR +KTGEVAAG  S+ILM
Sbjct: 326 NLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILM 385

Query: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           S+YAMVFTRDPE+IDN ETEGW+ILEFVRG SRQFT
Sbjct: 386 STYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  509 bits (1311), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 239/389 (61%), Positives = 313/389 (80%), Gaps = 9/389 (2%)

Query: 29  RSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLKAQKGSTIVGK 88
           ++P+QIFRETFKQEW+KS  LQD IK L DAS ++ +SDA+KKA++AY      +TI+ K
Sbjct: 37  KTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKAKDAYKNVSNQTTILSK 96

Query: 89  TMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVYKDVSEVMES-G 147
           T+ KTG  +   A KAW+S++++ T+ A    A KLD+SFEPVR+T++YKDVSEV++   
Sbjct: 97  TISKTGTKLNDAALKAWDSDLAQKTKLA----AKKLDDSFEPVRNTKIYKDVSEVIDDKD 152

Query: 148 NSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAKESFGKKVDDFK 207
           NS +YGGFI+KE+RR K   D+ +GKR K ++SNDEAGTAL+AT++++KES  +K++DFK
Sbjct: 153 NSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIATDLKSKESINEKLNDFK 212

Query: 208 EKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMGQFKMMDGNFNS 267
           EKTVVG+ +   K K+WDE++NPLIV +R +       FAETES+RV+ QFK++D NFN+
Sbjct: 213 EKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNN 272

Query: 268 ESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDI 327
           ESFL  LREYIIPEVLEAY+KGDEK+LK WFSEAPYNVY+AQQK  R+Q +F+DGR+LDI
Sbjct: 273 ESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDI 332

Query: 328 RGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYR----DVKTGEVAAGTQSNILMSSYAMVF 383
           RGVDIV+AK+L PQD+PV+VV CRAQEI++Y+    + +T ++ AG  SNILMS+YAMVF
Sbjct: 333 RGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVF 392

Query: 384 TRDPEDIDNKETEGWKILEFVRGGSRQFT 412
           TRDPE +DN ETEGWKILEFVRGGSR+FT
Sbjct: 393 TRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>Suva_10.83 Chr10 (165557..166957) [1401 bp, 466 aa] {ON} YLR005W
           (REAL)
          Length = 466

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  VG ++    L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 170 PISQVGIIIMRNGLAQLVSQVSGNPQDHIDALKAIRKQEPKGNPSLQN---ALEMARGLL 226

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV--ERIAAKAWESEISKSTRKAVNKTA 121
               A+   RE  +     ST     + +T DS+  E+I  K        +  K + K  
Sbjct: 227 LPVPAH-CTREVLIVFGSLSTTDPGDIHQTIDSLVDEKIRVKVLGLSAQVAICKELCKAT 285

Query: 122 AKLDESF 128
              DESF
Sbjct: 286 NYGDESF 292

>Skud_12.71 Chr12 (151308..152696) [1389 bp, 462 aa] {ON} YLR005W
           (REAL)
          Length = 462

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G ++    L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 166 PISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQN---ALEMARGLL 222

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV--ERIAAKAWESEISKSTRKAVNKTA 121
               A+   RE  +     ST     + +T DS+  E+I  K        +  K + K  
Sbjct: 223 LPVPAH-CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKAT 281

Query: 122 AKLDESF 128
              DESF
Sbjct: 282 NYGDESF 288

>YLR005W Chr12 (160049..161434) [1386 bp, 461 aa] {ON}
           SSL1Component of the core form of RNA polymerase
           transcription factor TFIIH, which has both protein
           kinase and DNA-dependent ATPase/helicase activities and
           is essential for transcription and nucleotide excision
           repair; interacts with Tfb4p
          Length = 461

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G ++    L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 165 PISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQN---ALEMARGLL 221

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV--ERIAAKAWESEISKSTRKAVNKTA 121
               A+   RE  +     ST     + +T DS+  E+I  K        +  K + K  
Sbjct: 222 LPVPAH-CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKAT 280

Query: 122 AKLDESF 128
              DESF
Sbjct: 281 NYGDESF 287

>Smik_12.67 Chr12 (147119..148495) [1377 bp, 458 aa] {ON} YLR005W
           (REAL)
          Length = 458

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G ++    L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 162 PISQMGIIIMRNGLAQLVSQVSGNPQDHVDALKSIRKQEPKGNPSLQN---ALEMARGLL 218

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV--ERIAAKAWESEISKSTRKAVNKTA 121
               A+   RE  +     ST     + +T DS+  E+I  K        +  K + K  
Sbjct: 219 LPVPAH-CTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKAT 277

Query: 122 AKLDESF 128
              DESF
Sbjct: 278 NYGDESF 284

>KLTH0B02794g Chr2 (217284..218696) [1413 bp, 470 aa] {ON} highly
           similar to uniprot|Q04673 YLR005W Saccharomyces
           cerevisiae SSL1 Component of RNA polymerase
           transcription factor TFIIH
          Length = 470

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 66/188 (35%), Gaps = 37/188 (19%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G V     L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 174 PISQIGIVCMRNDLAQLVSQVSGNPQDHIDALKAIRKQEPKGNSSLQN---ALEMARGLL 230

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV-ERI--------AAKAWESEISKSTR 114
               A+       +     ST  G   +     V ERI        A  A   E+ K T 
Sbjct: 231 LHVPAHCTREVLIIFGALSSTDPGDIHQTIASLVQERIRVRVIGLSAQVAICKELCKQTN 290

Query: 115 KAVNK----------------------TAAKLDESFEPVRH---TRVYKDVSEVMESGNS 149
              N                          K+++ F  V+    TRVY+D+       + 
Sbjct: 291 YGDNSFYGVILNEVHFKDLFAEAVTPLPVNKINKGFTLVKMGFPTRVYEDMPSFCTCHSK 350

Query: 150 SRYGGFIT 157
             YGG+  
Sbjct: 351 LMYGGYFC 358

>KNAG0B05150 Chr2 complement(987516..988925) [1410 bp, 469 aa] {ON}
           Anc_5.226 YLR005W
          Length = 469

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 54/130 (41%), Gaps = 12/130 (9%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G V+    L+  + +  GNP+  L   +   KQE K +  LQ+   AL+ A G L
Sbjct: 174 PISQIGIVIMRNGLAHLVSSVSGNPQDHLDALKHMRKQEPKGNPSLQN---ALELARGLL 230

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV-ERIAAKAWESEISKSTRKAVNKTAA 122
               ++       +     ST  G   +     V E+I  K     I  S + AV K   
Sbjct: 231 LPVPSHSTREVLIIFGSLSSTDPGDIHQTIASLVDEKIRVKV----IGLSAQVAVCKELC 286

Query: 123 KL----DESF 128
           KL    D+SF
Sbjct: 287 KLTNFGDDSF 296

>Kwal_33.15246 s33 complement(1030094..1031503) [1410 bp, 469 aa]
           {ON} YLR005W (SSL1) - Component of RNA polymerase
           transcription factor TFIIH [contig 94] FULL
          Length = 469

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 66/188 (35%), Gaps = 37/188 (19%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G V     L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 174 PISQIGIVCMRNDLAQLVSQVSGNPQDHIDALKAIRKQEPKGNSSLQN---ALEMARGLL 230

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV-ERI--------AAKAWESEISKSTR 114
               A+       +     ST  G   +     V ERI        A  A   E+ K T 
Sbjct: 231 LHVPAHCTREVLIVFGALSSTDPGDIHQTMSSLVQERIRVRVIGLSAQVAVCKELCKQTN 290

Query: 115 KAVNK----------------------TAAKLDESFEPVRH---TRVYKDVSEVMESGNS 149
              N                          K+++ F  V+    TRVY+D+       + 
Sbjct: 291 YGDNSFYGVILNEVHFKDLFTEAVTPLPVNKINKGFTLVKMGFPTRVYEDMPSFCTCHSK 350

Query: 150 SRYGGFIT 157
             YGG+  
Sbjct: 351 LMYGGYFC 358

>KLLA0E09615g Chr5 (851587..853053) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q04673 YLR005W Saccharomyces cerevisiae SSL1
           Component of RNA polymerase transcription factor TFIIH
          Length = 488

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 50/126 (39%), Gaps = 4/126 (3%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G VV    L+Q I    GNP+  +   +   +QE K +  LQ+   AL+ A G L
Sbjct: 189 PISQIGVVVMRDGLAQLISQVSGNPQEHIDALKMLRRQEPKGNASLQN---ALEMARGLL 245

Query: 64  GESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSV-ERIAAKAWESEISKSTRKAVNKTAA 122
               A+       +     +T  G   +  G  V E I AK        S  K + K   
Sbjct: 246 LHVPAHCTREVLIVFGALSTTDPGDIHQTIGSLVHENIRAKVIGLSAQVSVCKELCKQTN 305

Query: 123 KLDESF 128
             D S+
Sbjct: 306 YGDNSY 311

>KAFR0J00710 Chr10 complement(129877..131286) [1410 bp, 469 aa] {ON}
           Anc_5.226 YLR005W
          Length = 469

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 4   PVRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKL 63
           P+  +G V+    L+Q +    GNP+  +   +   KQE K +  LQ+   AL+ A G L
Sbjct: 173 PISQIGIVIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQN---ALEMARGLL 229

>NCAS0B04180 Chr2 (753256..754053) [798 bp, 265 aa] {ON} Anc_8.203
           YDR078C
          Length = 265

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 35  FRETFKQEWKKSQELQDN-IKALQDAS----GKLGESDAYKKAREAYLKAQKG 82
           F E F +E KK +EL +  IK + D S     K  + DA+  +R+ Y K  K 
Sbjct: 164 FNELFHEELKKGEELSNCLIKEIDDMSEFSNDKFSQLDAHSLSRQKYFKFDKC 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,969,431
Number of extensions: 1731036
Number of successful extensions: 6272
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6530
Number of HSP's successfully gapped: 81
Length of query: 412
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 300
Effective length of database: 40,638,807
Effective search space: 12191642100
Effective search space used: 12191642100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)