Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.19721na 1ON57757728680.0
KLTH0E01144gna 1ON57256825170.0
SAKL0E14806gna 1ON57857723080.0
KLLA0E12959gna 1ON57957721470.0
KLTH0B08140gna 2ON56856414510.0
KLTH0G10736gsingletonON56854214460.0
ZYRO0G01474gsingletonON57255614390.0
KLLA0E14675gsingletonON57356814300.0
Kwal_23.4458na 2ON56554514210.0
SAKL0D01232gna 3ON57457014090.0
SAKL0G14762gsingletonON56556413920.0
Kwal_0.16singletonON56455713920.0
KLLA0E24993gsingletonON56856813890.0
SAKL0G15136g5.112ON56955613840.0
NDAI0C031505.112ON57457713810.0
NCAS0D016005.112ON57657813770.0
KNAG0K01030singletonON58154213780.0
Suva_4.38na 4ON57157313760.0
ZYRO0B15048gsingletonON58258013740.0
Smik_4.30na 4ON57157313700.0
YDL210W (UGA4)na 4ON57157313690.0
KNAG0E008205.112ON57153713690.0
TDEL0G013705.112ON56957113560.0
Skud_4.46na 4ON57157013071e-174
ABL116Cna 3ON54451411891e-157
Ecym_4621na 3ON57253511571e-152
SAKL0A04730g6.205ON5415133694e-37
Suva_7.1936.205ON5635483404e-33
AFL081W6.205ON5424713385e-33
Ecym_22126.205ON5454783332e-32
YGL077C (HNM1)6.205ON5635763342e-32
Skud_7.2056.205ON5625573324e-32
KAFR0K003606.205ON5385243289e-32
KLTH0H04444g6.205ON5324973217e-31
TPHA0E029206.205ON5864853237e-31
ZYRO0G08602g6.205ON5695123192e-30
TDEL0G014106.205ON5535283164e-30
Kpol_1033.416.205ON5865013166e-30
NCAS0D037506.205ON5694843157e-30
Smik_7.2066.205ON5635563148e-30
TBLA0A019606.205ON5945533103e-29
CAGL0H03399g6.205ON5564803076e-29
KNAG0D051406.205ON5435263051e-28
NDAI0I011406.205ON6005162927e-27
KLLA0C15521g6.205ON5475262908e-27
TBLA0C057401.173ON6595292607e-23
Kwal_56.240096.205ON3423282378e-21
KLTH0F04576g1.173ON5495252285e-19
CAGL0M08272g1.173ON6215402242e-18
KLLA0A06666g1.173ON5604962143e-17
SAKL0C05126g1.173ON5685062143e-17
TPHA0E033501.173ON6475332125e-17
Kwal_33.138061.173ON5495252063e-16
NCAS0B083501.173ON6125162037e-16
ZYRO0G18700g1.173ON5915401965e-15
KNAG0C009801.173ON7145401931e-14
Kpol_2002.701.173ON6225151912e-14
TDEL0G021201.173ON5935291903e-14
Ecym_81051.173ON5833831884e-14
NDAI0A008901.173ON6415291787e-13
ZYRO0F00242gsingletonON5354871742e-12
Skud_11.511.173ON6165021643e-11
Suva_11.491.173ON6195021635e-11
KAFR0G003901.173ON6075311635e-11
YKL174C (TPO5)1.173ON6185101591e-10
AEL125C1.173ON5753811528e-10
Kwal_55.19602na 5ON5584781492e-09
Smik_11.551.173ON6195021474e-09
Smik_14.390na 5ON5543901367e-08
YNR056C (BIO5)na 5ON5613941351e-07
Skud_14.392na 5ON5313871332e-07
Suva_14.415na 5ON5323511313e-07
TDEL0G04830singletonON5432331215e-06
Kthe_YGOB_SAKL0H11484gna 5ON5563401162e-05
SAKL0H11484gna 5ON5605681135e-05
CAGL0A01199gna 6ON613373990.002
KLLA0B00385gna 5ON564351880.043
NDAI0A01340singletonON554125880.050
CAGL0E05632g7.44ON598298870.054
Smik_6.482na 7ON558153870.056
Suva_13.517singletonON547159840.12
KAFR0A062504.195ON575320840.13
ZYRO0G07172gna 8ON567391840.13
KAFR0D007001.83ON574160840.15
NCAS0J011804.195ON585210830.21
KLTH0A00308gsingletonON541111820.21
Skud_16.2na 7ON496208820.22
NCAS0J00140na 9ON558125800.41
KNAG0L00110na 9ON571144800.43
TBLA0A054501.83ON606138800.46
AFR667C1.84ON563109790.52
CAGL0M00154gsingletonON550158790.58
ZYRO0D03762g1.244ON60036780.67
KLLA0A06886gsingletonON587134780.75
TDEL0E05750singletonON548305780.79
CAGL0J08184g1.83ON572166780.79
KLTH0E11792gna 10ON804295780.83
Ecym_60211.244ON60092761.2
Kwal_YGOB_27.11900na 10ON801251761.2
KAFR0D039401.83ON597113761.4
Kwal_27.11900singletonOFF726251761.4
Kpol_543.791.244ON60536751.8
Smik_14.671.83ON573443741.9
Ecym_7299na 11ON54962741.9
Kpol_543.78singletonON60536742.2
KLLA0C15873g3.397ON568210742.3
NCAS0B033808.342ON845143742.6
KAFR0F02250singletonON554164732.6
Ecym_80357.44ON563426732.6
KLLA0A06930g1.244ON58775732.6
Skud_14.701.83ON573340733.1
Ecym_10871.83ON570420733.2
SAKL0G14916gna 6ON581275723.5
AFR668W1.83ON556223723.8
ZYRO0F17446g1.50ON633128723.9
NDAI0J019304.195ON590309714.4
KNAG0C007901.83ON579141715.4
TDEL0F02830na 8ON561123706.2
TPHA0A025001.368ON590224706.3
Kwal_33.154075.158ON587127706.3
NDAI0G060301.368ON599131706.7
TPHA0G03770singletonON60498707.1
Kpol_2000.641.84ON610130698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19721
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...  1109   0.0  
KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...   974   0.0  
SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...   893   0.0  
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...   831   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   563   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   561   0.0  
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   558   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   555   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   551   0.0  
SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...   547   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   540   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   540   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   539   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   537   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   536   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    535   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   535   0.0  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   534   0.0  
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   533   0.0  
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   532   0.0  
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   531   0.0  
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    531   0.0  
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    526   0.0  
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   508   e-174
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   462   e-157
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...   450   e-152
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   146   4e-37
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   135   4e-33
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   134   5e-33
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   132   2e-32
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   133   2e-32
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   132   4e-32
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...   130   9e-32
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   128   7e-31
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   129   7e-31
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   127   2e-30
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   126   4e-30
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   126   6e-30
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   125   7e-30
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   125   8e-30
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   124   3e-29
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   122   6e-29
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   122   1e-28
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    117   7e-27
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   116   8e-27
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...   104   7e-23
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...    96   8e-21
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    92   5e-19
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    91   2e-18
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    87   3e-17
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    87   3e-17
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    86   5e-17
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    84   3e-16
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    83   7e-16
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    80   5e-15
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    79   1e-14
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    78   2e-14
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    78   3e-14
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    77   4e-14
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    73   7e-13
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    72   2e-12
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    68   3e-11
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    67   5e-11
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    67   5e-11
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    66   1e-10
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    63   8e-10
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    62   2e-09
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    61   4e-09
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    57   7e-08
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    57   1e-07
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    56   2e-07
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    55   3e-07
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    51   5e-06
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    49   2e-05
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    48   5e-05
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...    43   0.002
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    39   0.043
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}               39   0.050
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...    38   0.054
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...    38   0.056
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...    37   0.12 
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    37   0.13 
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...    37   0.13 
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...    37   0.15 
NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4....    37   0.21 
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...    36   0.21 
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...    36   0.22 
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}       35   0.41 
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...    35   0.43 
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...    35   0.46 
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...    35   0.52 
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...    35   0.58 
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...    35   0.67 
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...    35   0.75 
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}             35   0.79 
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...    35   0.79 
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...    35   0.83 
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...    34   1.2  
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...    34   1.2  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...    34   1.4  
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...    34   1.4  
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...    33   1.8  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...    33   1.9  
Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar t...    33   1.9  
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...    33   2.2  
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...    33   2.3  
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...    33   2.6  
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}               33   2.6  
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...    33   2.6  
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...    33   2.6  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...    33   3.1  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...    33   3.2  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...    32   3.5  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...    32   3.8  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...    32   3.9  
NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4....    32   4.4  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}               32   5.4  
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...    32   6.2  
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...    32   6.3  
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...    32   6.3  
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...    32   6.7  
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...    32   7.1  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...    31   8.4  

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/577 (94%), Positives = 548/577 (94%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA
Sbjct: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI
Sbjct: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240
           LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI
Sbjct: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240

Query: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300
           AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA
Sbjct: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300

Query: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360
           EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL
Sbjct: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360

Query: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
           GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV
Sbjct: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
           W              VGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD
Sbjct: 421 WGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480

Query: 481 VWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY 540
           VWSPIINW               PSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY
Sbjct: 481 VWSPIINWIAVFAQAFMIIMMMFPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY 540

Query: 541 QGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV 577
           QGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV
Sbjct: 541 QGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV 577

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/568 (83%), Positives = 509/568 (89%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYK 65
           MSASSS   TIKNRKS+V+VEVGQ+REL TITSAHGAPIRFVDARSATSD+QVLAELGYK
Sbjct: 1   MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYK 60

Query: 66  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALA 125
           EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGL+LTIGIAL 
Sbjct: 61  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLILTIGIALG 120

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS++PTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSL ASVCSIVYGLAQQILSAVL
Sbjct: 121 ELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVL 180

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245
           VSNP FN T+PITYGVFAACI+ M ILTS+P++ TS++QTISI+SN FLI+LFFIA+PIG
Sbjct: 181 VSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIG 240

Query: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305
           VSRSD L R FN G FIFG+ DN S+WNKGWNWCIAG+MPAIWTIGAYDSCLHMAEEARD
Sbjct: 241 VSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARD 300

Query: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWT 365
           AVRAVPFGIVGSI+VCWI+GWL+CIV+LACM+P+ID+VL+S+FGQ MTQIIYDALGKRWT
Sbjct: 301 AVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWT 360

Query: 366 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXX 425
           LGFLSIFIICQFLMGASTVVANSRQFWAFARDDG PFSNFFKKV   TGVPVRAVW    
Sbjct: 361 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWGSSA 420

Query: 426 XXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPI 485
                     VGE ASGALFSLSVAGMYMALIFPITLRLTYGK+DFRPGPFYLGD WSPI
Sbjct: 421 LSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPI 480

Query: 486 INWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKS 545
           INW               PSD+TV P+TMNYTVVIGPGFWVLSLIYYFVWQRKFY+GPKS
Sbjct: 481 INWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKS 540

Query: 546 NLTDEEFQEYVGEDVIDAIISNNVATQK 573
           NLTDEEFQEYVG+DVIDAI+SNN A  K
Sbjct: 541 NLTDEEFQEYVGDDVIDAIMSNNEADYK 568

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/577 (74%), Positives = 484/577 (83%), Gaps = 1/577 (0%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           M    MS SSS  D I  RKSNV++ VG V ELR+ITSAHGAPIR++DA++ATSD+QVLA
Sbjct: 1   MATGYMSTSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLA 60

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           E+GYKEELKREFS++QIFGVAFSIMGLLPSIAST+DGGL AGPVGL WGWF+AGGL+LT+
Sbjct: 61  EIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTV 120

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GIALAELSSSIPTAGAVYVSCYQWAP R RK ISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240
           LSAV+VSNP F VT+PITYGVFAAC+IAM +LTS+ + FTS++QTISIVSN FLIILFFI
Sbjct: 181 LSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFI 240

Query: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300
           A+PIGVSRSDKL   FN+  FIFGK++N + WN GW+WCI G+ PAIWTIGAYDSCLHMA
Sbjct: 241 ALPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMA 300

Query: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360
           EEARDAVRAVP GIVGSI+ CWI+GWLICIVLLACMDP+++N++NS +GQG+TQ+ YDAL
Sbjct: 301 EEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDAL 360

Query: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
           GKRWTL FLS  IICQFLMGASTVVANSRQFWAFARDD +PFSNFFKKV+ +  VP+RAV
Sbjct: 361 GKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAV 420

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
           W               GE A+ ALFSLS+AGMYMALIFPITLRLTYGK+DFRPGPFY+GD
Sbjct: 421 WGSSILSLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGD 480

Query: 481 VWSPIINWXXXXXXXXXXXXXXXP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKF 539
            WSPIINW               P     +D  TMNYTVVIGPGFWVLSLIYY+ WQ KF
Sbjct: 481 FWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKF 540

Query: 540 YQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRM 576
           Y+GPKSNL+DEEF E VG+DV+DAI+S+NV    DR+
Sbjct: 541 YEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRL 577

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/577 (69%), Positives = 467/577 (80%), Gaps = 4/577 (0%)

Query: 2   DGNLMSASSSAMDTIKNRK-SNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           D   MS SS A++ + NR  SN E+  G V ELR +TSAHGAPIR++DA SATSD QVLA
Sbjct: 4   DQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLA 63

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           E+GYKEELKRE+S++QIFGVAFSIMGLLPSIAST+DGGL+AG VGL WGWF+AGGL+L++
Sbjct: 64  EIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSV 123

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GIAL ELSSSIPTAGAVYV+CYQWAP++ RKCISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 124 GIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 183

Query: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240
           LSAV+V NP F VT+PITYGVF ACI+A+T+LTSM +K T+R+QT SI++NVFLIILFFI
Sbjct: 184 LSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIILFFI 243

Query: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300
            +PIGVSRSDK+   FN   +IFG   NL+ WN GW+WCI G+ PAIWTIGAYDSCLHMA
Sbjct: 244 VLPIGVSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMA 301

Query: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360
           EEA+DA RAVP GIV SIS CWI+GWLICIV+LACM+P+++ ++NS +GQG+TQ+  DAL
Sbjct: 302 EEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDAL 361

Query: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
           GKRWTL FLS+ IICQFLMGASTV+ANSRQFWAFARDDGIPFS FFKKV   + VP+R++
Sbjct: 362 GKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSI 421

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
           W               G+ A+ ALFSLS+AGMYMAL+FPI LRLTYG++DFRPGPFYLG 
Sbjct: 422 WGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGH 481

Query: 481 VWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKF 539
            WS    W               P D + +   TMNYTVVIGPGFWVLSLIYYFVWQRKF
Sbjct: 482 FWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKF 541

Query: 540 YQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRM 576
           Y+GPKSNLTDEEF E VGED IDA++SN     +D++
Sbjct: 542 YEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKL 578

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/564 (49%), Positives = 388/564 (68%), Gaps = 7/564 (1%)

Query: 10  SSAMDTIKNRKSNVEVEVG---QVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKE 66
           + A+    +  S++E  VG   Q+  LRTITS     + F+DA+ A  D ++LAE+GYK+
Sbjct: 4   AQAVANSTDVSSSLEQAVGDIHQIGSLRTITSKRAGEVNFIDAKRAHGDAELLAEIGYKQ 63

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAE 126
           EL R FS++Q+FGVAFSIMGLLPSIAS L  G+  G V L WGWFIAG  +L +G  ++E
Sbjct: 64  ELNRHFSTVQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLVWGWFIAGIFILAVGCGMSE 123

Query: 127 LSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLV 186
           L+S+IPT+G +Y   Y +APQ+ +   S+ +G+ ++L+L + +CSI YGLA++ILS V+V
Sbjct: 124 LASAIPTSGGLYYYTYYYAPQKYKAFFSFVIGYSNSLALVSGLCSITYGLAEEILSIVVV 183

Query: 187 S-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245
           S +  F +TN  TYGVF A I A T++TS+ T   S++QT+SI++NV LI+LFFI +PIG
Sbjct: 184 SKDGDFTITNGKTYGVFVAGIAATTVVTSIATVAVSKLQTVSILANVGLIVLFFIVLPIG 243

Query: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305
           V+ +   G  FNDG FIFGK  N ++W  GW + +AG+ PAIWTIGA+DSC+HM+EEA++
Sbjct: 244 VANTK--GLDFNDGSFIFGKWLNETTWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEAKN 301

Query: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWT 365
           A +AVP GI+ SISVCWI+G+LICIV+ ACM P+ID +L S FG  + QI+Y+ALGK+WT
Sbjct: 302 ATKAVPLGIISSISVCWILGFLICIVMAACMGPDIDAILGSSFGSPLPQILYNALGKKWT 361

Query: 366 LGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXX 425
           +  +++   CQFLMG S + A SRQ WAFARDDG+ FS + K V+     P+RA W    
Sbjct: 362 IAIMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFSKYIKVVNKKLSSPLRATWFGAV 421

Query: 426 XXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPI 485
                     +G  AS ALFSL + G Y+A + P  LR+T GK  FRPG FY+G  WSPI
Sbjct: 422 CALVIGLLCLIGGTASNALFSLGIGGNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWSPI 481

Query: 486 INWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPK 544
           +NW               P+++  + P  MNYTVVI  G W+ S+IY+FV+++K + GPK
Sbjct: 482 VNWTAIVFQIFILIMIMFPAESKGITPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPK 541

Query: 545 SNLTDEEFQEYVGEDVIDAIISNN 568
           SNL+D+E+ + VG+DVID I+S+ 
Sbjct: 542 SNLSDDEYVDAVGQDVIDQILSHQ 565

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/542 (50%), Positives = 379/542 (69%), Gaps = 4/542 (0%)

Query: 29  QVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLL 88
           Q   LRTITS     + F+DA+ A  D ++LAE+GYK+EL R FS+IQ+FGVAFSIMGLL
Sbjct: 26  QFGSLRTITSKRAGEVNFIDAKGANGDSELLAEIGYKQELNRHFSTIQVFGVAFSIMGLL 85

Query: 89  PSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQR 148
           PSIAS L  G+  G V L WGW IAG  +L +G  +AEL+S+IPT+G +Y   Y ++P++
Sbjct: 86  PSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGCGMAELASAIPTSGGLYYYTYYYSPEK 145

Query: 149 VRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFNVTNPITYGVFAACII 207
            +  +S+ +G  ++L+L A +CSI YGLAQ+ILS V+V+ +  FN+T+  TYGVF A I 
Sbjct: 146 YKAFLSFVIGNTNSLALVAGLCSITYGLAQEILSIVVVAKDGDFNITSGKTYGVFVAGIA 205

Query: 208 AMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKND 267
           A T +TS+ T   S++QT+SI++NV LI+LFFI +PIGV+ +   G +FNDG FIFGK  
Sbjct: 206 ATTAVTSLATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTK--GLNFNDGSFIFGKWQ 263

Query: 268 NLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWL 327
           N +SW  GW + +AG+ PAIWTIGA+DSC+HM+EEA++A +AVP GI+ SI VCWI+G++
Sbjct: 264 NETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPVGIISSIGVCWILGFI 323

Query: 328 ICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVAN 387
           +CIV+ ACM PNID +L S +G  + QI+++ALGK+WT+ F+++   CQFLMG S + A 
Sbjct: 324 VCIVIAACMGPNIDAILESSYGSPLPQILFNALGKKWTIAFMTLIAACQFLMGCSILTAI 383

Query: 388 SRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSL 447
           SRQ WAFARDDG+ FS + K V+     P+RA W              +G  AS ALFSL
Sbjct: 384 SRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFGALCALVIGLLCLIGSTASNALFSL 443

Query: 448 SVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDA 507
           ++ G Y+A + P  LR+T GK  FRPG F++G +WSPI+NW               P+D+
Sbjct: 444 AIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWSPIVNWIAIIFQTFILIMIMFPADS 503

Query: 508 T-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIIS 566
             + P TMNYTVVI  G W+ S++Y+ V+++K + GPKSNL+DEE+ + VG+DVID I+S
Sbjct: 504 KDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHGPKSNLSDEEYADAVGQDVIDQILS 563

Query: 567 NN 568
           + 
Sbjct: 564 HQ 565

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/556 (49%), Positives = 391/556 (70%), Gaps = 9/556 (1%)

Query: 20  KSNVEV--EVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQI 77
           K +V+V    G++R +R+ T A    + +++A ++  D Q+LAE+GYK EL+R+FS++Q+
Sbjct: 17  KGDVQVYTSAGRIRSIRSRTGA--GEVNYINAATSNDDNQLLAEIGYKPELERKFSTLQV 74

Query: 78  FGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAV 137
           FG+AFSIMGLLPSIAS LD GL+ GPV   WGWFIAG  +  +G+ +AE SS+IPTAG +
Sbjct: 75  FGIAFSIMGLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMAENSSAIPTAGGL 134

Query: 138 YVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFNVTNP 196
           Y   Y +AP+  +  IS+ +G  ++L+L A VCSI YG A+++L+AV+VS + ++++T  
Sbjct: 135 YFWTYHYAPEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVVVSKDGNWDITQG 194

Query: 197 ITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHF 256
             YGV+A C+I   ++T + + + ++MQ+ISI SN+F+I+LF IA+PIG ++ ++ G  F
Sbjct: 195 KLYGVYAGCVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPIG-TKVNRGG--F 251

Query: 257 NDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVG 316
           NDG FIFGK +NLS W+ GW + +AG  P +WTI ++DSC+H AEEA+DA +AVP GI+G
Sbjct: 252 NDGSFIFGKFENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEAKDASKAVPIGIMG 311

Query: 317 SISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ 376
           SI VCWI+GW+I IVL+AC+D +++ V+NS +  GM QII+D+LGK WT+ FL++   CQ
Sbjct: 312 SIFVCWILGWVINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKNWTIAFLALMAFCQ 371

Query: 377 FLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXV 436
           FLMGAS++ A SRQ WAFARDDG+P SN  KKV +   VP  A                +
Sbjct: 372 FLMGASSMTAASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICSGLMSLVLGLLILI 431

Query: 437 GEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXX 496
            +AA+ ALFSL++AG Y+A + P  LRLT+G+  FRPGPFYLG  WSP++NW        
Sbjct: 432 DDAAAEALFSLAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAF 491

Query: 497 XXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEY 555
                  P+    ++   MNY  VIGPG W+LSLIYY+V+++K Y GPKSNL DEE+ + 
Sbjct: 492 IIIMVMFPTQKNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKSNLDDEEYADA 551

Query: 556 VGEDVIDAIISNNVAT 571
           VG +V+DAI+S + +T
Sbjct: 552 VGPEVLDAILSTDYST 567

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/568 (48%), Positives = 383/568 (67%), Gaps = 7/568 (1%)

Query: 6   MSASSSAMDTIKN---RKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAEL 62
           MS S S++    N       V+  V  V  LRTITS     + +++A++A  D ++LAE+
Sbjct: 1   MSDSVSSLSDKNNFVITSQEVKNRVDVVTSLRTITSRRVGDVNYINAKTAHDDTELLAEI 60

Query: 63  GYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGI 122
           GYK+EL+R FS  Q+FGVAFSIMGLLPSIAS L   L  G V L WGW I+G  VL  G+
Sbjct: 61  GYKQELQRHFSKTQVFGVAFSIMGLLPSIASILGVALPGGSVSLVWGWAISGAFVLANGL 120

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
           A++EL+S+IPT+G +Y   + +AP +V+  +S+ VG  ++L+L + +CSI YGLA +ILS
Sbjct: 121 AMSELASAIPTSGGLYYYTHYYAPPKVKNFLSFIVGNCNSLALISCLCSINYGLAGEILS 180

Query: 183 AVLV-SNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIA 241
            V+V SN +FN+TN  TYGV+AACIIA  ++TS+ T   SR+QT SIVSN+ LI +FF+ 
Sbjct: 181 IVVVGSNGNFNITNANTYGVYAACIIATAVVTSVATTAVSRLQTFSIVSNLLLICIFFVV 240

Query: 242 VPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAE 301
           +P+GV+RS  +   FND  +IFG  +NLS WN GW + +AG  P IW IG +DSCLHM+E
Sbjct: 241 LPVGVARSKDM--EFNDAAYIFGDFENLSDWNNGWQFMLAGFQPLIWVIGGFDSCLHMSE 298

Query: 302 EARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALG 361
           EA++A  +VPFGI+GSISVCW +G+ ICIV+ AC   ++  ++N++F Q + Q+++DALG
Sbjct: 299 EAKNATASVPFGIIGSISVCWFLGFFICIVIAACSSQDVAALVNTKFHQPLAQVLFDALG 358

Query: 362 KRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVW 421
           K+WT+  +++   CQFLM AS++ A SRQ WAFARDDG+PFS++ K V+     P+RA W
Sbjct: 359 KKWTIAIMTLIAFCQFLMAASSLTAISRQIWAFARDDGLPFSSWIKVVNVKLSSPLRATW 418

Query: 422 XXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDV 481
                         +G  AS ALFSL ++  Y + + P  LR+TYGK  F PG F++G  
Sbjct: 419 VGAGVALAIGCLCLIGPVASSALFSLYISANYFSWMLPNLLRMTYGKDVFTPGAFFMGKY 478

Query: 482 WSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY 540
            SP++NW               P++   + P TMNY+VV     W L+ IYYF+++ KFY
Sbjct: 479 LSPVVNWISIIFELFMILLVFFPTEQHGITPDTMNYSVVFIGAVWFLATIYYFIYKHKFY 538

Query: 541 QGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           +GPKSNLTDEE++E VG+DV+DAI+S +
Sbjct: 539 KGPKSNLTDEEYEENVGQDVLDAILSKS 566

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/545 (51%), Positives = 373/545 (68%), Gaps = 4/545 (0%)

Query: 26  EVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIM 85
           E+ Q+  LRTITS     + F+DA+ A  DK++LAE+GYK+EL R FS++Q+FGVAFSIM
Sbjct: 20  EIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELNRHFSTVQVFGVAFSIM 79

Query: 86  GLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWA 145
           GLLPSIAS L  G + G V L WGW IAG  ++TIG+++AEL+S+IPT+G +Y   Y +A
Sbjct: 80  GLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELASAIPTSGGLYYYTYYYA 139

Query: 146 PQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFNVTNPITYGVFAA 204
           PQR +  +S+ +G  ++L+L A +CSI YGLA +ILS V+VS + +F +TN  TYGV+  
Sbjct: 140 PQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKDGNFEITNGKTYGVYVG 199

Query: 205 CIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFG 264
            I A  ++TS+ T   S+MQT+SI+SNV LI  F I +PIGVS +   G  FNDG FIFG
Sbjct: 200 GIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSNTK--GLEFNDGSFIFG 257

Query: 265 KNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIV 324
           K  N +SW  GW + +AG+ PAIWTIGA+DSC+HM+EEA++A +AVP GI+ SI VCW++
Sbjct: 258 KFMNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPIGIISSIFVCWVL 317

Query: 325 GWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTV 384
           G+ ICI + ACM P+ID +L S FG  + QI+Y+ALGK+WT+ F+S+   CQF MG S +
Sbjct: 318 GFFICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITFMSLIAFCQFAMGCSIL 377

Query: 385 VANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGAL 444
            A SRQ WAFARDDG+ F  +FK V+     P+RA W              +G  A+ AL
Sbjct: 378 TAISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACALVIGLLCLIGGTAANAL 437

Query: 445 FSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXP 504
           FSL + G Y+A + P  LR+T GK  FRPG F++G+ WSPI+NW               P
Sbjct: 438 FSLGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNWTSIVFQIFIIFMIMFP 497

Query: 505 SDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDA 563
           ++   + P TMNYTVVI  G W  S+IYY V++ K + GPKSNLTDEEF E VG+DVID 
Sbjct: 498 AEKVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNLTDEEFSEVVGQDVIDQ 557

Query: 564 IISNN 568
           I+S+ 
Sbjct: 558 ILSHQ 562

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/570 (47%), Positives = 379/570 (66%), Gaps = 6/570 (1%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           ++ N +  S+  +  I +  +N EV+  Q+  LRTITS     + +++A++A  D ++LA
Sbjct: 8   VEKNQIKTSARELHPIVSANANGEVQ--QITSLRTITSKRAGEVNYINAKAAHDDTELLA 65

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           E+GYK+EL R FS+IQ+FG+AFSIMGLLPSIAS L    + G + L WGW I+G  +L++
Sbjct: 66  EIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSV 125

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           G  +AEL+S+IPT+G +Y   Y +AP + +K +S+ +G  ++L+L A +CSI YGLAQ+I
Sbjct: 126 GAGMAELASAIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEI 185

Query: 181 LSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239
           LS V++S +  F +TN  TYGV+A CIIA T+LTS+ T   S++QT SIVSNV LII F 
Sbjct: 186 LSIVVISKDGDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLLIIFFL 245

Query: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHM 299
           I +PIGVS+SD +   FN G FIFG  +N   W  GW + +AG  P +W IGA+DSC+HM
Sbjct: 246 IVLPIGVSQSDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHM 303

Query: 300 AEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDA 359
           +EEA++A +AVP GI+ SISVCWIVG+ I I ++ACM  NI  +L++ +GQ + QI+Y+A
Sbjct: 304 SEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNA 363

Query: 360 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRA 419
           LGK+W + F+++   CQF+MGAST+ A SRQ WAFARDDG+PFS + KKV+     P+RA
Sbjct: 364 LGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRA 423

Query: 420 VWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLG 479
            W              +G  AS ALFS+ +A  Y A + P  LR+T GK  F PG FY+G
Sbjct: 424 TWFGGAGALCIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMG 483

Query: 480 DVWSPIINWXXXXXXXXXXXXXXXP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538
           + WSP+INW               P S   +   TMNYT V     W  S+ YY+ ++ +
Sbjct: 484 NFWSPVINWTSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHR 543

Query: 539 FYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
            + GPKSNLTD+EF + VG+DVID I+SN 
Sbjct: 544 TFHGPKSNLTDDEFVDAVGQDVIDEILSNQ 573

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/564 (51%), Positives = 394/564 (69%), Gaps = 7/564 (1%)

Query: 13  MDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREF 72
           M T K   S    E+  +R +R+ T A    + +++A +A  D Q+LAE+GYK+ELKR+F
Sbjct: 1   MSTDKLANSLSIQEIAALRSVRSRTGA--GEVNYINAATANDDNQLLAEIGYKQELKRQF 58

Query: 73  SSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIP 132
           S++Q+FG+AFSIMGLLPSIAS + GGLS GPV L WGWFIAG  +L IG+++AE +S+IP
Sbjct: 59  STLQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIP 118

Query: 133 TAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSF 191
           TAG ++   + +AP+  +  IS+ +G  ++L+L + +CSI YGLAQ+IL+AV++S +  F
Sbjct: 119 TAGGLFYWTHYYAPEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDF 178

Query: 192 NVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDK 251
            VT+  TYGVFAA ++   + T + +   SR+QT SIV+N F+IIL FIA+PIG  R+  
Sbjct: 179 EVTSGKTYGVFAAAVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIGTKRN-- 236

Query: 252 LGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVP 311
           +G  FND  +IFGK +N S WN GW++C+ G MP IWTIGA+DSC+H +EEA+DA +AVP
Sbjct: 237 MG-GFNDASYIFGKFENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVP 295

Query: 312 FGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSI 371
            GI+GSI+VCWI+GWLI IVL+AC+DP+++ VL++ +G  + QI+Y++LGK W + F+S+
Sbjct: 296 IGIIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSL 355

Query: 372 FIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXX 431
             +CQFLMGAS + A SRQ WAFARDDG+P S + K V     VP+ AVW          
Sbjct: 356 IAVCQFLMGASVLTALSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLG 415

Query: 432 XXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXX 491
               +  AA+ ALFSL+VAG Y++   P  LRLT+GK  FRPGPFYLG  WSPIINW   
Sbjct: 416 LLCLIDAAAASALFSLAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSV 475

Query: 492 XXXXXXXXXXXXP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDE 550
                       P S   VD STMNY  VIGPG W+L+ IYY ++++K+Y GPKSNLTDE
Sbjct: 476 IFQAFIIILVMFPASQHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDE 535

Query: 551 EFQEYVGEDVIDAIISNNVATQKD 574
           E+ E VG +VID I+SN   T KD
Sbjct: 536 EYVEAVGSNVIDEILSNTERTSKD 559

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/557 (46%), Positives = 375/557 (67%), Gaps = 4/557 (0%)

Query: 14  DTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFS 73
           +  +    N   E+ + R LRTITS     + +++A++A  D ++LAE+GYK+EL R FS
Sbjct: 10  EITREFSPNAVGEIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQELSRHFS 69

Query: 74  SIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
           ++Q+FG+AFSIMGLLPSIAS L      G V   WGW I+G  VL IG +++EL+S+IPT
Sbjct: 70  TLQVFGIAFSIMGLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSELASAIPT 129

Query: 134 AGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFN 192
           +G +Y   Y +AP+R +  +S+ +G  +TL+L A +CS+ YG AQ++L+ V++S + +F 
Sbjct: 130 SGGLYYYTYYYAPKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVISKDGNFE 189

Query: 193 VTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKL 252
           +TN + YGV+AA I+A  ++TS+ T   SR+QT+SIVSN+ LI  F I +PIGVS++  L
Sbjct: 190 LTNGMIYGVYAAGIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIGVSKTKWL 249

Query: 253 GRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPF 312
              FNDG FIFG   N ++W  GW + + G  PA+WTIGA+DSC+HM+EEA++A +AVP 
Sbjct: 250 --DFNDGSFIFGNWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNATKAVPA 307

Query: 313 GIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIF 372
           GI+GSISVCW+VG+ ICI + ACM P+ID +L+S +G  + QI+Y+ALGK+WT+ F+++ 
Sbjct: 308 GILGSISVCWVVGFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMAFMTLI 367

Query: 373 IICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXX 432
             CQF+MG S + A SRQ WAFARDDG+ FS   K V+     P+RA W           
Sbjct: 368 AFCQFVMGCSILTAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGALVIGL 427

Query: 433 XXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXX 492
              +G  AS ALFS+ +A  Y++ + P  LR+T GK  F+PG FY+GD WSPI+NW    
Sbjct: 428 LCLIGGTASNALFSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVNWTSIA 487

Query: 493 XXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEE 551
                      P++ T + P TMNYT+VI    W+ SL Y+  ++ K++ GPKSNL+D E
Sbjct: 488 FELFIIVMMMFPTEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSNLSDAE 547

Query: 552 FQEYVGEDVIDAIISNN 568
           F + VG+DVID I+S++
Sbjct: 548 FDKAVGQDVIDQILSHS 564

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/568 (49%), Positives = 383/568 (67%), Gaps = 7/568 (1%)

Query: 6   MSASSSAMDTIKNR---KSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAEL 62
           MSAS S+     N       V+ +V  V  LRTITS     + +++A++A  D ++LAE+
Sbjct: 1   MSASVSSGSEKNNYIIGAQEVKNKVDVVTSLRTITSRRVGDVNYINAKAAHDDTELLAEI 60

Query: 63  GYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGI 122
           GYK+EL+R FS IQ+FGVAFSIMGLLPSIAS L   L  G V L WGW IAG  VLT G+
Sbjct: 61  GYKQELQRHFSKIQVFGVAFSIMGLLPSIASVLSLALPGGSVSLVWGWGIAGAFVLTNGL 120

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
           A++EL+S+IPT+G +Y   Y +AP +V+  +S+ VG  ++L+L A +CSI YGLA +ILS
Sbjct: 121 AMSELASAIPTSGGLYYYTYYYAPPKVKNLLSFVVGNSNSLALIAGLCSINYGLAGEILS 180

Query: 183 AVLV-SNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIA 241
            V+V S+ +FN+TN  TYGV+AACI+A  ++TS+ T   S++QT SIVSN+ LI +FF+A
Sbjct: 181 IVVVGSDGNFNITNASTYGVYAACIVATAVVTSVATVAVSKLQTFSIVSNLLLICIFFVA 240

Query: 242 VPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAE 301
           +P+GV+RS+ +   FND  +IFG   NLS WN GW +  AG  P IW IG +DSC+HM+E
Sbjct: 241 LPVGVARSNHM--EFNDAKYIFGNFQNLSDWNDGWQFMSAGFQPLIWVIGGFDSCIHMSE 298

Query: 302 EARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALG 361
           EA++A  +VPFGI+GSISVCW++G+ ICIV+ AC   ++  ++ ++F Q + QI++DALG
Sbjct: 299 EAKNATASVPFGIIGSISVCWVLGFFICIVIAACSSQDVAAIVETKFHQPLAQILFDALG 358

Query: 362 KRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVW 421
           KRWT+  + +   CQFLM AS + A SRQ WAFARDDG+PFS++ K V+     P+RA W
Sbjct: 359 KRWTIAIMVLIAFCQFLMAASILTAISRQIWAFARDDGLPFSSWIKVVNIKLSSPLRATW 418

Query: 422 XXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDV 481
                         +G  AS ALFSL+V+  Y + + P  LR+TYGK  F PG F++G  
Sbjct: 419 VGAGAALAIGCLCLIGPVASSALFSLAVSANYFSWMVPNLLRMTYGKDVFTPGAFFMGKY 478

Query: 482 WSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY 540
            SP++NW               P+D   + P TMNY+VV     WVL  IYY V++ KFY
Sbjct: 479 LSPVVNWISIVFEIFMILLVFFPADQHGITPDTMNYSVVFIGAVWVLPTIYYLVYKYKFY 538

Query: 541 QGPKSNLTDEEFQEYVGEDVIDAIISNN 568
            GPKSNLTDEE++E VG+DV+DAI+S +
Sbjct: 539 SGPKSNLTDEEYEEKVGQDVLDAILSKH 566

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 388/556 (69%), Gaps = 6/556 (1%)

Query: 16  IKNRKSNVEVEVGQVRELRTITSAHGA-PIRFVDARSATSDKQVLAELGYKEELKREFSS 74
           I +R      ++  +  +R++ S  GA  + +++A +A  D Q+LAE+GYK+ELKR+FS+
Sbjct: 13  IVSRDKGTTSDLQNLHSVRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFST 72

Query: 75  IQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTA 134
           +Q+FG+AFSIMGLLPSIAS + GGLS GPV L WGWFIAG  +L IG+++AE +S+IPTA
Sbjct: 73  LQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENASAIPTA 132

Query: 135 GAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFNV 193
           G +Y   + +AP+  +  IS+ +G  ++L+L + VCSI YGLA++IL+AV++S +  F V
Sbjct: 133 GGLYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKDGDFEV 192

Query: 194 TNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLG 253
           T+  TYGVF A + AM + T + +   SR+QT SIV+N F+IIL FIA+PIG  R+  +G
Sbjct: 193 TSGKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIGTKRN--MG 250

Query: 254 RHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFG 313
             FND  +IFGK +N S WN GW +C+ G M  +WTIGA+DSC+H +EEA+DA +AVP G
Sbjct: 251 -GFNDASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAVPIG 309

Query: 314 IVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFI 373
           I+GSI+VCWI+GWLI IVL+AC+DP+++ VL++ +G  + QI+Y++LGK W + F+S+  
Sbjct: 310 IIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIA 369

Query: 374 ICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXX 433
            CQFLMGAS + A SRQ WAFARDDG+P S + K V+    VP+ AVW            
Sbjct: 370 ACQFLMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVLGLL 429

Query: 434 XXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXX 493
             +  AA+ ALFSL+VAG Y++   P  LRLT+G+  FRPGPFYLG  WSPI+NW     
Sbjct: 430 CLIDSAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTSVLF 489

Query: 494 XXXXXXXXXXP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEF 552
                     P S   +  STMNY  VIGPG W+L+ +YY V+++K+Y GPKSNLTDEE+
Sbjct: 490 QAFIIVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTDEEY 549

Query: 553 QEYVGEDVIDAIISNN 568
            + VG  VID ++SN+
Sbjct: 550 VDAVGSIVIDEMLSNS 565

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/577 (47%), Positives = 385/577 (66%), Gaps = 14/577 (2%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVR------ELRTITSAHGA-PIRFVDARSAT 53
           M+  + S SS     I N +     E G +        LR+I S  GA  + +++A  + 
Sbjct: 1   MNSTMTSESSKKDIKIINLEPRASTEEGSIELHNMASNLRSIISKTGAGEVNYINASKSV 60

Query: 54  SDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
           +D Q+LAE+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS +  G+S G V   WGWFIA
Sbjct: 61  NDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGTGISGGSVSFVWGWFIA 120

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIV 173
              +L +GI++AE +S+IPTAG +Y   Y +AP+  ++  S+ +G  ++L+L A +CSI 
Sbjct: 121 SFFILLVGISMAENASAIPTAGGLYYWTYYYAPKGYKEVFSFIIGCSNSLALVAGLCSID 180

Query: 174 YGLAQQILSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
           YGLA++I++AV+V+ +  FN+T+   Y VF A +I M + TSM +   +R+Q ISIVSN+
Sbjct: 181 YGLAEEIMAAVVVTYDGDFNITDGRLYAVFLASVIVMALCTSMASGVIARLQNISIVSNL 240

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
           F+I+L FIA+P+G     K G  FND  FIFG  +N S WN GW +C+ G MPA+WTIG+
Sbjct: 241 FIIVLLFIALPVGTKH--KRGT-FNDASFIFGGFENFSDWNGGWQFCLTGFMPAVWTIGS 297

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +DSC+H +EEA+DA ++VP GI+GSIS CWI+GWLI I L+AC+DP ++NVL++++G  M
Sbjct: 298 FDSCVHQSEEAKDAKKSVPVGIIGSISACWILGWLIIICLMACIDPQLENVLDTQYGFPM 357

Query: 353 TQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNT 412
            Q+IYD+LGK+WT+ FLS+   CQFLMG S   A SRQ WAF+RDDG+PFS + K+V N+
Sbjct: 358 AQLIYDSLGKKWTIAFLSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPFSKYIKQVHNS 417

Query: 413 TGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFR 472
             VP  A+               +   A+ ALFSL+VAG Y+A   P  LRLT G+  FR
Sbjct: 418 --VPFFAILAACVSSLVLGLLCLIDATAANALFSLAVAGNYLAWCTPTLLRLTSGRDIFR 475

Query: 473 PGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIY 531
           PGPFYLG V SPI++W               PS    ++ + MNY  VIGPG W L+ IY
Sbjct: 476 PGPFYLGKVLSPIVSWIGVLYEVFIIIMEMFPSQQHGINKTNMNYACVIGPGIWFLAWIY 535

Query: 532 YFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           Y ++++K+Y GPK+NL+DEE+ + VG DVID I+   
Sbjct: 536 YLLYKKKYYHGPKTNLSDEEYSDMVGIDVIDGILEQK 572

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/578 (45%), Positives = 381/578 (65%), Gaps = 17/578 (2%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVG-------QVR----ELRTITSAHGA-PIRFVDARSAT 53
           MS SS+  D    +  ++E  V         +R     +R+I S  GA  + ++++ ++ 
Sbjct: 1   MSGSSNRSDDKDFKSISIEARVSTEAGSAVDIRNVNSHIRSIRSKTGAGEVNYINSATSV 60

Query: 54  SDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
           +D Q+LAE+GYK+ELKR+FS+ Q+FG+AFSIMGLLPSIAS +  G+S GP    WGWFIA
Sbjct: 61  TDNQLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLPSIASVMGTGISGGPTTFVWGWFIA 120

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIV 173
               + IGI++AE +S+IPTAG +Y   Y +AP+  +K IS+ +G  ++L+L A +CSI 
Sbjct: 121 SIFTIFIGISMAENASAIPTAGGLYYWTYYYAPEGFKKVISFVIGCSNSLALAAGLCSID 180

Query: 174 YGLAQQILSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
           YGLA++I++AV+++ +  F+VT+   YG+FAA ++ M I T + +   +RMQ+ SI SN+
Sbjct: 181 YGLAEEIMAAVVLTFDGDFDVTSGKLYGIFAAAVVVMGICTCISSGAIARMQSFSIASNL 240

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
           F+I+L FIA+PIG  R+      FND  FIFGK +N S WN GW +C+AG MPA+WTIG+
Sbjct: 241 FIIVLLFIALPIGTKRNRG---EFNDAKFIFGKFENFSDWNSGWQFCMAGFMPAVWTIGS 297

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +DSC+H +EEA+DA ++VP GI+ SI+ CWI+GWLI IVL+AC+DPN++NV+++++G  M
Sbjct: 298 FDSCVHQSEEAKDAKKSVPIGIIASIAACWILGWLIIIVLMACIDPNLENVVDTKYGFPM 357

Query: 353 TQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNT 412
            Q+IYD+LGKRW + F+S+   CQFLMG S   A SRQ WAF+RDDG+P S + K V   
Sbjct: 358 AQLIYDSLGKRWAITFMSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPLSKYIKIVDKR 417

Query: 413 TGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFR 472
             VP  A+               +   A+ ALFSL+VAG Y+A   P  LR T G+  FR
Sbjct: 418 YSVPFNAIIAACVTCLVLGLLCLIDSTAANALFSLAVAGNYLAWSIPTLLRFTTGRDLFR 477

Query: 473 PGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIY 531
           PGPFYLG   S I+ W               P+    ++ + MNY  VIGPG W LS IY
Sbjct: 478 PGPFYLGKPLSAIVGWTGICYEFFIIIMVMFPTQKNGINKTNMNYACVIGPGIWFLSWIY 537

Query: 532 YFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNNV 569
           Y  +++K+++GPK+NL++++++E V  D ID I+ + +
Sbjct: 538 YIAYKKKYFRGPKTNLSEDDYEEMVAIDNIDEIMMSKI 575

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/542 (50%), Positives = 371/542 (68%), Gaps = 13/542 (2%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVREL-------RTITSAHGA-PIRFVDARSATSDKQ 57
           MS +SS  +T    +  + V+ G   E+       R++ S  GA  + F+DA +  SD Q
Sbjct: 1   MSLTSSKKETQVVTEQRLSVDFGSAEEIERPFSNIRSVRSQTGAGEVNFIDAGATVSDHQ 60

Query: 58  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV 117
           +LAE+GYK+EL R+FS+IQ+FG+AFSIMGLLPSIAS + GGL+ GP  L WGWFIAG  +
Sbjct: 61  LLAEIGYKQELNRQFSTIQVFGIAFSIMGLLPSIASVMGGGLAGGPTTLVWGWFIAGCFI 120

Query: 118 LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA 177
           LT+GIA+AE +S+IPTAG +Y   Y +AP+  ++ IS+ +G  ++L+L A VCSI YG A
Sbjct: 121 LTVGIAMAENASAIPTAGGLYYWTYYYAPKGYKEVISFVIGCSNSLALAAGVCSIDYGFA 180

Query: 178 QQILSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLII 236
           +++L+AV+++ + +F +T   TYGVFAA ++AM I T M +K  +R+QTISIVSN+F+I+
Sbjct: 181 EEVLAAVVIAKDGNFEITPGKTYGVFAAAVVAMGICTCMASKAIARLQTISIVSNLFIIV 240

Query: 237 LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSC 296
           L FIA+PIG ++ +  G  FNDG FIFGK  NLS WN GW + +AG MP +WTIGA+DSC
Sbjct: 241 LLFIALPIG-TKINMGG--FNDGSFIFGKFKNLSDWNNGWQFFLAGFMPVVWTIGAFDSC 297

Query: 297 LHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQII 356
           +H +EEA+DA ++VP GI+GSISVCW++GWLI I L+ACM P+I+ ++++++G  M QII
Sbjct: 298 VHQSEEAKDAKKSVPIGIIGSISVCWVLGWLILICLMACMSPDIEGIVDNKYGFAMAQII 357

Query: 357 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVP 416
           YD+LGK+W + F+S+   CQFLMG+S V A SRQ WAFARDDG+P S++ K V     VP
Sbjct: 358 YDSLGKKWAVAFMSLIAFCQFLMGSSVVTAISRQIWAFARDDGLPLSDYIKMVDKKYKVP 417

Query: 417 VRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPF 476
             A+               +  AA+ ALFSL+VAG  +A   P  LRLT G+  FRPGPF
Sbjct: 418 FNAIIFACCGSLILGLLCLIDAAATSALFSLAVAGNNLAWSTPTLLRLTSGRDLFRPGPF 477

Query: 477 YLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVW 535
           YLG VWS +  W               PS+   +  STMNYT VIGPG W LS +YY V+
Sbjct: 478 YLGPVWSKVNGWISIIFEAFIIIVVMFPSEKHGITKSTMNYTCVIGPGIWFLSWVYYSVY 537

Query: 536 QR 537
           ++
Sbjct: 538 KK 539

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/573 (48%), Positives = 389/573 (67%), Gaps = 14/573 (2%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVREL-------RTITSAHGA-PIRFVDARSATSDKQ 57
           MS SS   + I   +  V  ++GQ  +L       R+I S  GA  + +++A  + +D Q
Sbjct: 1   MSMSSKNENKITVER-KVSTDLGQAFQLQGLGSNLRSIRSKTGAGEVNYINASKSVNDHQ 59

Query: 58  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV 117
           +LAE+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF+AG  +
Sbjct: 60  LLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLDGGPASLLWGWFVAGFFL 119

Query: 118 LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA 177
           L +G+++AE +S+IPTAG +Y   Y +AP+  ++ IS+ +G  ++L+L A VCSI YGLA
Sbjct: 120 LLVGMSMAEHASAIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALTAGVCSINYGLA 179

Query: 178 QQILSAV-LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLII 236
           ++I +AV L  + +F+VT  + YG+FA  ++ M + T + +   +R+QT+SI SNVF+II
Sbjct: 180 EEIAAAVTLTKDGNFDVTRGMLYGIFAGAVVLMGLCTCIASGGIARLQTLSIASNVFIII 239

Query: 237 LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSC 296
           L FIA+PIG  R+  +G  FN+G FIFGK +N S WN GW +C+AG MPA+WTI ++DSC
Sbjct: 240 LLFIALPIGTKRN--MG-GFNNGDFIFGKFENFSDWNNGWQFCLAGFMPAVWTINSFDSC 296

Query: 297 LHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQII 356
           +H +EEA+DA ++VP GI+ SI VCWI+GW I I LLAC++P++ +VL+S++G  + QII
Sbjct: 297 VHQSEEAKDAKKSVPIGIILSILVCWILGWFIIICLLACINPDLASVLDSKYGFALAQII 356

Query: 357 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVP 416
           YD+LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G+P S + KKV +   VP
Sbjct: 357 YDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKKVDSKYSVP 416

Query: 417 VRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPF 476
             A+               + +AA+ ALFSL+VAG  +A   P  LRLT GK  FRPGPF
Sbjct: 417 FYAILAACVCSLVLGLLCLIDQAATNALFSLAVAGNNLAWSTPTVLRLTSGKDLFRPGPF 476

Query: 477 YLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVW 535
           YLG  WSPI+ W               P+    +  +TMNYT VIGPG W+L+ IYY V+
Sbjct: 477 YLGKFWSPIVAWVGVAFQVFIIVMVMFPAQQKGITKATMNYTCVIGPGIWILAGIYYKVY 536

Query: 536 QRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           ++K+Y GP +NL+DE++ + VG DVID IIS  
Sbjct: 537 KKKYYHGPATNLSDEDYVDAVGVDVIDTIISKQ 569

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/580 (47%), Positives = 387/580 (66%), Gaps = 11/580 (1%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           + G   + S++ +D  KN  + +E   G    +R++ S     + ++++ ++ +DK +LA
Sbjct: 11  VKGGYSTTSAAELDGEKNEGTLLEFR-GLKSHIRSVRSPVAGEVNYINSATSNTDKGLLA 69

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           E+GYK+EL+R+FS+IQ+FGVAFSIMGLLPSI + L  GL+ GPV   WGW IAG  +L +
Sbjct: 70  EIGYKQELERKFSTIQVFGVAFSIMGLLPSIGTLLSDGLAGGPVSTIWGWLIAGFFILVL 129

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           G+A+AE +S+IPTAG +Y   Y +AP+  +  +S+ +G  ++L+L A+ CSI YG A+++
Sbjct: 130 GLAMAENASAIPTAGGLYYWTYYYAPKGYKAVMSFIIGCSNSLALTAACCSITYGFAEEV 189

Query: 181 LSAV-LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239
           L+AV L  + +F+VTN   YG+FA   I M + TS+ + F +++QT+SI+ N+F+I+LFF
Sbjct: 190 LAAVVLTKDGNFDVTNGKLYGIFAGAAIMMGVCTSVASGFVAKLQTLSIICNLFIIVLFF 249

Query: 240 IAVPIGVSRSDKLGR-HFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLH 298
           IAVPIG     K+ R  FN GHFIF    N S WN GW +C+AG MPAIWTIG +DSC+H
Sbjct: 250 IAVPIGA----KVNRGKFNHGHFIFANYQNSSDWNNGWQFCLAGFMPAIWTIGGFDSCVH 305

Query: 299 MAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYD 358
            +EEA+DA ++V  GIVGSISVCWI+GW I IVLLACMDP++   +N+++   + QIIYD
Sbjct: 306 QSEEAKDAKKSVALGIVGSISVCWILGWFILIVLLACMDPDVSKTMNTKYVLSIAQIIYD 365

Query: 359 ALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVR 418
            LGK W + F+S+   CQFLMGAST+ A SRQ WAF+RD+G+PFS + KKV+ T  +P  
Sbjct: 366 CLGKNWAIAFMSLIAFCQFLMGASTITAVSRQIWAFSRDNGLPFSKYIKKVNKTYSIPFV 425

Query: 419 AVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYL 478
           A+                 EAA+ ALFSLSVAG  ++   P  LRLT+GK  FRPGPFYL
Sbjct: 426 AIIAACCGTLVLGLLCLQDEAAN-ALFSLSVAGNNLSWGTPTFLRLTFGKDLFRPGPFYL 484

Query: 479 GDVWSPIINWXXXXXXXXXXXXXXXP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQR 537
           G   S +  W               P S   V P +MNY  VIGPG W+LS IYY  +++
Sbjct: 485 GKFLSTVNGWISVFWGLFVIILVMFPTSQHNVTPQSMNYACVIGPGVWILSFIYYITYKK 544

Query: 538 KFYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV 577
           K+Y GP SNLT+EE+   VGEDV+D I  +NV +Q +++V
Sbjct: 545 KYYHGPASNLTEEEYVNAVGEDVLDNI--DNVLSQPEKVV 582

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/573 (48%), Positives = 392/573 (68%), Gaps = 16/573 (2%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVREL-------RTITSAHGA-PIRFVDARSATSDKQ 57
           MS+ +    TI+ R   V  +VGQ  +L       R+I S  GA  + ++DA  + +D Q
Sbjct: 3   MSSKNENKITIEQR---VSTDVGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQ 59

Query: 58  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV 117
           +LAE+GYK+ELKR+FS+IQ+FG+AFSIMGLLPSIAS + GGL  GP  L WGWFIA   +
Sbjct: 60  LLAEIGYKQELKRQFSTIQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFIAAFFI 119

Query: 118 LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA 177
           L +GI +AE +SSIPTAG +Y   Y +AP+  ++ IS+ +G  ++L+L A VCSI YGLA
Sbjct: 120 LLVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLA 179

Query: 178 QQILSAV-LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLII 236
           ++I +A+ L  + +F+VT+   YG+FA  ++ M I T + +   +R+QT+SI +N+F+I+
Sbjct: 180 EEIAAAITLTKDGNFDVTSGKLYGIFAGAVVVMGICTCIASGAIARLQTLSIFANLFIIV 239

Query: 237 LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSC 296
           L FIA+PIG   +  +G  FN+G FIFGK +NLS WNKGW +C+AG MPA+WTIG++DSC
Sbjct: 240 LLFIALPIGTKHN--IG-GFNNGDFIFGKYENLSDWNKGWQFCLAGFMPAVWTIGSFDSC 296

Query: 297 LHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQII 356
           +H +EEA+DA ++VP GI+ SI+VCWI+GWLI I L+AC++P+ID+VL+S++G  + QII
Sbjct: 297 VHQSEEAKDAKKSVPIGIISSITVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQII 356

Query: 357 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVP 416
           YD+LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G+P S + K+V +   VP
Sbjct: 357 YDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVP 416

Query: 417 VRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPF 476
             A+               + +AA+ ALFSL+VAG  +A   P  LRLT G+  FRPGPF
Sbjct: 417 FFAILAACAGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPF 476

Query: 477 YLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVW 535
           YLG +WSPI+ W               P+    +  STMNY  VIGPG W L+ +YY V+
Sbjct: 477 YLGKIWSPIVAWIGVAFQVFIIILVMFPAQQHGITKSTMNYACVIGPGIWFLAGVYYKVY 536

Query: 536 QRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           ++K+Y GP +NL+D+++ E VG DVID IIS  
Sbjct: 537 KKKYYHGPATNLSDDDYAEAVGIDVIDTIISKQ 569

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/573 (48%), Positives = 390/573 (68%), Gaps = 14/573 (2%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVREL-------RTITSAHGA-PIRFVDARSATSDKQ 57
           MS SS   + I + +  +  ++GQ  +L       R+I S  GA  + ++DA  + +D Q
Sbjct: 1   MSMSSKNENKI-SVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQ 59

Query: 58  VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV 117
           +LAE+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF+A   +
Sbjct: 60  LLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFVAAFFI 119

Query: 118 LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA 177
           L +GI +AE +SSIPTAG +Y   Y +AP+  ++ IS+ +G  ++L+L A VCSI YGLA
Sbjct: 120 LLVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLA 179

Query: 178 QQILSAV-LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLII 236
           ++I +AV L  + +F VT+   YG+FA  ++ M I T + +   +R+QT+SI +N+F+I+
Sbjct: 180 EEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGAIARLQTLSIFANLFIIV 239

Query: 237 LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSC 296
           L FIA+PIG     ++G  FNDG FIFGK +NLS WN GW +C+AG MPA+WTIG++DSC
Sbjct: 240 LLFIALPIGTKH--RMG-GFNDGDFIFGKYENLSDWNNGWQFCLAGFMPAVWTIGSFDSC 296

Query: 297 LHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQII 356
           +H +EEA+DA ++VP GI+ SI+VCWI+GWLI I L+AC++P+ID+VL+S++G  + QII
Sbjct: 297 VHQSEEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQII 356

Query: 357 YDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVP 416
           YD+LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G+P S + K+V +   VP
Sbjct: 357 YDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVP 416

Query: 417 VRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPF 476
             A+               + +AA+ ALFSL+VAG  +A   P   RLT G+  FRPGPF
Sbjct: 417 FFAILAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVFRLTSGRDLFRPGPF 476

Query: 477 YLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVW 535
           YLG +WSPI+ W               PS    +  STMNY  VIGPG W+L+ IYY V+
Sbjct: 477 YLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNYACVIGPGIWILAGIYYKVY 536

Query: 536 QRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           ++K+Y GP +NL+D+++ E VG DVID I+S  
Sbjct: 537 KKKYYHGPATNLSDDDYTEAVGADVIDTIMSKQ 569

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/537 (49%), Positives = 368/537 (68%), Gaps = 6/537 (1%)

Query: 32  ELRTITSAHGA-PIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPS 90
            +RT+ S  GA  + ++++  + SD Q+LAE+GYK ELKR+FS++Q+FG+AFSIMGLLPS
Sbjct: 33  RVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKPELKRQFSTLQVFGIAFSIMGLLPS 92

Query: 91  IASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVR 150
           IAS + GGL+ GPV L WGWF +   +L +GI +AE +S+IPTAG +Y   Y +AP++ +
Sbjct: 93  IASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAENASAIPTAGGMYYWTYYYAPKKYK 152

Query: 151 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVS-NPSFNVTNPITYGVFAACIIAM 209
             +S+ VG  ++L+L AS CSI YG A+++++AV ++ + +  VT+   YG+FA   + M
Sbjct: 153 AVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFLTYDGAVTVTSGKLYGIFAGATVVM 212

Query: 210 TILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNL 269
            + T + +   +R+QT+SIVSN+F+IILF IAVPIG   +  +G HFNDG +IFG  +NL
Sbjct: 213 AMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIGTKAN--IG-HFNDGKYIFGHFENL 269

Query: 270 SSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLIC 329
           S WN G+ + +AG MPA WTI ++DSC+H +EEA+DA ++VP GI+GSI+ CWI+G+LI 
Sbjct: 270 SDWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAKKSVPIGIIGSITACWILGFLII 329

Query: 330 IVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSR 389
           I L ACMD ++D ++NS+ G  M QII+D+LGKRW + F+++   CQFLMGAS V A SR
Sbjct: 330 ICLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIAFMALIAFCQFLMGASIVTAISR 389

Query: 390 QFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSV 449
           Q WAFARDDG+PFSN  K V     VP  +V               +   A+ ALFSLSV
Sbjct: 390 QIWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITSLLLGLLCLINSQATAALFSLSV 449

Query: 450 AGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDA-T 508
           AG Y+A + P  LRLT G+  FRPGPFYLG  WSPI+ W               P+    
Sbjct: 450 AGGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVAWSSVVFEIWIILLEMFPAQQHH 509

Query: 509 VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAII 565
           +D STMNY+ VIGPG  +L+ IYY VW+ + Y GPKSNL+DE+++E +G  V+D II
Sbjct: 510 IDKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSNLSDEDYKEALGPAVLDDII 566

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/571 (48%), Positives = 388/571 (67%), Gaps = 7/571 (1%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGA-PIRFVDARSATSDKQVL 59
           M  ++ SA  S      +  S  E+      ++R + S  GA  + ++++ ++ +D Q+L
Sbjct: 1   MTDDIKSAIRSGPRLSTSEGSAFELHQLSSSDVRYVRSKTGAGEVNYINSATSVNDGQLL 60

Query: 60  AELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLT 119
           AE+GYK+ELKR+FS++Q+FGVAFSIMGLLPSIAS + GGL+ GPV L WGWFIA   +L 
Sbjct: 61  AEIGYKQELKRQFSTLQVFGVAFSIMGLLPSIASVMGGGLTGGPVTLVWGWFIAAFFILL 120

Query: 120 IGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 179
           +GI +AE +S+IPTAG +Y   Y +AP+  ++ +S+ +G  ++L+L A VCSI YG A +
Sbjct: 121 VGITMAENASAIPTAGGLYYWTYYYAPKGYKEIVSFVIGCSNSLALSAGVCSISYGFALE 180

Query: 180 ILSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILF 238
           +L+AV++S +  F VT   TYG+FAA ++A  ++T + +   +R+QT+SIVSNVF++IL 
Sbjct: 181 VLAAVVISRDGDFEVTTGKTYGIFAAVVVAQGVVTCLSSGLVARLQTLSIVSNVFIMILL 240

Query: 239 FIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLH 298
           FIA+PIG ++ ++ G  FN+G FIFG   N S WN GW +C+AG MPA+WTIG++DSC+H
Sbjct: 241 FIALPIG-AKVNRGG--FNNGEFIFGTYQNFSDWNSGWQFCLAGFMPAVWTIGSFDSCVH 297

Query: 299 MAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYD 358
            +EEA+DA ++VP GI+GSI+ CWI+GWLI I L+ACMD +I  VL++++   + QI+YD
Sbjct: 298 QSEEAKDAKKSVPIGIIGSIAACWILGWLIIICLMACMDSDISKVLDTDYEIILAQIVYD 357

Query: 359 ALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVR 418
            LGK W + F+++   CQFLMGAS V A SRQ WAFARDDG+P S + KKV     VP  
Sbjct: 358 CLGKNWAIAFMALIAFCQFLMGASIVTAASRQIWAFARDDGLPLSKYIKKVDKKYSVPFV 417

Query: 419 AVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYL 478
           A+               +  AA+ ALFSL+VAG  +A   P  LRLT+G+  FRPGPFYL
Sbjct: 418 AI-IAACVASLLLGLLCLDAAAAAALFSLAVAGNNLAWSTPTFLRLTWGRDLFRPGPFYL 476

Query: 479 GDVWSPIINWXXXXXXXXXXXXXXXPS-DATVDPSTMNYTVVIGPGFWVLSLIYYFVWQR 537
           G +WSPII W               PS    + P TMNY  VIGPG W+LS IYY V+++
Sbjct: 477 GKLWSPIIAWIGVVYQAFIIILVMFPSARHGLTPQTMNYACVIGPGLWILSWIYYMVYRK 536

Query: 538 KFYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           K++ GPKSNL+DE++ E VGED+I+ I+S  
Sbjct: 537 KYFHGPKSNLSDEDYNEAVGEDLIEEILSRK 567

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  508 bits (1307), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 274/570 (48%), Positives = 388/570 (68%), Gaps = 10/570 (1%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVR----ELRTITSAHGA-PIRFVDARSATSDKQVLA 60
           MS+ +    +++ R S    E  Q+      LR+I S  GA  + +++A  + +D Q+LA
Sbjct: 3   MSSKNDNKISVEQRVSTDFGEAYQLEGLGSNLRSIRSKTGAGEVNYINAAKSVNDNQLLA 62

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           E+GYK+ELKR+FS++Q+FG+AFSIMGLLPSIAS + GGL  GP  L WGWF+A   +L +
Sbjct: 63  EIGYKQELKRQFSTVQVFGIAFSIMGLLPSIASVMGGGLGGGPATLLWGWFVAAFFILLV 122

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180
           GI +AE +S+IPTAG +Y   Y +AP+  ++ IS+ +G  ++L+L A VCSI YGLA++I
Sbjct: 123 GITMAEHASAIPTAGGLYYWTYHYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEI 182

Query: 181 LSAV-LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239
            +AV L  + +F+ T+   YG+FA  ++ M I T + +   +R+QT+SIV+N+F+I+L F
Sbjct: 183 AAAVTLTRDGNFDATSGKLYGIFAGAVVLMGICTCIASGAIARLQTVSIVANLFIIVLLF 242

Query: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHM 299
           IA+PIG   +  +G  FN+G FIFGK +N+S WN GW +C+AG MPA+WTIG++DSC+H 
Sbjct: 243 IALPIGTKHN--MG-GFNNGEFIFGKFENMSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQ 299

Query: 300 AEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDA 359
           +EEA+DA ++VP GI+ SI+VCW++G LI I LLAC++P+ID+VLNS++G  + QIIYD+
Sbjct: 300 SEEAKDAKKSVPIGIISSIAVCWVLGLLIIICLLACINPDIDSVLNSKYGFALAQIIYDS 359

Query: 360 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRA 419
           LGK+W + F+S+   CQFLMGAS   A SRQ WAF+RD+G+P S + K+V +   VP  A
Sbjct: 360 LGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFYA 419

Query: 420 VWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLG 479
           +               + EAA+ ALFSL+VAG  +A   P  LRLT G+  FRPGPFYLG
Sbjct: 420 ILAACVGSLILGLLCLIDEAATSALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFYLG 479

Query: 480 DVWSPIINWXXXXXXXXXXXXXXXPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538
             WSPII W               PS    +  STMNY  VIGPG W L+ +YY V+++K
Sbjct: 480 KFWSPIIAWIGVAFQVFIIILVMFPSQQHGITKSTMNYACVIGPGIWFLAGVYYKVYKKK 539

Query: 539 FYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568
           +Y GP +NL+D+++ + VG DVIDAIIS  
Sbjct: 540 YYHGPATNLSDDDYADAVGVDVIDAIISKQ 569

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  462 bits (1189), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 229/514 (44%), Positives = 335/514 (65%), Gaps = 5/514 (0%)

Query: 36  ITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTL 95
           I  ++  P+ ++DA++   D ++LAE+GYK+ELKR FS++QIFG+AFSIMGLLPSIAS L
Sbjct: 32  IECSNKGPMNYIDAKNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVL 91

Query: 96  DGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISY 155
              L  G V + WGWFI G  +L +G A+AEL+S+ PT+G +Y   Y +AP R++ C+S+
Sbjct: 92  PVALPGGSVSMVWGWFIFGAFILAVGAAMAELASAFPTSGGLYYYTYYYAPPRLKACLSF 151

Query: 156 SVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNP-ITYGVFAACIIAMTILTS 214
            +G  ++L+L A +CSI YGLA+QILS + +S+ S+ V++  + YG++   ++A  +L S
Sbjct: 152 LIGNGNSLALIAGLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLAS 211

Query: 215 MPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNK 274
           + T   S +QT SIV N+ L+ LF I +P+GV+ +   GR FN   F+F   +N + W  
Sbjct: 212 IATFSVSLLQTASIVMNLALVALFIIVLPVGVAHN---GRGFNSAKFMFTNFENHTGWPD 268

Query: 275 GWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLA 334
            + + + G +P +W IGA+DS +HM+EEA++A R+VP GI+ SIS CW +G+ I +V+ A
Sbjct: 269 WFQFFLCGSLPIVWVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAA 328

Query: 335 CMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAF 394
           CM P+ID +LN EF   + QI+Y+ALGK W L  +   ++CQ+LMGAS + A+SRQ WAF
Sbjct: 329 CMGPDIDAILNGEFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAF 388

Query: 395 ARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYM 454
           ARDDG+PFS++ K V+     P+RA W               G  AS ALFS++VA  Y+
Sbjct: 389 ARDDGLPFSSWIKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYL 448

Query: 455 ALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSD-ATVDPST 513
           A + P  LR+ +GK  +RPG FY+G  WSP+INW               PSD A +  ST
Sbjct: 449 AWMTPNLLRMLFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRAST 508

Query: 514 MNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNL 547
           MNYT +I    W+ S+ Y+  ++ + + GPKSNL
Sbjct: 509 MNYTAIITGFVWIGSIFYFLAYKHRTFIGPKSNL 542

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score =  450 bits (1157), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 228/535 (42%), Positives = 341/535 (63%), Gaps = 5/535 (0%)

Query: 21  SNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGV 80
           +N  V V Q+  ++T  S     + +++A++A  D ++LAE+GYK+EL R FS+IQ+FG+
Sbjct: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGI 83

Query: 81  AFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVS 140
           AFSIMGLLPSIAS L   L  G V   WGW I G  +L+IG A++EL+S+IPT+G +Y  
Sbjct: 84  AFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLYYY 143

Query: 141 CYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLV-SNPSFNVTNPITY 199
            Y +AP + +  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  +  F +++  T+
Sbjct: 144 TYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203

Query: 200 GVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDG 259
            V+ A I+A  ILTSM T   S +QT+SIV N+ L+  F I +PIGV+ +D +   FN  
Sbjct: 204 AVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSM--TFNGP 260

Query: 260 HFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIS 319
            FIF    N SSW     + + G +P +W IGA+DS +HM+EEA++A +AVP  I+ SI+
Sbjct: 261 GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSIT 320

Query: 320 VCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM 379
           VCW++G+ I + + ACM P+I+ +L++ FGQ + Q++++ LGK+W + F+S+  +CQ++M
Sbjct: 321 VCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM 380

Query: 380 GASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEA 439
           GAS + A SRQ WAFARDDG+PFS + KKV+ +   P+RA W               G  
Sbjct: 381 GASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPV 440

Query: 440 ASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXX 499
           AS ALFS+ V   Y+A + P  LR+ +GK  F PG FY+G  WSPIINW           
Sbjct: 441 ASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIV 500

Query: 500 XXXXPSDA-TVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQ 553
               P++   +  S+MNYT +     W  S+IY+ +++ K ++GPKSNLTD +  
Sbjct: 501 LMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLN 555

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  146 bits (369), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 125/513 (24%), Positives = 232/513 (45%), Gaps = 24/513 (4%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALA 125
           EL++ FS   I GV F +      I++++  G+S+G P+ + +G  I   + + IGI+L 
Sbjct: 46  ELRKSFSLWSILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLG 105

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS+ P AG  +    + AP + R+  +Y  G         +  S    +A +++    
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKYRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYA 165

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245
           +++P F V     + +F    +   +L      F    +++ ++S+  L I  F  + I 
Sbjct: 166 LTHPDFEVKR---WHIF----VCFELLHLFLMIFNCSGKSLPLISSSALYISLFSFITIT 218

Query: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305
           ++        +ND  F+F    N + W       I G++   W+    D   HMA E   
Sbjct: 219 ITVLACSHGQYNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEK 278

Query: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRW- 364
             R +P  I+G++++ +I  +   I +   +  N+D +++S  G  +  I Y AL  +  
Sbjct: 279 PERVIPISIMGTVAIGFITSFCYVIAMFFSLH-NLDEIMSSNTGAPILDIYYQALQSKAG 337

Query: 365 --TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWX 422
              LG L +F     ++   T    +R  W+FARD+G+P+S ++ KV+   GVP+ A   
Sbjct: 338 AIVLGCLILFTSFGCVIACHT--WQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAHLM 395

Query: 423 XXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVW 482
                            A  +L +  +A + ++ + P+ + L + KR  + GPF+LG + 
Sbjct: 396 SCAWIVLLGVLYLASSTAFNSLITGCIAFLLLSYVVPV-ICLLWRKRQIQHGPFWLGKI- 453

Query: 483 SPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQG 542
               N+               P+   V    MNY  V+  G+ + SL+Y   W+   ++G
Sbjct: 454 GLFSNYVLLGWTVFALVFFCFPAVMPVTKDNMNYASVVIVGYLLYSLLY---WR---FRG 507

Query: 543 PKSNLTDEEFQEYVGEDV-IDAIISNNVATQKD 574
             +    EE  EY GE+V +++   ++   ++D
Sbjct: 508 RYTFYVVEE-DEYTGENVSVNSETIHDTTIEED 539

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 139/548 (25%), Positives = 235/548 (42%), Gaps = 38/548 (6%)

Query: 37  TSAHGAPIRFVDARSATSD---KQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIAS 93
           T  H   +R  +    + D   K V+A  G +  L++ FS   I GV F +      I++
Sbjct: 21  TDVHKRDVRVAEEFEPSDDADGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSWFGISA 79

Query: 94  TLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKC 152
           ++  G+S+G P+ + +G  I   + + IG +L ELSS+ P AG  +    + AP + ++ 
Sbjct: 80  SMVAGISSGGPMMIVYGIIIVALISVCIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRF 139

Query: 153 ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTIL 212
            +Y  G         +  S    +A +++    + NP+F    P  + +F  C   + + 
Sbjct: 140 AAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALMNPNFI---PKRWHIFV-CFELLHLF 195

Query: 213 TSMPTKFTSRMQTISIVSNVFLIILFF-IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSS 271
             +   +   +  IS  S    ++ FF I + +      K    FND  F+F    N + 
Sbjct: 196 LMLFNCYGKSLPLISSSSLYISLLSFFTITITVLACSHGK----FNDAKFVFATFYNETG 251

Query: 272 WNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIV 331
           W  G    I G++   W+    D   HMA E     R +P  I+G++++ ++      I 
Sbjct: 252 WKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSLCYVIA 311

Query: 332 LLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGA-STVVA---- 386
           +   +  ++D VL+S  G  +  I   ALG +      +IF+ C  L  +   V+A    
Sbjct: 312 MFFSIK-DLDAVLSSTTGAPILDIYNQALGNKSG----AIFLGCLVLFTSFGCVIACHTW 366

Query: 387 NSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFS 446
            +R  W+FARD+G+P S F+ +V+  TGVP+ A                    A  +L +
Sbjct: 367 QARLCWSFARDNGLPLSRFWSQVNPHTGVPLNAHLMSCAWISLIGLLYLASSTAFQSLIT 426

Query: 447 LSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSD 506
             +A + ++ I P+   L   KRD   GPF+LG  +    N                P  
Sbjct: 427 GCIAFLLLSYIIPVICLLA-KKRDIAHGPFWLGK-FGLFSNIVLLGWTVFSIVFFSFPPV 484

Query: 507 ATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIIS 566
             V    MNY  V+  G+   S++Y   W+   Y+G K     EE  E+  +D      +
Sbjct: 485 LPVTKDNMNYVCVVIVGYTAYSILY---WR---YKGKKEFHAVEE-SEHEQDD-----FA 532

Query: 567 NNVATQKD 574
           NN  T +D
Sbjct: 533 NNFETIED 540

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  134 bits (338), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 115/471 (24%), Positives = 205/471 (43%), Gaps = 16/471 (3%)

Query: 66  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIAL 124
           + L++ FS   + GV F +      I+ ++  G+ S GP+ + +G  I   + + +G++L
Sbjct: 40  QLLRKSFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSL 99

Query: 125 AELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAV 184
           AELSS+ P AG  +    + AP + R+  +Y  G L       +  S     A +++   
Sbjct: 100 AELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAATELVGMY 159

Query: 185 LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPI 244
            +  P F V     + VF    +   IL      F    +++ +VS+  L +  F  V I
Sbjct: 160 ALVRPEFVVRK---WHVF----VCYQILHCFLMLFNCYGRSLPLVSSSALYVSLFSFVTI 212

Query: 245 GVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEAR 304
            ++       HFND  F+F    N + W       I G++   W+    D   HMA E  
Sbjct: 213 TITVVACSRGHFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATHMAFEVE 272

Query: 305 DAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKR- 363
              R +P  I+G++++ ++  +   I +   +  ++  ++ S  G  +  I Y ALG R 
Sbjct: 273 QPERVIPIAILGTVAIGFLTSFCYVIAMFFSLR-DLSEIMTSNTGVPILDIYYQALGSRA 331

Query: 364 --WTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVW 421
               LG L +      ++ + T    +R  W+FARD G+P+S+ + +V+ + GVP+ A  
Sbjct: 332 GALVLGSLVLLTSVGCIISSHT--WQARLCWSFARDGGLPYSHLWARVNRSVGVPLNAHL 389

Query: 422 XXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDV 481
                             A  +L +  +A + ++ I P+ + L   KR  + GPF+LG  
Sbjct: 390 MSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPV-ICLLLKKRQIKHGPFWLGP- 447

Query: 482 WSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYY 532
           +    N+               P    V    MNY  V+  G+ +  LI++
Sbjct: 448 FGAFCNYVLLAWTVFVLIFFSLPPLKPVTKDNMNYVSVVVVGYILYVLIFW 498

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 113/478 (23%), Positives = 214/478 (44%), Gaps = 15/478 (3%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALA 125
           EL++ FS   + GV F +      ++ ++  G+S+G P+ + +G  I   + + +G++L 
Sbjct: 46  ELRKSFSLWSVLGVGFGLTNSWFGLSVSMVTGISSGGPMMIIYGIVIIALISVCVGVSLG 105

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVG-FLDTLSLCASVCSIVYGLAQQILSAV 184
           ELSS+ P AG  +    Q AP + ++  +Y  G F    S+ AS  S +    + +L   
Sbjct: 106 ELSSAYPHAGGQFWWSLQLAPNKYKRLAAYLCGSFAWAGSVFASASSTL-STTRLLLGMY 164

Query: 185 LVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPI 244
            + +PS  + +   + VF  C  A+ +   +   F    + + ++S+  L +  F  + I
Sbjct: 165 ALVHPSLEIKD---WHVFV-CYQALHMFLLL---FNCHGRPLPLISSTALYVSLFSFITI 217

Query: 245 GVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEAR 304
            ++       +FND  F+F    N + W       I G++   W+    D   HMA E  
Sbjct: 218 TITVLASSHGNFNDAKFVFANFRNETGWESNTIAFIVGLINPAWSFSCLDCATHMAFEVE 277

Query: 305 DAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRW 364
                +P  I+G++++ ++   + CI +   +  ++D +L+S  G  +  I Y A G + 
Sbjct: 278 KPETVIPTAILGTVAIGFLTSIVYCIAMFFSIR-DLDGILSSTTGAPILDIYYQASGSKA 336

Query: 365 TLGFL-SIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXX 423
               L S+ ++  F    S     +R  W+FARD+G P+S  + KV+   GVP+ A    
Sbjct: 337 CAIVLGSLVLLTSFTCVTSCHTWQARLCWSFARDNGFPYSRIWAKVNTELGVPLNAHLLS 396

Query: 424 XXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWS 483
                           A  AL +  ++ + ++   P+ + L   +R+ + GPF+LG  + 
Sbjct: 397 CAVISLLGVLYLASSTAFNALVTGCISFLLLSYTVPV-ICLLLKQRNIKRGPFWLGK-FG 454

Query: 484 PIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYY-FVWQRKFY 540
              N+               P    +    MNY  ++   + + S++Y+ F   +KFY
Sbjct: 455 TFSNYVLLAWTLFSLVFFSLPPMKPITKGNMNYVSIVILSYLLYSILYWKFSGHKKFY 512

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  133 bits (334), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 137/576 (23%), Positives = 234/576 (40%), Gaps = 47/576 (8%)

Query: 2   DGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSA-TSDKQVLA 60
            G  M    S+  ++  R   VE E+               P+  +D++ A  +D +V  
Sbjct: 9   SGGYMQPDQSSNASMHKRDLRVEEEI--------------KPLDDMDSKGAVAADGEV-- 52

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLT 119
                  L++ FS   I GV F +      I++++  G+S+G P+ + +G  I   + + 
Sbjct: 53  ------HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISIC 106

Query: 120 IGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 179
           IG +L ELSS+ P AG  +    + AP + ++  +Y  G         +  S    +A +
Sbjct: 107 IGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATE 166

Query: 180 ILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239
           ++    +++P F    P  + +F    +    L        S     S    + L+  F 
Sbjct: 167 VVGMYALTHPEFI---PKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFT 223

Query: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHM 299
           I + +      K    FND  F+F   +N + W  G    I G++   W+    D   HM
Sbjct: 224 ITITVLACSHGK----FNDAKFVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCATHM 279

Query: 300 AEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDA 359
           A E     R +P  I+G++++ ++  +   I +   +  ++D VL+S  G  +  I   A
Sbjct: 280 AFEVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSIQ-DLDAVLSSTTGAPILDIYNQA 338

Query: 360 LGKRWTLGFLSIFII-CQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVR 418
           LG +    FL   I+   F    +     +R  W+FARD+G+P S  + +V+  TGVP+ 
Sbjct: 339 LGNKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFARDNGLPLSRLWSQVNPHTGVPLN 398

Query: 419 AVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYL 478
           A                    A  +L +  +A + ++ I P+   L   KR+   GPF+L
Sbjct: 399 AHLMSCAWITLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVICLLA-KKRNIAHGPFWL 457

Query: 479 GDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538
           G  +    N                P    V    MNY  V+  G+   S++Y   W+  
Sbjct: 458 GK-FGFFSNIVLLGWTVFSVVFFSFPPVLPVTKDNMNYVCVVIVGYTAYSILY---WK-- 511

Query: 539 FYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKD 574
            Y+G K      EF      +   A  SNN  T +D
Sbjct: 512 -YKGKK------EFHALEESENEQAEYSNNFDTIED 540

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 132/557 (23%), Positives = 239/557 (42%), Gaps = 27/557 (4%)

Query: 32  ELRTITSAHGAPIRFVDARSATSD---KQVLAELGYKEELKREFSSIQIFGVAFSIMGLL 88
           E  + T  H   +R  +    + D   K V+A  G +  L++ FS   I GV F +    
Sbjct: 16  EQSSNTHIHKRDVRVEEEIKPSDDMDGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSW 74

Query: 89  PSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQ 147
             I++++  G+S+G P+ + +G  I   + + IG +L ELSS+ P AG  +    + AP 
Sbjct: 75  FGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSAYPHAGGQFWWSLKLAPP 134

Query: 148 RVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACII 207
           + ++  +Y  G         +  S    +A +++    + +P F    P  + +F  C  
Sbjct: 135 KYKRFAAYMCGSFAFAGSVFTSASTTLSVATEVVGMYALMHPEFT---PKRWHIFV-CFE 190

Query: 208 AMTILTSMPTKFTSRMQTISIVSNVFLIILFF-IAVPIGVSRSDKLGRHFNDGHFIFGKN 266
            + +   +   +   +  IS  S    +  FF I + +      K    FND  F+F   
Sbjct: 191 LLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACSHGK----FNDAKFVFATF 246

Query: 267 DNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGW 326
            N + W  G    I G++   W+    D   HMA E     R +P  I+G++++ ++  +
Sbjct: 247 YNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSF 306

Query: 327 LICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVA 386
              I +   +  ++  VL+S  G  +  I   ALG +    FL   I+   L     V+A
Sbjct: 307 CYVIAMFFSIK-DLSAVLSSTTGAPILDIYNQALGNKSGAIFLGCLIL---LTSFGCVIA 362

Query: 387 ----NSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASG 442
                +R  W+FARD+G+P S ++ +V+   GVP+ A                    A  
Sbjct: 363 CHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWISLIGLLYLASSTAFQ 422

Query: 443 ALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXX 502
           +L +  +A + ++ I P+   L   KRD   GPF+LG  +    N               
Sbjct: 423 SLITGCIAFLLLSYIIPVVCLLA-KKRDIAHGPFWLGK-FGFFSNIVLLGWTIFSVVFFS 480

Query: 503 XPSDATVDPSTMNYTVVIGPGFWVLSLIY-YFVWQRKFYQGPKSNLTDEEF-QEYVGEDV 560
            P    V    MNY  V+  G+   SL+Y +F  +++F+   +S     +F   +  ED 
Sbjct: 481 FPPVLPVTKDNMNYVCVVIVGYTAYSLLYWHFKGKKEFHAVEESEDEQADFANNFENEDS 540

Query: 561 ID-AIISNNVATQKDRM 576
            + ++++++V  + + +
Sbjct: 541 QEFSLVASDVEVENEHV 557

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score =  130 bits (328), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 135/524 (25%), Positives = 225/524 (42%), Gaps = 23/524 (4%)

Query: 49  ARSATSDKQVLAELGYKEE----LKREFSSIQIFGVAFSIMGLLPSI-ASTLDGGLSAGP 103
           + + + D ++L++   +++    L++ FS   I GV F +      I AS + G  S GP
Sbjct: 22  SNTPSKDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGGP 81

Query: 104 VGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTL 163
           + + +G  I   + + IG++L ELSS+ P AG  +    Q A  + ++  +Y  G     
Sbjct: 82  MMIVYGIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCGSFAYA 141

Query: 164 SLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRM 223
               +  S    +A  ++    +++ +F    P  + VF    +    L        S  
Sbjct: 142 GSVFTSASTTLSVATLLVGMYSLTHENFI---PKRWHVFVCFELVHLFLMLFNCYGKSLP 198

Query: 224 QTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGM 283
              S    + L   F I + +    S K    FND  F+F    N + W       I G+
Sbjct: 199 LISSSSLYISLFSFFTITITVLACSSGK----FNDSKFVFATFYNETGWKSSAIAFIVGL 254

Query: 284 MPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNV 343
           +   W+    D   HMA E     R +P  I+G+I++ ++  +   I +   +  NI +V
Sbjct: 255 INPAWSFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFLTSFAYVISMFFSIR-NIQDV 313

Query: 344 LNSEFGQGMTQIIYDALGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGI 400
           LNS  G  + +I   ALG +     LG L +F     ++   T  A  R  W+FARD G+
Sbjct: 314 LNSNSGAPILEIYNQALGNKAGAVILGCLVLFTSFGCVIACHTWQA--RLCWSFARDKGL 371

Query: 401 PFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPI 460
           P+S F+ +V+ T GVP+ A                    A  +L +  +A + ++   P+
Sbjct: 372 PYSRFWSQVNPTFGVPLHAHLMSCTLISIIGLLYLASSTAFNSLITACIAFLLLSYSIPV 431

Query: 461 TLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVI 520
            + L   KRD   GPF+LG  +    N                PS   V+ + MNY  V+
Sbjct: 432 -ICLLLRKRDMNRGPFWLGK-FGLFSNIVLLAWTVFSLVFFSFPSQIPVNRNNMNYVSVV 489

Query: 521 GPGFWVLSLIYYFVW-QRKFYQGPK--SNLTDEEFQEYVGEDVI 561
             G+   S+ Y+FV  + +FY      S+ ++EE      EDVI
Sbjct: 490 IAGYTFFSVSYWFVKGKNEFYLDDNIISSSSEEEADIVTREDVI 533

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  128 bits (321), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 123/497 (24%), Positives = 216/497 (43%), Gaps = 25/497 (5%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGG-LSAGPVGLGWGWFIAGGLVLTIGIALA 125
            L+++FS   I GV F +      I++++  G +S GP+ + +G  I   + + I ++L 
Sbjct: 46  HLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSLG 105

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS+ P AG  +    + AP + ++  +Y  G L       +  S    +A +I+    
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGMYA 165

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245
           +++P F V    T+  F    + + +          +   +   S++++ +  FI + I 
Sbjct: 166 LTHPEFEVKRWHTFVCFEVLHLFLMLFNCY-----GKALPLISSSSLYISLFSFITITIT 220

Query: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305
           V      G+ +ND  F+F    N + W       I G++   W+    D   HMA E   
Sbjct: 221 VLACSH-GK-YNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEK 278

Query: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRW- 364
             R +P  I+G++++ ++  +   I +   +  N+D V+NS     +  I Y ALG +  
Sbjct: 279 PERVIPISILGTVAIGFVTSFCYVIAMFFSLQ-NLDKVVNSNTQVPILDIYYQALGSKAG 337

Query: 365 --TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWX 422
              LG L +F     ++   T  A  R  W+FARD+G+PFS ++ +VS   GVP+ A   
Sbjct: 338 AIVLGCLLLFTSFGCVIACHTWQA--RLCWSFARDEGLPFSRYWARVSPELGVPLNAHLM 395

Query: 423 XXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVW 482
                            A  +L +  +  + ++   P+   L   KR+ + GPF+LG  +
Sbjct: 396 SSFWIVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVC-LLLKKRNIKHGPFWLGK-F 453

Query: 483 SPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQG 542
               N                PS   V    MNY  V+  G+ + SL++   WQ   ++G
Sbjct: 454 GCFSNVVLLGWMLFSIVFFCFPSQMPVVKDNMNYASVVIVGYLLFSLLF---WQ---FRG 507

Query: 543 PKSNLTDEEFQEYVGED 559
                T    +E  GED
Sbjct: 508 RH---TFHALEEEAGED 521

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  129 bits (323), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 118/485 (24%), Positives = 210/485 (43%), Gaps = 21/485 (4%)

Query: 55  DKQVLAELGYKE-ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFI 112
           D+Q+   +G  E  L++ FS+  I GV F +      I+++L  G+S+G P+ + +G  I
Sbjct: 46  DQQLNHHVGDGEVHLRKSFSAWSILGVGFGLTNSWFGISTSLVTGISSGGPLMVVYGIII 105

Query: 113 AGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
              + + +G++L ELSS+ P AG  +    + AP + RK  +Y  G         +  S 
Sbjct: 106 IALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPPKHRKFAAYLCGSFAYAGSVFTSAST 165

Query: 173 VYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
              +A +++    + +P F    P  + VF  C   + +   +   +   +  IS  S  
Sbjct: 166 TLSVATEVVGMYALKHPEFK---PQRWHVFI-CFELLHLFLMLFNCYGKSLPLISSSSLY 221

Query: 233 FLIILFF-IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIG 291
             +  FF I V +    S K    FND  F+F    N + W       I G++   W+  
Sbjct: 222 ISLTSFFTITVTVLACSSGK----FNDSKFVFASFYNETGWKNNGIAFITGLINPAWSFS 277

Query: 292 AYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQG 351
             D   HMA E     + +P  I+G+I++ ++  +   I +   +  ++D +LNS  G  
Sbjct: 278 CLDCATHMAFEVEKPEKIIPLAIMGTIAIGFVTSFCYVIAMFFSIR-DLDKLLNSTTGAP 336

Query: 352 MTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVA----NSRQFWAFARDDGIPFSNFFK 407
           +  I   ALG      FL   I+         V+A     +R  W+F+R+ G+P+S+ + 
Sbjct: 337 ILDIFNQALGNSSGAIFLGCLIL---FTSFGCVIACHTWQARLCWSFSRNKGLPYSHLWS 393

Query: 408 KVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYG 467
           +V+   GVP+ A                    A  +L +  +A + ++ I P+ + L   
Sbjct: 394 QVNPNVGVPLNAHLMSCALISIIGVLYIASSTAFNSLITACIAFLLLSYIIPV-ICLLLK 452

Query: 468 KRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVL 527
           +R  + GPF+LG  +    N                P    V    MNY  V+  G+ + 
Sbjct: 453 RRQIKHGPFWLGK-FGLFSNIVLLCWTIFAIVFFSFPPQLPVTKDNMNYVSVVIVGYSIY 511

Query: 528 SLIYY 532
           +++Y+
Sbjct: 512 AILYW 516

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  127 bits (319), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 127/512 (24%), Positives = 224/512 (43%), Gaps = 27/512 (5%)

Query: 63  GYKEE--LKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLT 119
           G  EE  L++ FS   I GV F +      I+++L  GLS+G P+ + +G  +   + +T
Sbjct: 46  GGSEEVVLRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLISIT 105

Query: 120 IGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 179
           IG++L EL+S+ P AG  +    + AP + ++  +Y  G         +  S    +A +
Sbjct: 106 IGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTLSVASE 165

Query: 180 ILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239
           +++   +++  F    P  + VF   +I    L     +F    +++ ++++  L I   
Sbjct: 166 LVAMYQLTHEDFT---PKRWQVFVTYLILHFFLM----QFNCYGKSLPLIASSSLYISLL 218

Query: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHM 299
             + I ++       HFN   F+F    N + W+ G    I G++   W+    D   HM
Sbjct: 219 SFIVITITVLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCATHM 278

Query: 300 AEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDA 359
           A E       +P  I+G+I++ +I  +   I L   +  ++ +VLN+  G  +  I   A
Sbjct: 279 AFEVEKPETIIPTAILGTIAIGFITSFCYVISLFFSIR-DLPSVLNNTGGFPVLVIYEQA 337

Query: 360 LGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVP 416
           L  +     LG L +F     ++ + T    SR  W+F+RD G+PF+  + KV++  GVP
Sbjct: 338 LNSKAGAIVLGCLILFTSFGCVIASHT--WQSRLCWSFSRDGGLPFAGLWSKVNSRMGVP 395

Query: 417 VRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPF 476
           + A                    A  +L +  +A + ++   P+ + L   KR    GPF
Sbjct: 396 LNAHLMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPV-ICLLMKKRQIAHGPF 454

Query: 477 YLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQ 536
           + G  +    N                P D  V+   MNY  V+  G+++ SLIY+  W 
Sbjct: 455 WFGK-FGLFCNIALLLWTVFCLVFFSFPPDYPVNKDNMNYVSVVIVGYFLYSLIYWKFWA 513

Query: 537 RKFY---------QGPKSNLTDEEFQEYVGED 559
            K +         Q     +++E F EY G D
Sbjct: 514 SKDFHTHDDDDDEQTVAQEISNEGFDEYDGTD 545

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  126 bits (316), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 127/528 (24%), Positives = 220/528 (41%), Gaps = 31/528 (5%)

Query: 17  KNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQ 76
           K+  S  E +   + E+ T  S  GA               ++ E G +  L++ FS   
Sbjct: 4   KSLSSAYEADRTSLSEVHTRESHKGA--------LEYGKDTMMTERGGEVHLRKSFSLWS 55

Query: 77  IFGVAFSIMGLLPSIA-STLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
           I GV F +      I+ S + G  S GP+ + +G  I   + + +G +L ELSS+ P AG
Sbjct: 56  ILGVGFGLTNSWFGISVSMVTGIFSGGPMMIVYGIIIVALISICVGASLGELSSAYPHAG 115

Query: 136 AVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTN 195
             +    + AP + ++  +Y  G         +  S     A +++    +++P F    
Sbjct: 116 GQFWWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSAATEVVGMYALAHPDFT--- 172

Query: 196 PITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRH 255
           P  + VF  C   M +  ++   +   +  IS  S +++ +L F  + + V      G+ 
Sbjct: 173 PKRWHVFV-CFEIMHLFLTLFNCYGKSLPLIS-ASALYISLLSFFTITVTVLACSS-GK- 228

Query: 256 FNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIV 315
           FND  F+F    N + W       I G++   W+    D   HMA E     R +P  I+
Sbjct: 229 FNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 288

Query: 316 GSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIIC 375
           G++++ +   +   I +   +  ++D+++ S  G  +  I   ALG   T G  +IF+ C
Sbjct: 289 GTVAIGFATSFCYVISMFFSIR-DLDSLMQSATGAPILDIYNQALGN--TSG--AIFLGC 343

Query: 376 QFLMGA-STVVA----NSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXX 430
             L  +   ++A     +R  W+FARD G+PFS    +V+   GVP+ A           
Sbjct: 344 MVLFTSFGCIIACHTWQARLGWSFARDKGLPFSGLLSQVNPQVGVPLNAHLMSCALISLI 403

Query: 431 XXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXX 490
                    A  +L +  +A + ++   P+ + L   KR  + GPF+ G +     N   
Sbjct: 404 GLLYLASSTAFNSLCTGCIAFLLLSYSIPV-ICLLRKKRQIKHGPFWFGKL-GYFFNIVL 461

Query: 491 XXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538
                        P    V    MNY  V+  GF   +L+Y   W+ K
Sbjct: 462 LGWAVFCIVFFSFPPALPVTKDNMNYVSVVIVGFTAYALLY---WKFK 506

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  126 bits (316), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 120/501 (23%), Positives = 217/501 (43%), Gaps = 20/501 (3%)

Query: 48  DARSATSDKQVLAE---LGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-P 103
           +   + SDK+ + +    G +  L++ FS   I GV F +      I+++L  G+S+G P
Sbjct: 38  ENDHSISDKKEIQQGGGNGDEVHLRKSFSLWSILGVGFGLTNSWFGISASLVTGISSGGP 97

Query: 104 VGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTL 163
           + + +G  I   + + +G++L ELSS+ P AG  +    + APQ+ ++  +Y  G     
Sbjct: 98  MMVVYGIIIIALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPQKHKRFAAYLCGSFAYA 157

Query: 164 SLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRM 223
               +  S    +A +++    +++P F    P  + VF    +   +L      F    
Sbjct: 158 GSVFTSASTTLSVATELVGMYSLTHPEFI---PQRWHVF----VCFELLHLFLMLFNCYG 210

Query: 224 QTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGM 283
           +++ ++S   L I     + I V+       +FND  F+F    N + W       I G+
Sbjct: 211 KSLPLISTTSLYISLASFLTITVTVLGCSHGNFNDPKFVFATFYNQTGWKNSVIAFITGL 270

Query: 284 MPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNV 343
           +   W+    D   HMA E     R +P  I+G+I++ ++  +   I +   +  ++D +
Sbjct: 271 INPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIR-DLDAL 329

Query: 344 LNSEFGQGMTQIIYDALGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGI 400
             S  G  +  I   ALG +     LG L +F     ++   T  A  R  W+F+RD G+
Sbjct: 330 FASHTGAPILDIYNQALGNKGGAIVLGCLILFTSFGCVIACHTWQA--RLCWSFSRDKGL 387

Query: 401 PFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPI 460
           P+S+ + +V+   GVP+ A                    A  +L +  +A + ++ I P+
Sbjct: 388 PYSHLWAQVNPQLGVPLNAHLMSCAWISLIGILYIASTTAFNSLITGCIAFLLLSYIIPV 447

Query: 461 TLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVI 520
              L   KR  + GPF+LG  +    N                P    V    MNY  V+
Sbjct: 448 ICLLK-KKRQIKHGPFWLGK-FGLFSNIVLLGWTLFAIVFFSFPPQLPVTKDNMNYVSVV 505

Query: 521 GPGFWVLSLIYY-FVWQRKFY 540
             G+ +  LIY+ F   ++F+
Sbjct: 506 IVGYTLYVLIYWKFKGSKEFH 526

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  125 bits (315), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 118/484 (24%), Positives = 215/484 (44%), Gaps = 24/484 (4%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALA 125
            L++ FS   I GV F +      I++++  G+S+G P+ + +G  I   + + IG +L+
Sbjct: 54  HLRKSFSVWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLS 113

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS+ P AG  +    + AP + ++  +Y  G         +  S    +A +++    
Sbjct: 114 ELSSAYPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYA 173

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG 245
           +++P F V     + +F  C   + +L  +   +   +  IS  S++++ ++ F  + + 
Sbjct: 174 LTHPDFKVQR---WHIFV-CFELLHLLLMLFNCYGKSLPFIS-ASSLYISLVSFFTITVT 228

Query: 246 VSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD 305
           V        +FND  F+F    N + W  G    I G++   W+    D   HMA E   
Sbjct: 229 VLACSH--GNFNDPKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEK 286

Query: 306 AVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWT 365
             R +P  I+G+I++ +   +   I +   +  ++D +L S  G  +  I    LG +  
Sbjct: 287 PERVIPIAIMGTIAIGFATSFCYVIAMFFSLR-DLDKILTSTTGAPILDIYNQVLGNKSG 345

Query: 366 LGFLSIFIICQFLMGA-STVVA----NSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
               +IF+ C  L  +   V+A     +R  W+FARD+G+P+S+ + +V+   GVP+ A 
Sbjct: 346 ----AIFLGCLVLFTSFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAH 401

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
                              A  +L +  +A + ++ I P+ + L   KR  R GPF+LG 
Sbjct: 402 LMSCAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLMKKRQIRHGPFWLGK 460

Query: 481 --VWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538
             ++S II                 P    V    MNY  V+  G+   +L+Y+    RK
Sbjct: 461 FGLFSNII---LLAWTAFAIIFFSFPPVLPVTKDNMNYVAVVIVGYTSYALLYWRFKGRK 517

Query: 539 FYQG 542
            +  
Sbjct: 518 EFHA 521

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  125 bits (314), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 125/556 (22%), Positives = 228/556 (41%), Gaps = 34/556 (6%)

Query: 3   GNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAEL 62
           G+ M    S+ + +  R   VE E+  + ++                    + K V+A  
Sbjct: 10  GDYMVPDQSSNNYVHKRDLRVEEEMKPLDDM--------------------NGKGVVAGD 49

Query: 63  GYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIG 121
           G +  L++ FS   I GV F +      I++++  G+S+G P+ + +G  I   + + IG
Sbjct: 50  G-EVHLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIG 108

Query: 122 IALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQIL 181
            +L ELSS+ P AG  +    + AP + ++  ++  G         +  S    +A +++
Sbjct: 109 TSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVATEVV 168

Query: 182 SAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIA 241
               + +  F    P  + +F    +    L        S     S    + L+  F I 
Sbjct: 169 GMYALMHSEFT---PKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTIT 225

Query: 242 VPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAE 301
           + +      K    FND  F+F    N + W  G    I G++   W+    D   HMA 
Sbjct: 226 ITVLACSHGK----FNDSKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAF 281

Query: 302 EARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALG 361
           E     R +P  I+G+I++ ++  +   I +   +  ++D +L+S  G  +  I   ALG
Sbjct: 282 EVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIK-DLDGILSSTTGAPILDIYNQALG 340

Query: 362 KRWTLGFLSIFII-CQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
            +    FL   I+   F    +     +R  W+F+RD+G+P S  + +V+  TGVP+ A 
Sbjct: 341 NKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNPHTGVPLNAH 400

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
                              A  +L +  +A + ++ I P+   L   KRD   GPF+LG 
Sbjct: 401 LMSCAWISLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLN-KKRDIAHGPFWLGK 459

Query: 481 VWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYY-FVWQRKF 539
            +    N                P    V    MNY  V+  G+   S++Y+ +  +++F
Sbjct: 460 -FGFFSNIVLLGWTLFAVVFFSFPPVLPVTKDNMNYVCVVIVGYTAYSILYWKYKGKKEF 518

Query: 540 YQGPKSNLTDEEFQEY 555
           +   +S +   +F  +
Sbjct: 519 HAVEESEIDQTDFANH 534

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  124 bits (310), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 134/553 (24%), Positives = 234/553 (42%), Gaps = 30/553 (5%)

Query: 24  EVEVGQVRELRTITSAHGAPIRFVDARSATSDK-------QVLAELGYKEE--LKREFSS 74
           + ++ +  E+ TI  A+     F    S +S K        +  E    EE  L++ FS 
Sbjct: 5   DQKLQKNSEVYTIVEANDDTASFNQLGSVSSSKISDLDKNSINNEFNQTEEVHLRKSFSL 64

Query: 75  IQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
             I GV F +      I++++  G+ S GP+ + +G  I   + + +G++L ELSS+ P 
Sbjct: 65  WSILGVGFGLTNSWFGISASMVTGIESGGPMMIVYGIIIISLISICVGVSLGELSSAYPH 124

Query: 134 AGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNV 193
           AG  +    + AP + R+  +Y  G         +  S    +A +++    + + SF  
Sbjct: 125 AGGQFFWSLKLAPPKHRRFAAYMCGSYAYAGSVFTSASTTLSVATELVGMYALCHESFV- 183

Query: 194 TNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF-IAVPIGVSRSDKL 252
             P  + VF  C   + +   +   +   +  IS  S    ++ FF I + +      K 
Sbjct: 184 --PRRWHVFV-CFELLHLFLLLFNCYGKSLPFISSSSLYISLLSFFTITITVLACAHGK- 239

Query: 253 GRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPF 312
              +ND  F+F    N + W  G    I G++   W+    D   HMA E     R +P 
Sbjct: 240 ---YNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPM 296

Query: 313 GIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRW---TLGFL 369
            I+G+I++ +I  +   I +   ++ +++ + NS  G  +  I   AL  +     LG L
Sbjct: 297 AIMGTIAIGFITSFCYVIAMFFSLN-DLNALFNSHTGAPILDIYNQALHNKAGAIVLGCL 355

Query: 370 SIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXX 429
            +F     ++   T  A  R  W+FA D G+P+S ++ +V+ T GVP+ A          
Sbjct: 356 VLFTSFGCVIACHTWQA--RLCWSFATDQGLPYSKWWAEVNPTLGVPLNAHLMSCGWIAI 413

Query: 430 XXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWX 489
                     A  +L +  +A + ++ I P+ + L   KR  + GPF+LG  +    N  
Sbjct: 414 IGLLYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLQKKRQIKHGPFWLGK-FGLFSNIV 471

Query: 490 XXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTD 549
                         P +  V+ + MNY  V+  GF    LIY   W+ K  +   S   D
Sbjct: 472 LLCWTLFSIVFFSFPPNLPVNRNNMNYVCVVIVGFTCYQLIY---WKWKGAKEFHSAQDD 528

Query: 550 EEFQEYVGEDVID 562
           ++  EY     I+
Sbjct: 529 DDNIEYENNSNIN 541

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  122 bits (307), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 116/480 (24%), Positives = 206/480 (42%), Gaps = 19/480 (3%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALA 125
            L++ FS   I GV F +      I++++  G+ S GP+ + +G  I   + + IG++L 
Sbjct: 43  HLRKSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLG 102

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS+ P AG  +    + AP + ++  +Y  G         +  S     A +++   +
Sbjct: 103 ELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSLFTSASTTLSAATELVGMYV 162

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVS-NVFLIILFFIAVPI 244
           +++P F    P  + +F  C   + +   +   +   +  IS  S  + L   F I V +
Sbjct: 163 LTHPEFT---PKRWHIFV-CFELLHLFLMLFNCYGKSLPLISASSLYISLTSFFVITVTV 218

Query: 245 GVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEAR 304
               S K    FND  F+F    N + W       I G++   W+    D   HMA E  
Sbjct: 219 LACSSGK----FNDAKFVFATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVE 274

Query: 305 DAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRW 364
              R +P  I+G+I++ ++  +   I +   +  ++D +L S  G  +  I   A   + 
Sbjct: 275 KPERVIPIAIMGTIAIGFLTSFCYVIAMFFSIR-DLDALLASNTGAPILNIYEQATNSKA 333

Query: 365 ---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVW 421
               LG L   +I  F    +     +R  W+FARD+G+P+S ++ +V+   GVP+ A  
Sbjct: 334 GAIVLGCL--VLITSFGCIIACHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHL 391

Query: 422 XXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDV 481
                             A  +L +  +A + ++ I P+ + L   KR  R GPF+LG  
Sbjct: 392 MSSALIALIGVLYLASTTAFNSLITGCIAFLLLSYIIPV-ICLLMRKRQIRQGPFWLGK- 449

Query: 482 WSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYY-FVWQRKFY 540
           +    N                P    V    MNY  V+  G+ V ++ Y+ F  +++F+
Sbjct: 450 FGLFSNIVLLGWTLFAIVFFSFPPVLPVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEFH 509

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 124/526 (23%), Positives = 218/526 (41%), Gaps = 22/526 (4%)

Query: 38  SAHGAPIRFVDARSATSDKQVLAE------LGYKEELKREFSSIQIFGVAFSIMGLLPSI 91
           S H    R    + + +D + L++      L  +  L++ FS   I GV F +      I
Sbjct: 18  SVHKRQSRVSLTQLSLNDDESLSKGAADTLLDGEPHLRKSFSLWSILGVGFGLTNSWFGI 77

Query: 92  A-STLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVR 150
           + S + G +S GP+ + +G  I   + + +G +L ELSS+ P AG  +    + AP R R
Sbjct: 78  SVSMVTGIMSGGPMMIVYGIIIIALISVCVGGSLGELSSAYPHAGGQFWWALKLAPARHR 137

Query: 151 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMT 210
           +  ++  G         +  S       +++    + +P F V     +  F    + + 
Sbjct: 138 RFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGMYALKHPGFVVKRWHVFVCFELIHLFLM 197

Query: 211 ILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLS 270
           +          +   +   S++++ ++ F+ + I V         FND  F+F    N +
Sbjct: 198 LFNCY-----GKSLPLISSSSLYISLISFLTITITVLACSS--GSFNDSKFVFATFYNET 250

Query: 271 SWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICI 330
            W       I G++   W+    DS  HMA E     R +P  I+G++++ ++  +   I
Sbjct: 251 GWKNSGMAFIMGLINPAWSFSCLDSATHMAFEVERPERVIPTAIMGTVAIGFVTSFCYVI 310

Query: 331 VLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFII-CQFLMGASTVVANSR 389
            +   +  +I  VL S  G  + +I   ALG      FL   ++   F    S     +R
Sbjct: 311 AMFFSIR-DISAVLKSTTGAPILEIYRQALGNEGGAIFLGCLVLFTSFGCIISCHTWQAR 369

Query: 390 QFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSV 449
             W+F+RD+G+P+S ++ +V+   GVP+ A                    A  +L +  +
Sbjct: 370 LCWSFSRDNGLPYSKWWSQVNPDVGVPLNAHLMSCAWISLIGVLYLASSTAFNSLITACI 429

Query: 450 AGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATV 509
           A + ++   PI   L + +RD   GPF+LG  +    N                P    V
Sbjct: 430 AFLLLSYSVPIVC-LLWRRRDIPQGPFWLGK-FGLFANVVLLAWTVFAVVFFSFPPVLPV 487

Query: 510 DPSTMNYTVVIGPGFWVLSLIYY-FVWQRKFYQ---GPKSNLTDEE 551
           D + MNY  V+  GF   SL+Y+ F   R F++    P   L D E
Sbjct: 488 DRNNMNYVCVVIVGFVTYSLLYWRFKGSRDFHKVEDEPGEKLVDAE 533

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  117 bits (292), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 125/516 (24%), Positives = 225/516 (43%), Gaps = 33/516 (6%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALA 125
            L++ FS   + GV F +      I++++  G+S+G P+ + +G  I   + + IG +L 
Sbjct: 67  HLRKSFSLWSVLGVGFGLTNSWFGISTSMVTGISSGGPMMVIYGIIIIALISICIGTSLG 126

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVL 185
           ELSS+ P AG  +    + AP + ++  +Y  G         +  S     A +++    
Sbjct: 127 ELSSAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATEVVGMYA 186

Query: 186 VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVS--NVFLIILFFIAVP 243
           +++  F    P  + VF    +   IL      F    +++ I+S  ++++ +  F+ + 
Sbjct: 187 LTHEDFV---PKRWHVF----VCFEILHLFLMIFNCYGKSLPIISASSLYISLSSFLIIT 239

Query: 244 IGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA 303
           I V    +    FND  F+F    N + W       I G++   W+    D   HMA E 
Sbjct: 240 ITVLACSR--GQFNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEV 297

Query: 304 RDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKR 363
               R +P  I+ +I++ +I  +   I +   +  ++D++L S  G  +  I   ALG +
Sbjct: 298 EKPERVIPIAILSTIAIGFITSFCYVISMFFSLR-DLDSILKSTTGAPILDIYNQALGNK 356

Query: 364 W---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
                LG + +F     ++   T  A  R  W+FARD+G+P+S  + +V+   GVP+ A 
Sbjct: 357 AGAIILGCMILFTSFGCVIACHTWQA--RLGWSFARDNGLPYSKLWAQVNPQVGVPLNAH 414

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480
                              A  +L +  +A + ++ I P++  L   KR  R GPF+LG 
Sbjct: 415 LMSCAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVSC-LLLKKRQIRHGPFWLGK 473

Query: 481 VWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFY 540
            +    N                P+   V    MNY  V+  G+ + S++Y   W  K Y
Sbjct: 474 -FGLFSNIVLLLWTVFAIVFFSFPAMMPVTKDNMNYVAVVIAGYTLYSVLY---WNFKGY 529

Query: 541 QGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRM 576
           +   ++  +EE QEY          +N+++T  D M
Sbjct: 530 KEFHASEEEEEQQEY----------ANDISTNGDGM 555

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  116 bits (290), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 128/526 (24%), Positives = 214/526 (40%), Gaps = 33/526 (6%)

Query: 47  VDARSATSDKQVLAELGYKE-ELKREFSSIQIFGVAFSIMGLLPSIA-STLDGGLSAGPV 104
           ++ +S +S     A  G  E  L++ FS   I GV F +      I+ S + G  S GP+
Sbjct: 35  LEEQSISSKDAYDAYGGTGEGHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSGGPM 94

Query: 105 GLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
            + +G  I   + + I + L ELSS+ P AG  +    Q AP + R+  +Y  G      
Sbjct: 95  MVVYGIIIIALISICIAVTLGELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCGSFAWAG 154

Query: 165 LCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQ 224
              S  S    +A +++    +++P F V     + VF    +   IL      F    +
Sbjct: 155 AIFSSASTTLSVASELVGMYALTHPDFEVKR---WHVF----VCFQILHLFLMMFNCSGK 207

Query: 225 TISIVSN----VFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCI 280
            + ++S     + LI  F I V +      K    +ND  F+F    N + W  G    I
Sbjct: 208 ALPVISQSSLYISLISFFTITVTVLACSHGK----YNDAKFVFATFYNETGWKNGVIAFI 263

Query: 281 AGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNI 340
            G++   W+    D   HMA E  +  R +P  I+ ++ + ++  +   I +   +  ++
Sbjct: 264 VGLINPAWSFSCLDCATHMAFEVENPERVIPISILCTVGIGFLTSFSYVIAMFFSLQ-DL 322

Query: 341 DNVLNSEFGQGMTQIIYDALGKR---WTLGFLSIFIICQFLMGASTVVANSRQFWAFARD 397
           + V +S  G  + +I   A         LG L +F     ++   T  A  R  W+FARD
Sbjct: 323 EAVASSNTGMPILEIFRQATKSTPGAVVLGCLILFTSFGCVIACHTWQA--RLCWSFARD 380

Query: 398 DGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALI 457
           +GIP+S ++ K+    GVP+ A                    A  +L +  +A +  +  
Sbjct: 381 NGIPYSKYWAKIDPELGVPLNAHLLSCALISLLGCLYMASTTAFNSLITGCIAFLLFSYS 440

Query: 458 FPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYT 517
            P+   L   KR+ + GPF+LG  +    N                P+   V    MNY 
Sbjct: 441 VPVVCLLAR-KRNIKHGPFWLGK-FGAFSNIVLLGWNLFALVFFCFPAVMPVTKDNMNYA 498

Query: 518 VVIGPGFWVLSLIYY-FVWQRKFYQGPKSN-------LTDEEFQEY 555
            V+  GF +  L ++ F  ++ FY     N       +T E F  Y
Sbjct: 499 SVVIVGFLLFYLGFWQFKAKKVFYIREDENTDSNQESVTTEAFHAY 544

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 113/529 (21%), Positives = 229/529 (43%), Gaps = 19/529 (3%)

Query: 51  SATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGW 108
           + T   Q +    Y ++L +   S   + G+ F +M  +  + +++  GL + GP  + W
Sbjct: 37  AETEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLMSPVLGMCTSMAIGLMNGGPATIMW 96

Query: 109 GWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCAS 168
           G+ I+G +V    ++L E+ S  P    ++VS    AP++++   S+  G+L  +     
Sbjct: 97  GFLISGIMVWFCSLSLGEIVSKFPM--ELHVSSAMLAPKKLKLICSWYTGWLTLIGNWTM 154

Query: 169 VCSIVYGLAQQILSAVLVSNPSF-NVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTIS 227
             SI +  AQ  +S +L++N    + TN I + V    ++ +TI+  +  K    ++ I+
Sbjct: 155 STSITFAGAQLTISLILMANNDLISETNLIFFTVIVFYLV-VTIVGIVNLKLARFIEIIN 213

Query: 228 IVSNVFLII-LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPA 286
            V   ++I  + FI + +    S   G++ +    +F  +++LS +   +   I G   +
Sbjct: 214 KVCVYWIIYAILFIDILLLFFHS---GKYRSLKFALFHFDNSLSGYANCFVSFIIGFQQS 270

Query: 287 IWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNS 346
            +T+  +     +A+E ++A R +P  +  S+ +  + G++  + ++  + P+  N+   
Sbjct: 271 NFTLQGFSMLPALADEVKEAERDIPRAMSASVLISTVSGFIFLLPIMLIL-PDNTNLFAD 329

Query: 347 EFGQGMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGIPFSNF 405
                +  I   +    +   FL + I+   F  G  ++  +SR  ++F+RD  IP   F
Sbjct: 330 HKILPIVSIFTQSTHSTFVSFFLVLMILGNLFFSGIGSITTSSRVVYSFSRDHAIPKHEF 389

Query: 406 FKKV--SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLR 463
           +  V   + + VP  +V                  AA  A    +V  +  A + P+ L 
Sbjct: 390 WTYVDPQSVSKVPKYSVLLSMAVSYLLGILALFSTAAFNAFIGAAVLCLCSATVLPLVLV 449

Query: 464 LTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPG 523
           L   +R  R  P  +      I+N                PS   V   TMNY +++   
Sbjct: 450 LFTRRRILRNAPIKIHYKLGWIVNITSIVWLLLSMGSVCLPSQVPVTVRTMNYALIVYVA 509

Query: 524 FWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQ 572
             +   I YF W +  +  P   L DE+++      ++++  S+N  T 
Sbjct: 510 CLIAITILYFRWGKYHFTLP---LVDEDYKNLTS--IMESATSSNFPTN 553

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score = 95.9 bits (237), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 137/328 (41%), Gaps = 16/328 (4%)

Query: 239 FIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLH 298
           FI + I V    +   ++ND  F+F    N + W       I G++   W+    D   H
Sbjct: 25  FITITITVLACSR--GNYNDPKFVFATFFNETGWRNSGIAFIVGLINPAWSFSCLDCATH 82

Query: 299 MAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYD 358
           MA E     R +P  I+G++++ ++  +   I +   +  N+D ++ S  G  +  I   
Sbjct: 83  MAFEVERPERVIPISILGTVAIGFVTSFCYVIAMFFSLH-NLDEIVGSNTGAPILDIYLQ 141

Query: 359 ALGKRW---TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGV 415
           ALG +     LG L +F     ++   T    +R  W+FARD+G+P+S  + KVS   GV
Sbjct: 142 ALGNKAGAVVLGCLVLFTSFGCVIACHT--WQARLCWSFARDEGLPYSRIWAKVSPELGV 199

Query: 416 PVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGP 475
           P+ A                    A  +L +  +  +  + I P+   L   KR+ + GP
Sbjct: 200 PLNAHLMSCFWIVLLGLLYLASTTAFNSLITGCIMFLLFSYIVPVICLLI-KKRNIKHGP 258

Query: 476 FYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVW 535
           F+LG  +    N                P    VD   MNY  V+  G+ + SL++   W
Sbjct: 259 FWLGK-FGLFANIVLLGWSLFALVFFCFPFVMPVDKDNMNYASVVIVGYILFSLLF---W 314

Query: 536 QRKFYQGPKSNLTDEEFQEYVGEDVIDA 563
               ++G  S    EE +E V     DA
Sbjct: 315 H---FKGRHSFHLLEEEEENVFPLETDA 339

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 112/525 (21%), Positives = 214/525 (40%), Gaps = 26/525 (4%)

Query: 50  RSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLG 107
           + A  +++ +    Y+++L R F S   + G+ F +M  +  +++T+  G L+ GP+ + 
Sbjct: 31  QDADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 90

Query: 108 WGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCA 167
            G+ I G       ++L E+ S  P    ++      A Q+ +   S+  G+L  L    
Sbjct: 91  IGFLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWT 148

Query: 168 SVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTIS 227
              SI +  AQ ++S V ++N      N I      A  + +TI+  +  KF   ++T++
Sbjct: 149 MSTSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVN 208

Query: 228 ------IVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIA 281
                 IV  V  I +  +    G  RS K    +   HF    +++ S ++      I 
Sbjct: 209 KVCVYWIVYAVIFIDILLLLFHSGKYRSLK----YALAHF----DNSFSGYSSAALSFII 260

Query: 282 GMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNID 341
           G   + +T+  +     +A+E +++ R +P G+  ++    + G +  + ++  + P+  
Sbjct: 261 GFQQSSFTLQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQ 319

Query: 342 NVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGI 400
            ++N+     +  I   +    +   FL I I+   L  G  +V  +SR  ++ +RD  +
Sbjct: 320 TIINNPKVMPIALIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMAL 379

Query: 401 PFSNFFKKV--SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIF 458
           P+S F+  V  S+   VP  ++               +  AA  A    +V  +  A   
Sbjct: 380 PYSEFWSYVDPSSKHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCI 439

Query: 459 PITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTV 518
           P+ L L   +R  R  P  +       +N                P    V  S+MNY  
Sbjct: 440 PLVLVLISRRRALRGSPIKVRYRLGWFVNIASILWLVFTMVVICIPPQVPVTFSSMNYAF 499

Query: 519 VIGPGFWVLSLIYYFVWQRKFYQGP----KSNLTDEEFQEYVGED 559
           V+   F     + YF W R  ++ P     S   D     +V +D
Sbjct: 500 VVYLLFLAAITVLYFRWGRYNFKTPLISEDSRTDDTASASFVLQD 544

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 112/540 (20%), Positives = 233/540 (43%), Gaps = 24/540 (4%)

Query: 17  KNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREF-SSI 75
           +N + N+   +  +       + H     +V     T + + +    YK+EL +   S  
Sbjct: 10  ENIRENIRENMPNLDPHEIFENLH----HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRN 65

Query: 76  QIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTA 134
            + G+ F +M  +  + +++  G L+ GP+ +  G+FI+G L+    ++L E+ S  P  
Sbjct: 66  SVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFISGILIWFSSLSLGEIVSKFPM- 124

Query: 135 GAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSF-NV 193
             ++V     AP R++   S+  G+L  +       SI +  AQ  +S +L++N    + 
Sbjct: 125 -ELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTSITFAGAQLTISLILMANNELISE 183

Query: 194 TNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLG 253
           T+ I + V    ++ +T++  +  KF   ++ I+ V  V+ II   I + I +    K G
Sbjct: 184 THLILFTVIVFYMV-VTLVGLVNLKFARFIEIINKVC-VYWIIYAIIFIDILLLIFHK-G 240

Query: 254 RHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFG 313
           +  +  + +F  ++++S ++  +   + G   + +T+  +     +A+E +   + +P G
Sbjct: 241 KFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFTLQGFSMLPALADEVKKPEKDIPRG 300

Query: 314 IVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFI 373
           +  ++ +    G LI ++ +  + P+I+ + ++     +  I   +        FL + I
Sbjct: 301 MSTAVLLSTFSG-LIFLLPIMLILPDIETIFSNHKVLPIVTIFTKSTHSMVVSVFLVLLI 359

Query: 374 ICQ-FLMGASTVVANSRQFWAFARDDGIPFSNF--FKKVSNTTGVPVRAVWXXXXXXXXX 430
           +   F  G  ++  +SR  ++F+RD  IP  +   F    + + VP  ++          
Sbjct: 360 LGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDLWTFVPPDSQSRVPKYSILLSMGISYFL 419

Query: 431 XXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXX 490
                +  AA  A    +V  +  A   P+ L L  G+R  +  P  +   +   IN   
Sbjct: 420 GLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLCTGRRSIKHAPVKIRYKFGWFINIAS 479

Query: 491 XXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSL----IYYFVWQRKFYQGPKSN 546
                        P+   V    MNY +V+    +VL L    I YF W +  ++ P S+
Sbjct: 480 VLWLLLVMVSVCFPTQLPVTVKGMNYAIVV----YVLCLIGITILYFKWGKYNFRLPLSD 535

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 108/496 (21%), Positives = 214/496 (43%), Gaps = 22/496 (4%)

Query: 59  LAELGYKEEL-KREFSSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFIAGGL 116
           + E  Y ++L K   S   + G+ F +M  +  +++T+  G L+ G   + +G+ I G +
Sbjct: 72  VKEFTYVQQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGYLICGIM 131

Query: 117 VLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGL 176
                ++L+E+ S  P    ++ +    AP R+R  +S+  G+L          SI +  
Sbjct: 132 TWISSLSLSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYCGWLMLFGSWTMSTSITFAG 189

Query: 177 AQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLII 236
           AQ I+S + ++N S   +  +T        + +T++  +  KF+S ++TI+ V  V+ I+
Sbjct: 190 AQLIISLLTMTNESLIDSRWLTLWTVLMFYLIVTVVGVINLKFSSFIETINKVC-VYWIL 248

Query: 237 LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDN-LSSWNK-GWNWCIAGMMPAIWTIGAYD 294
              +     +       R F D   +F K DN LS ++    ++ I G   + +T   + 
Sbjct: 249 YAILFTSTLLLLFQPNHRSFKD---VFTKFDNSLSGYSSMALSFLIGGFQQSNFTFQGFA 305

Query: 295 SCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQ 354
               +++E     + +P+ +  S+ +  + G    I ++  + P++  V+N E   G+  
Sbjct: 306 MLSALSDETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLIL-PDVSEVMNHE---GVMP 361

Query: 355 IIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGIPFSNFFKKV 409
           I+        +L F+SIF++   L      G  +V  +SR  ++ +RD GIP+ + +  V
Sbjct: 362 IVLIFTKSTKSL-FVSIFLVLLILGNLLFSGIGSVTTSSRALYSLSRDRGIPYHHLWTYV 420

Query: 410 --SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYG 467
             ++ + VP  +V               +  AA  A    +V  +  A + PI L L + 
Sbjct: 421 DPASESKVPKYSVMLSMGVSYVLALLALISTAAFNAFVGCAVLCLCSASMLPILLSLYHR 480

Query: 468 KRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVL 527
           ++  +   F +      I N                P    V   +MNY+ V+   F ++
Sbjct: 481 RKLVKGSAFRIKYRLGYITNCLTVIWLLFTMVIISLPQKVPVTFRSMNYSSVVYFLFMIM 540

Query: 528 SLIYYFVWQRKFYQGP 543
             + Y  W    ++ P
Sbjct: 541 VTVLYDRWGIYNFRAP 556

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 101/506 (19%), Positives = 206/506 (40%), Gaps = 25/506 (4%)

Query: 57  QVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFIAG 114
           +V+ +  Y+++L +   S   + G+ F +M  +  +++T+  G L+ GP+ +  G+ + G
Sbjct: 41  EVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVG 100

Query: 115 GLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVY 174
                  ++L E+ S  P    ++      A ++ R   S+  G+L  L       SI +
Sbjct: 101 FATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITF 158

Query: 175 GLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTIS------I 228
             AQ ++S + ++N S    + + +         +T++  +  KF   ++TI+      I
Sbjct: 159 AGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCVYWI 218

Query: 229 VSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIW 288
           +  +    +  +    G  RS K    +   HF    +++LS +       + G   + +
Sbjct: 219 IYAIIFTDILLLLFHTGEYRSLK----YALAHF----DNSLSGYRSAALSFMIGFQQSNF 270

Query: 289 TIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEF 348
           T+  +     +A+E ++  R +P G+  S+ +  + G L+ ++ +  + P+   +LN++ 
Sbjct: 271 TLQGFSMLPALADEVKEPERDIPRGMSLSVVLSALSG-LVFLLPIMLILPDTSAILNNDR 329

Query: 349 GQGMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGIPFSNFFK 407
              +  I   +        FL + I+   L  G  ++  +SR  ++ +RD  +P+   + 
Sbjct: 330 VMPIVLIFTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHELWT 389

Query: 408 KV--SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLT 465
            V  ++ + VP  ++               V  AA  A    +V  +  A   P+ L L 
Sbjct: 390 YVEPASQSRVPKYSILLTMAISYVLGLLALVSTAAFNAFVGAAVLCLCSATCIPVVLVLA 449

Query: 466 YGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFW 525
             +R  R  P  +      ++N                P    V   TMNY   +   F 
Sbjct: 450 SRRRALRGSPIKVRYKLGWLVNLASVAWLVFTMFVISMPPQVPVTLVTMNYAAFVFAAFM 509

Query: 526 VLSLIYYFVWQRKFYQGPKSNLTDEE 551
           V     YF W R  ++ P   L DE 
Sbjct: 510 VGITALYFCWGRHHFRAP---LVDEN 532

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 108/533 (20%), Positives = 229/533 (42%), Gaps = 24/533 (4%)

Query: 48  DARSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGLS-AGPVG 105
           D    +S  +V   L Y+++L +   S   I G+ F +M  +  + +++  GL   GP+ 
Sbjct: 39  DESDLSSSPEVNDAL-YEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLT 97

Query: 106 LGWGWFIAGGLVLTIGIALAELSSSIPTA---GAVYVSCY---QWAPQRVRKCISYSVGF 159
           +  G+ ++G       ++L E+ S  P      +  +S Y        ++R   S+  G+
Sbjct: 98  ILIGFMVSGIFTWFCSLSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTGW 157

Query: 160 LDTLSLCASVCSIVYGLAQQILSAVLVSNPSF-NVTNPITYGVFAACIIAMTILTSMPTK 218
           L  +       SI +  AQ  +S +L+      + T+ I + V    ++ +TI+  +  K
Sbjct: 158 LMLIGNWTMSTSITFAGAQLTISLLLLMKSDLISETHLILFTVIVFYLV-VTIVGFINLK 216

Query: 219 FTSRMQTISIVSNVFLII-LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWN 277
           F+  ++TI+ +  +++   + FI V + V ++   G+  +  + +F  +++LS +   + 
Sbjct: 217 FSRFIETINKICVIWIFYAIIFIDVLLLVFQA---GKFRSLKYALFHFDNSLSGYTSAFL 273

Query: 278 WCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMD 337
             I G   + +T+  +     +A+E +   R +P G+  ++ +    G +  + ++  + 
Sbjct: 274 SFIIGFQQSNFTLQGFSMLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLIL- 332

Query: 338 PNIDNVLNSEFGQ--GMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAF 394
           P++DN+ N++      +  I   +   ++   FL   I+   L  G  ++  +SR  ++F
Sbjct: 333 PDLDNIFNNKNSNLLPIVSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSF 392

Query: 395 ARDDGIPFSNF--FKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGM 452
           +RD  +P+     F    + + VP  ++W                 AA  A    +V  +
Sbjct: 393 SRDHALPYHELWTFVDSDSVSKVPKYSIWLSMGVSYTLGLLALFSTAAFNAFVGAAVLCL 452

Query: 453 YMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPS 512
             A + P+ L L  G+R  R  P  +      I+N                P    V  S
Sbjct: 453 CTATVIPLILVLISGRRSIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFPPQIPVTFS 512

Query: 513 TMNYTVVIGPGFWVLSLIYYFVWQRKFYQGP---KSNLTDEEFQEYVGEDVID 562
           TMNY +++     ++  + YF W +  +  P   K++LT       + + ++D
Sbjct: 513 TMNYALMVYIFCLIIITVLYFQWGKNNFVLPHPMKTSLTSNPSTYAMSKSLVD 565

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 105/525 (20%), Positives = 221/525 (42%), Gaps = 17/525 (3%)

Query: 55  DKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLGWGWFI 112
           +++ +    Y+++L R F S   I G+ F++M  +  +++T++ G L+ GP+ +  G+ I
Sbjct: 36  EQEEVQAFKYEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFLI 95

Query: 113 AGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
            G       ++L E+ S  P    ++      AP   +   S+  G+L  L       SI
Sbjct: 96  NGLATWLCSLSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWTMSTSI 153

Query: 173 VYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
            +  AQ ++S V ++N        I      A  I +TI+  +  +F S ++ ++ V   
Sbjct: 154 TFAGAQLVISLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCVY 213

Query: 233 FLII-LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIG 291
           ++I  + FI + + +  S   G + +  + +F  +++ S ++      + G   + +T+ 
Sbjct: 214 WIIYAVIFIDILLLLFHS---GSYRSLKYALFHFDNSFSGYSSKALSFMIGFQQSSFTLQ 270

Query: 292 AYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQG 351
            +     +A+E +   R +P G+  ++    + G ++ ++ +  + P+   ++++     
Sbjct: 271 GFSMLPALADEVKRPERDIPKGMFTAVLTSTLTG-IVFLLPIMIILPDTKTIIDNPKLMP 329

Query: 352 MTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGIPFSNFFKKVS 410
           +  I   +    +   FL I I+   F  G  ++  +SR  ++ +RD  +P+S F+  V 
Sbjct: 330 IVLIFTQSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPYSEFWSYVD 389

Query: 411 NTTG--VPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGK 468
            T+   VP  ++               V  AA  A    +V  +  A   P+ L +   +
Sbjct: 390 PTSDHRVPKNSILLSMGISYLLGLLALVSTAAFNAFMGAAVMCLCSATCIPLVLVMMSRR 449

Query: 469 RDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLS 528
           R  R  P  +      ++N                P    V   +MNY  ++   F    
Sbjct: 450 RALRGAPVKVRYRMGWLVNIISILWLLFTMVVICWPPKLPVTLGSMNYAFLVYLLFLTGI 509

Query: 529 LIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQK 573
            + YF W +  ++ P   L  EE +    E  + +++  NV   K
Sbjct: 510 TVLYFRWGKYNFKTP---LIGEENKS--NESTLTSVVLENVEVTK 549

>NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON}
           Anc_1.173
          Length = 612

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 104/516 (20%), Positives = 209/516 (40%), Gaps = 25/516 (4%)

Query: 47  VDARSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPV 104
           +   S T + + +    Y +EL +   S   + G+ F +M  +  +++++  GL + GP 
Sbjct: 31  IHEESDTDEVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPA 90

Query: 105 GLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
            + WG+ I+G  +    ++L E+ S  P    ++VS    AP+  +   S+  G+L  L 
Sbjct: 91  TILWGFIISGICIWFCSLSLGEVVSKFPM--ELHVSSAMLAPKDAKLICSWYTGWLMLLG 148

Query: 165 LCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQ 224
                 SI +  AQ  +S +L++         +         + +T++  +  KF   ++
Sbjct: 149 NWTMSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARFIE 208

Query: 225 TISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHF------IFGKNDNLSSWNKGWNW 278
           TI+ V  V++I          +   D L   F+ G +      +F  +++LS ++  +  
Sbjct: 209 TINKVCVVWII--------YAICVIDILLLIFHQGKYRSLKFALFNFDNSLSGYSNFFVS 260

Query: 279 CIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDP 338
            I G   + +T+  +     +A+E +   + +P G+  ++ +    G +  I ++  + P
Sbjct: 261 FIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSTFSGIIFLIPIMIIL-P 319

Query: 339 NIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARD 397
           + D + ++     +  I   +   +    FL + I+   F  G  ++  +SR  ++F+RD
Sbjct: 320 DSDKLFSNNQMLPIVNIFTQSTHSKIVSLFLVLSILGNLFFSGIGSITTSSRAVYSFSRD 379

Query: 398 DGIPFSNF--FKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMA 455
             IP      F K  + + VP  ++                  AA  A    +V  +  A
Sbjct: 380 HAIPHHELWTFVKPESQSKVPKNSILLSMAISYFLGILALFSTAAFNAFIGAAVLCLCSA 439

Query: 456 LIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMN 515
              P+ L L   +R  R  P  +       +N                P    V   TMN
Sbjct: 440 TCIPLVLVLFRRRRIIRSAPVKIRYKLGWAVNIISIVWLILSMISVCFPPKIPVTWGTMN 499

Query: 516 YTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEE 551
           Y +++   F +   I Y  W +  ++ P   L DE+
Sbjct: 500 YALIVYVIFLIAITIMYLKWGKYNFKLP---LIDED 532

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 103/540 (19%), Positives = 227/540 (42%), Gaps = 25/540 (4%)

Query: 50  RSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLD-GGLSAGPVGLG 107
             A ++ ++     Y++EL +   S   + G+ F +M  +  + +++  G L+ GP  + 
Sbjct: 33  EEADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMGIGLLNGGPFTIM 92

Query: 108 WGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCA 167
           +G+ + G        +L E+ S  P    ++ +    AP  +++  S+  G+   L    
Sbjct: 93  FGFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSWLTGWFLLLGNWF 150

Query: 168 SVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACII---AMTILTSMPTKFTSRMQ 224
               + +  AQ I+S + ++N  F++ +   Y V    +I    +TI+  +  K+   ++
Sbjct: 151 MSIGVTFAGAQLIISLIAMAN--FDLISE-KYLVLYTVLIYYAVVTIVGVVNLKYAKYVE 207

Query: 225 TISIVSNVFLII-LFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGM 283
           TI+ V   ++I  + FI V + +   +K     +  + +F  ++ LS +       I G 
Sbjct: 208 TINKVCIYWIIYAVLFIDVLLLLFHRNKFR---SLPYALFHFDNELSGYRSVIISFIIGF 264

Query: 284 MPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNV 343
             + +T+  +     +A+E +   + +P G+  ++ +  ++G +    ++  + P+  ++
Sbjct: 265 QQSNFTLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFPIMVIL-PDSRDL 323

Query: 344 LNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGIPF 402
            +++    +  I   +   ++   FL + I+   F  G  ++  +SR  ++F+RD  IP+
Sbjct: 324 FSNQKVLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPY 383

Query: 403 SNFFKKV--SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPI 460
              +  V   + + VP  ++                  AA  A    +V  +  A + P+
Sbjct: 384 YRLWTYVDPQSESRVPKYSILLSMSISYILGLLPLFSNAAFNAFIGCAVLCLCSATLIPL 443

Query: 461 TLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVI 520
            L L   +R  +  P  +      I N                P    V   TMNY +++
Sbjct: 444 LLVLVTRRRVLKNAPVKIKYKLGWIANIGSVCWLLLSMFSVCLPPQIPVTAKTMNYALLV 503

Query: 521 GPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGEDVIDA------IISNNVATQKD 574
               + +  I Y+ W RK +Q P+ +      +E    DVI+       ++ ++   QKD
Sbjct: 504 FLFCFFIICILYYKWGRKHFQLPQVDKASIA-EEMSTLDVINVDQNSTPLMGSDATQQKD 562

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 115/540 (21%), Positives = 225/540 (41%), Gaps = 53/540 (9%)

Query: 47  VDARSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPV 104
           +   S  ++ +++    Y++EL +   S   I G+ F +M  +  + +++  GL + GP 
Sbjct: 28  IHEDSDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMSPVLGMCTSMAIGLINGGPA 87

Query: 105 GLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
            + WG+ I+G  +    ++L E+ S  P    ++V     AP  ++   S+  G+L  + 
Sbjct: 88  TIMWGFLISGICIWFCSLSLGEIVSKFPM--EIHVGSAMLAPASLKLISSWYTGWLMLIG 145

Query: 165 LCASVCSIVYGLAQQILSAVLVSNPSFNVTNP--ITYGVFAACIIAMTILTSMPTKFTSR 222
                 SI +  AQ  +S +L++N    + +P  + Y V    ++ +TI+  +  KF   
Sbjct: 146 NWTMSTSITFAGAQLTISLILMNNNDL-IKDPHLVLYTVIVFYLV-VTIVGLINLKFARF 203

Query: 223 MQTIS------IVSNVFLIILFFIAVPIGVSRSDKLG-RHFNDGHFIFGKNDNLSSWNKG 275
           ++TI+      I+  V  I +  +    G  RS K    HF++    +G           
Sbjct: 204 IETINKVCVYWILYAVIFIDILLLIFHKGKYRSLKYALTHFDNSRSGYG----------- 252

Query: 276 WNWCIA---GMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVL 332
            N+ I+   G   + +T+  +     +A+E R   + +P G+  ++ +    G +I ++ 
Sbjct: 253 -NFVISFIIGFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSG-IISLLP 310

Query: 333 LACMDPNIDNVLNSEFGQGMTQIIYDALGKR-----WTLGFLSIFIICQFLMGASTVVAN 387
           +  + P++D  +   F  G    I +   +       +   + + +   F  G  ++ A+
Sbjct: 311 IMIILPDMDTFI---FYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITAS 367

Query: 388 SRQFWAFARDDGIPFSNF--FKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALF 445
           SR  ++F+RD  IP  +   F K  + + VP  ++                  AA  A  
Sbjct: 368 SRSVYSFSRDHAIPGYDLWTFVKPESESKVPKNSILLSMLISYILGLLALFSTAAFNAFI 427

Query: 446 SLSVAGMYMALIFPITLRLTYGKRDFRPGP----FYLGDVWSPIINWXXXXXXXXXXXXX 501
             +V  +  A   P+ L L   +R  +  P    + LG  W   IN              
Sbjct: 428 GAAVLCLCSATCIPLVLVLFRRRRILKSAPVKIRYKLG--WG--INIFSICWLLLSMFSV 483

Query: 502 XXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEY-VGEDV 560
             P+   V   TMNY +V+     +   + YF W +  ++ PK+   D +  +Y +G DV
Sbjct: 484 CLPTRIPVTFKTMNYALVVYVVCLISITVLYFFWGKSNFRLPKA---DGQVAKYEMGSDV 540

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 103/515 (20%), Positives = 210/515 (40%), Gaps = 29/515 (5%)

Query: 46  FVDARSATSDK-----QVLAELGYKEELKREFSSIQI-----FGVAFSIMGLLPSIASTL 95
           F +  +A  D+     +V+ +  Y++EL +   S+       FG+   ++G+  S++  L
Sbjct: 24  FENLHTALHDEGNDQVEVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTSMSIGL 83

Query: 96  DGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISY 155
             G   GP+ +  G+ ++G  +    ++L E+ S  P    ++ S    AP  ++   S+
Sbjct: 84  KNG---GPLTIIMGFLLSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSW 138

Query: 156 SVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSM 215
             G+L  +       SI Y  AQ  +S +L++N        + +       + +TI+  +
Sbjct: 139 YTGWLMLIGNWTMSTSITYAGAQLTISLILMNNSDLISEANLIFFTVIVFYMVVTIVGLV 198

Query: 216 PTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKG 275
             KF+  ++ I+ +  +++I        + +      G+  +  + +F  +++LS +  G
Sbjct: 199 NLKFSRFIEIINKICVLWIIYAIIFIDILLLIFHS--GKFRSLKYALFHFDNHLSGYGSG 256

Query: 276 WNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLAC 335
               I G   + +T+  +     ++EE +     +P G+  ++ +  + G     V+   
Sbjct: 257 VLSFIIGFQQSNFTLQGFSMLPALSEEVKRPENDIPRGMSNAVLLSTLSG-----VIFLI 311

Query: 336 MDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ-----FLMGASTVVANSRQ 390
               I   +++ F       I +   K      +SIF++       F  G  ++  +SR 
Sbjct: 312 PILIILPDIDTLFTGHKILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSRS 371

Query: 391 FWAFARDDGIPFSNFFKKV--SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLS 448
            ++F+RD GIP+ N +  V  S+ + VP  ++W                 AA  A    +
Sbjct: 372 VYSFSRDRGIPYHNLWTYVDPSSVSKVPKYSIWLSMAISYFLGLLALFSTAAFNAFIGAA 431

Query: 449 VAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDAT 508
           V  +  A + P+ L L   +R  R  P  +      I+N                P    
Sbjct: 432 VLCLCSATVIPLILVLFSRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFPPQIP 491

Query: 509 VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGP 543
           V   TMNY +++     +   + YF W +  +Q P
Sbjct: 492 VTFQTMNYALIVYIFCLISITVLYFKWGKYNFQLP 526

>TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {ON}
           Anc_1.173 YKL174C
          Length = 593

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 100/529 (18%), Positives = 215/529 (40%), Gaps = 23/529 (4%)

Query: 39  AHGAPIRFVD------ARSATSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSI 91
           AH AP   +D        ++T   +V+    Y+++L +   S   + G+ F +M  +  +
Sbjct: 17  AHLAPNEILDNLHTIIHENSTDVPEVVEHFEYEQQLDKSLLSRSSVVGLGFGLMSPVLGM 76

Query: 92  ASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVR 150
            +++  GL + GP  + +G+ I G        +L E+ S  P    ++ +    AP+ ++
Sbjct: 77  CTSMGIGLVNGGPFTIMFGFPICGFFSFLCASSLGEVVSKYPIE--LHGASAMIAPKSIK 134

Query: 151 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMT 210
              S+  G+L  L        + +  AQ I+S V + +        +           +T
Sbjct: 135 PMCSWFTGWLMLLGNWFMSIGVTFAGAQLIISLVNIGDRDVIADGRLGIYTVLVYYGVVT 194

Query: 211 ILTSMPTKFTSRMQTISIVSNVFLI--ILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDN 268
           ++  +  K+   ++ I+ V   ++I  +LF   + +   R       +   HF    ++ 
Sbjct: 195 VVGVVNLKYARYVEAINKVCIYWIIYAVLFIDVLLLLFHRQKFRSLPYALFHF----DNT 250

Query: 269 LSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLI 328
           LS ++  +   I G   + +T+  +     +A+E +   + +P G+  ++ +  ++G + 
Sbjct: 251 LSGYSSAFLSFIIGFQQSNFTLQGFSMLPALADEVQVPEKDIPRGMSSAVLISTLIGMIF 310

Query: 329 CIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVAN 387
            + ++  + P++D +  +     +  +   +   ++   FL + I+   F  G  ++  +
Sbjct: 311 LLPIMLIL-PDVDGLFENTKVLPIVDVFTHSTNSKFVSVFLILLILGNLFFSGIGSITTS 369

Query: 388 SRQFWAFARDDGIPFSNFFKKVSNTT--GVPVRAVWXXXXXXXXXXXXXXVGEAASGALF 445
           SR  ++F+RD  IP    +  V  T+   VP  ++                  AA  A  
Sbjct: 370 SRAVYSFSRDCAIPNHQLWTYVDPTSESKVPKYSILLSMGVSYILGLLPLFSTAAFNAFI 429

Query: 446 SLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPS 505
             +V  +  A + P+ L L   +R  R  P  +      I N                P 
Sbjct: 430 GCAVLCLCSATLIPLVLVLLTRRRILRDAPVKIKYKLGWIANVGSVIWLPLSMVSVCMPP 489

Query: 506 DATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQE 554
              V P TMNY +V+    +   ++ YF W +  ++ P   L D++ ++
Sbjct: 490 QIPVTPKTMNYALVVFIACFAGIIVLYFKWGKYNFKLP---LVDKQIED 535

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 169/383 (44%), Gaps = 30/383 (7%)

Query: 55  DKQVLAE-LGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWF 111
           D  VL E   Y++ L +   S   + G+ F +M  +  ++++L  GL + GP+ +   + 
Sbjct: 37  DDTVLVEHFQYEQRLDKSLLSKYSVIGLGFGLMSPVLGMSTSLSTGLVNGGPLTILGAFI 96

Query: 112 IAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCS 171
           I G +     +++ E+ S  P    ++ S    AP   R   +Y  G+L  L  C    S
Sbjct: 97  ICGFMNWLTSLSIGEVVSKYPIE--LHGSVAMLAPDNYRLVTAYFTGWLMLLGNCVMNAS 154

Query: 172 IVYGLAQQILSAVLVSNPSFNVTNPI---TYGVFAACIIAMTILTSMPTKFTSRMQTISI 228
           I Y  A+ I+S V +S  S    + +   T  V+  CI    I+ S   ++   + T+ I
Sbjct: 155 IQYAGARLIISLVTISGDSLISEDNLIIWTVLVYFLCITITGIINSNFARYLEIINTVCI 214

Query: 229 VSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHF------IFGKNDNLSSWNKG-WNWCIA 281
              ++            V+  D L   F+ G F       F  ++ LS ++    ++ + 
Sbjct: 215 YWILY-----------AVAFIDILLLMFHYGSFRPFLYAFFHFDNKLSGYSSAVLSFMVG 263

Query: 282 GMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNID 341
           G   + +T+  +     +++E R+  + +P G+  S+ V  I G +  I +L  + P  +
Sbjct: 264 GFQQSNFTLQGFSLLPALSDETREPEKDIPKGMSQSVLVSTICGIIYLIPILLVI-PEPE 322

Query: 342 NVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM-GASTVVANSRQFWAFARDDGI 400
            ++N      +  I   +   +    F  + I+   L  G  ++  +SR  ++ +RD G+
Sbjct: 323 EIMNDSRVMEIVLIFTKSTRSKIVSYFQVLLILGNLLFSGIGSITTSSRAVYSMSRDHGL 382

Query: 401 PFSNFFKKVS--NTTGVPVRAVW 421
           P+S+ +  VS  + + VP  AV+
Sbjct: 383 PYSDLWSYVSPDSQSQVPRYAVY 405

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 108/529 (20%), Positives = 218/529 (41%), Gaps = 23/529 (4%)

Query: 57  QVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAG 114
           +V+    Y +EL +   S   I G+ FS+M     +++++  GL + GP  + WG+ I+G
Sbjct: 41  EVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSMAIGLINGGPATIIWGFLISG 100

Query: 115 GLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVY 174
             +    ++L E+ S  P    ++VS    AP++++   S+  G+L  L       SI +
Sbjct: 101 ICIWFCSLSLGEVVSKFPM--ELHVSSAMLAPKKLKLICSWYTGWLMLLGNWTMSTSITF 158

Query: 175 GLAQQILSAVLVSNPSFNVTNPITYGVFAACI--IAMTILTSMPTKFTSRMQTISIVSNV 232
             AQ  +S +L++N    ++     G F   I  + +TI+  +  KF   ++TI+    +
Sbjct: 159 AGAQLTISLILMTNSDL-ISEKYLIG-FTVIIFYLVVTIVGLINLKFARFIETINRACVI 216

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
           +  I++ I     +      G++ +  + +F  +++LS ++      + G   + +T+  
Sbjct: 217 W--IIYAILFIDILLLIFHRGKYHSLKYSLFHFDNSLSGYSGFLISFLIGFQQSNFTLQG 274

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +     +A+E +   + +P G+  ++ +    G +  I ++  + P  D +  +     +
Sbjct: 275 FSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIPIMIIL-PESDKLFTNHKILPI 333

Query: 353 TQIIYDALGKRWTLGFLSIFIICQ-FLMGASTVVANSRQFWAFARDDGIPFSN--FFKKV 409
             I   +    +   FL + I+   F  G  ++  +SR  ++F+RD  IP      F + 
Sbjct: 334 VNIFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRAVYSFSRDHAIPHHETWTFVQP 393

Query: 410 SNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKR 469
            + + VP  ++                  AA  A    +V  +  A   P+ L L   +R
Sbjct: 394 ESQSKVPKNSILLSMAISYILGLLALFSTAAFNAFIGAAVLCLCSATCIPLVLVLFRRRR 453

Query: 470 DFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSL 529
             R  P  +       +N                P    V   +MNY +++     ++  
Sbjct: 454 VLRNAPVKIRYKLGWFVNIVSILWLLLSMVSVCLPPKIPVTLESMNYALIVYLLCIIIIT 513

Query: 530 IYYFVWQRKFYQGP-----KSNLTDEEFQEYVGEDVIDAIISNNVATQK 573
           + YF W +  ++ P     K N  D      V  D+I   I  N+   K
Sbjct: 514 LMYFKWGKDNFKLPLIEEEKKNQNDR--TRKVPLDIIS--IKKNIKAHK 558

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 107/487 (21%), Positives = 189/487 (38%), Gaps = 33/487 (6%)

Query: 90  SIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRV 149
           +I ++L+ G   GP G+ + +         IG ++AEL+SS+P +G VY     WA    
Sbjct: 63  AIVASLNNG---GPPGIMYEFIAVSVFYWAIGASIAELASSVPASGGVY----HWAAMTP 115

Query: 150 RK----CISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAAC 205
            K       +  G+ D L+    + S    +A  I+ +  + +P   +     Y     C
Sbjct: 116 GKKWGPICGWFAGWFDFLAWNFGIASNANMVASMIVYSYGLFHPDTELQRWHVY----IC 171

Query: 206 IIAMTILTSMPTKFTS-RMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFG 264
            + +T L      F    + TI+ + +  ++  +F+ V +        G+      F++ 
Sbjct: 172 FLILTWLCCFVVMFADWALPTINRIGSFLILGGWFVTVVVCAVMPSTTGKGHASNDFVWS 231

Query: 265 KNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIV 324
           K  N + ++      + GM+   +++G  D   H+AEE  DA R +P  +   I    +V
Sbjct: 232 KWQNNTGYSSDGFAFLLGMLNGAFSVGTPDCITHLAEEIPDAGRNLPKVLFWQI----LV 287

Query: 325 GWLICIVLLACMDPNIDNV-------LNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQF 377
           G++  I  +  M   I+N+         S  G+   Q      G    L  + + IIC  
Sbjct: 288 GFITAITYMIAMFYAINNLPIIFSSNTFSPLGEIYLQATNSRGGAIGLLLIIYLPIICAI 347

Query: 378 LMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVG 437
           +      +   R  +  ARD+  PFS +   +      P  A +              VG
Sbjct: 348 V---GCYITAGRTLYVLARDNATPFSKYLGAIHPRYKSPFWATF-ACGVLCTCLGAIYVG 403

Query: 438 EAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRP-GPFYLGDVWSPIINWXXXXXXXX 496
            A +   F  S   +  A  F   L     KR   P G F +G  +   +N         
Sbjct: 404 SATAFNAFVGSFVLLTTAAFFLAMLPNLLTKRSKLPLGSFNMGK-FGYAVNIISCLYILV 462

Query: 497 XXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYV 556
                  P         MNYT V+  G  ++  I++ V  RK Y+GP  ++ +++    +
Sbjct: 463 FFVIYCFPYSLPATAENMNYTSVMVSGLTLMVAIWWMVHGRKNYKGPTFDMVEKDNCSVL 522

Query: 557 GEDVIDA 563
            +D + A
Sbjct: 523 TDDYLVA 529

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 101/502 (20%), Positives = 204/502 (40%), Gaps = 20/502 (3%)

Query: 55  DKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFI 112
           + +      Y + L +   S   I G+   +M  +  + +++  GL + GP+ +  G+ I
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLI 97

Query: 113 AGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
           +G       ++L E+ S  P    ++V     AP+ ++   S+  G+L  +       SI
Sbjct: 98  SGMCTWFSSLSLGEIVSKFPME--LHVGSAMLAPKNLKLVCSWYTGWLMLIGNWTMSTSI 155

Query: 173 VYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
            +  AQ  +S +L++N        + +       + +T++  +  KF   ++TI+ V  V
Sbjct: 156 TFAGAQLTISLILMTNSDLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETINKVC-V 214

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
           + I+   I + I +    K G+  +  + +F  ++NLS +   +   I G   + +T+  
Sbjct: 215 YWIVYAIIFIDILLLIFHK-GKFRSLKYALFHFDNNLSGYKSAFLSFIIGFQQSNFTLQG 273

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +     +A+E +   R +P G+  ++ +    G +  I ++  +  N     ++ F    
Sbjct: 274 FSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLILPDN-----DALFTNHK 328

Query: 353 TQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGIPFSNFFK 407
              I +   K      LS F++   L      G  ++  +SR  ++F+RD  IP    + 
Sbjct: 329 VLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDHAIPHYGRWT 388

Query: 408 KVS--NTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLT 465
            V   + + VP  +V               +  AA  A    +V  +  A   P+ L L 
Sbjct: 389 YVEPDSQSKVPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLL 448

Query: 466 YGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFW 525
             +R  R  P  +   +   IN                P+   V   TMNY +++   F 
Sbjct: 449 TRRRAIRSAPVKIRYKFGWFINIVSIAWVLLSMVSVCLPTQVPVTFKTMNYALMVYV-FC 507

Query: 526 VLSLI-YYFVWQRKFYQGPKSN 546
           +L +   YF W +  ++ P ++
Sbjct: 508 ILVITGLYFKWGKYNFRLPLAD 529

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 103/502 (20%), Positives = 209/502 (41%), Gaps = 20/502 (3%)

Query: 55  DKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFI 112
           + +      Y + L +   S   I G+   +M  +  +++++  GL + GP+ +  G+ I
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMSTSMAIGLINGGPLTIMLGFLI 97

Query: 113 AGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
           +G  +    ++L E+ S  P    ++V     AP++++   S+  G+L  +       SI
Sbjct: 98  SGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLACSWYTGWLMLIGNWTMSTSI 155

Query: 173 VYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
            +  AQ  +S +L++N +      +T+       + +TI+  +  KF   ++TI+ V  V
Sbjct: 156 TFAGAQLTISLILMTNSNLISEAHLTFYTVIVFYLVVTIVGLVNLKFARFIETINKVC-V 214

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
           + II   I + I +    K G+  +  + +F  +++LS +   +   I G   + +T+  
Sbjct: 215 YWIIYAIIFIDILLLIFHK-GKFRSLKYALFHFDNSLSGYKSAFLSFIIGFQQSNFTLQG 273

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +     +A+E +   R +P G+  ++ +    G +  I ++  +  N     +  F    
Sbjct: 274 FSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLILPDN-----DLLFTNHK 328

Query: 353 TQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGIPFSNFFK 407
              I +   K      LS F++   L      G  ++  +SR  ++F+RD  IP    + 
Sbjct: 329 VLPIVNIFTKSTASVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDRAIPHYEKWT 388

Query: 408 KVS--NTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLT 465
            V   + + VP  +V               +  AA  A    +V  +  A   P+ L L 
Sbjct: 389 YVEPDSQSKVPKNSVILSMVISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLF 448

Query: 466 YGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFW 525
             +R  R  P  +   +   IN                P+   V   TMNY +++   F 
Sbjct: 449 TRRRAIRSAPVKIRYKFGWFINIVSIAWLLLSMVSVCLPTQVPVTFKTMNYALMVYI-FC 507

Query: 526 VLSLI-YYFVWQRKFYQGPKSN 546
           +L++   YF W +  ++ P ++
Sbjct: 508 ILAITGLYFKWGKYNFRLPLAD 529

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 103/531 (19%), Positives = 213/531 (40%), Gaps = 19/531 (3%)

Query: 18  NRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREF-SSIQ 76
           N ++++    G++ E    T  H       D  S  SD   +    Y++EL +   S   
Sbjct: 10  NVRNSIHFNTGEIFE-NLHTYLHE------DEDSVNSD--TVEHFKYEQELDKSLLSRSS 60

Query: 77  IFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
           + G+ F +M  +  + +++  GL + GP+ +  G+ ++G  +    ++L E+ S  P   
Sbjct: 61  VIGLGFGLMSPVLGMCTSMSIGLINGGPLTIMLGFILSGISIWFCSLSLGEIISKFPME- 119

Query: 136 AVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTN 195
            ++V+    AP++ +   S+  G+L  +       SI +  AQ  +S  L+ +       
Sbjct: 120 -MHVASAMLAPKKFKLLCSWYTGWLMLIGNWTMSTSITFAGAQLTISLFLMKDQYLISEE 178

Query: 196 PITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRH 255
              +       + +T++  +  KF   ++ I+ V  V+ II   I + I +    K G +
Sbjct: 179 HFIFYTVIVFYLVVTVVGLINLKFARFIEIINKVC-VYWIIYAIIFIDILLLIFHK-GTY 236

Query: 256 FNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIV 315
            +  + +F  +++ S ++      I G   + +T+  +     +A+E +   R +P G+ 
Sbjct: 237 RSLKYALFHFDNSRSGYSNVLISFIIGFQQSNFTLQGFSMLPALADEVKKPERDIPRGMS 296

Query: 316 GSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIIC 375
            S+ +    G +  + ++  + P++  +        +  I   +        FL + I+ 
Sbjct: 297 ISVLISTFSGIIFLLPIMIIL-PDLSTIFTDHKVLPIVNIFIQSTDSMIVSFFLVLLILG 355

Query: 376 Q-FLMGASTVVANSRQFWAFARDDGIPFSN--FFKKVSNTTGVPVRAVWXXXXXXXXXXX 432
             F  G  ++ A+SR  ++F+RD  IP+ +   F K  + + VP  +V            
Sbjct: 356 NLFFSGIGSITASSRTVYSFSRDQAIPYYDHWIFVKPESESKVPKNSVLLSMAISYVLGI 415

Query: 433 XXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXX 492
                 AA  A    +V  +  A   P+ L L   +R  +  P  +       IN     
Sbjct: 416 LALFSTAAFNAFIGAAVLCLCSATCIPLILILFGRRRILKNAPIKIRYKLGWGINIISIL 475

Query: 493 XXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGP 543
                      P    V   TMNY +++     +     Y  W ++ ++ P
Sbjct: 476 WLLLSMFSVCLPVQIPVTFQTMNYALMVYVFCLICVTFLYVKWGKRNFKLP 526

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 99/510 (19%), Positives = 204/510 (40%), Gaps = 32/510 (6%)

Query: 53  TSDKQVLAELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGW 110
           + + +      Y + L +   S   I G+   +M  +  + +++  GL + GP+ +  G+
Sbjct: 36  SQENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGF 95

Query: 111 FIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVC 170
            I+G  +    ++L E+ S  P    ++V     AP++++   S+  G+L  +       
Sbjct: 96  LISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMST 153

Query: 171 SIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIV- 229
           SI +  AQ  +S +L++N +      + +       + +T++  +  KF   ++TI+ V 
Sbjct: 154 SITFAGAQLTISLILMTNSNLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETINKVC 213

Query: 230 -----SNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMM 284
                  +  I +  +    G  RS K          +F  ++NLS +   +   I G  
Sbjct: 214 VYWIIYAIIFIDILLLVFHKGKFRSLKYA--------LFHFDNNLSGYKSAFLSFIIGFQ 265

Query: 285 PAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVL 344
            + +T+  +     +A+E +   + +P G+  ++ +    G +  I ++  +  N     
Sbjct: 266 QSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGVIFLIPIMLILPDN----- 320

Query: 345 NSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDG 399
           +  F       I +   K      LS F++   L      G  ++  +SR  ++F+RD  
Sbjct: 321 DLLFTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQA 380

Query: 400 IPFSNFFKKVS--NTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALI 457
           IP+ + +  V   + + VP  +V               +  AA  A    +V  +  A  
Sbjct: 381 IPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATF 440

Query: 458 FPITLRLTYGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYT 517
            P+ L L   +R  R  P  +   +   IN                P+   V   TMNY 
Sbjct: 441 IPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLSMVSVCLPTQVPVTFKTMNYA 500

Query: 518 VVIGPGFWVLSLI-YYFVWQRKFYQGPKSN 546
           +++   F +L +   YF W +  ++ P ++
Sbjct: 501 LMVYV-FCILVITGLYFKWGKYNFRLPLAD 529

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 174/381 (45%), Gaps = 27/381 (7%)

Query: 55  DKQVLAE-LGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWF 111
           D+ V  E   Y+++L R   S   + G+ F +M  +  +++TL  GL   GP  +   + 
Sbjct: 36  DEPVEVEHFQYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFA 95

Query: 112 IAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCS 171
           + G +     +A+ E+ S  P    ++ S    AP+R R   +Y  G L  L       S
Sbjct: 96  LCGLMSWLTALAIGEVVSKYPIE--LHGSVALLAPERYRLVAAYYTGCLILLGNWVMNAS 153

Query: 172 IVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSN 231
           I Y  AQ I+S + +S    +  N   + V A   +++T+   +  KF S ++ I+ V  
Sbjct: 154 IQYAGAQLIISLIAISGDLVSEENLAIWTV-AVYFLSITVTGVINAKFASFLEPINTVC- 211

Query: 232 VFLIILFFIAVPIGVSRSDKLGRHFNDGHF-----IFGKNDN-LSSWNKGW-NWCIAGMM 284
           ++ I+   + +       D L   F+ G F      F   DN LS +     ++ + G+ 
Sbjct: 212 IYWILYAVVFI-------DVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQ 264

Query: 285 PAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVL 344
            + +T+  +     +++E ++  + +P G+  ++ V  + G +  + LL  M P+ + V+
Sbjct: 265 QSNFTLQGFSMLPALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVM-PSPEEVM 323

Query: 345 NSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM--GASTVVANSRQFWAFARDDGIPF 402
           +      +  +++    +   + +L + +I   L+  G  ++  +SR  ++ +RD  IP+
Sbjct: 324 SDSRVMEIV-LLFTKSTRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPY 382

Query: 403 SNFFKKVS--NTTGVPVRAVW 421
              +  VS  + + VP  AV+
Sbjct: 383 YELWSYVSPGSQSQVPKYAVY 403

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 95/478 (19%), Positives = 186/478 (38%), Gaps = 89/478 (18%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAG-PVGLGWGWFIAGGLVLTIGIALA 125
           +L + F  + + G+AFS+      ++S+L  G+S+G P+ + +G  I     L  G +LA
Sbjct: 21  KLSKNFGWLSLLGIAFSLTNSWLGVSSSLVVGISSGGPLLIIYGLIIGVFFTLMCGWSLA 80

Query: 126 ELSSSIP-TAGAVY---------------------------------VSCYQWAPQR--- 148
           E SS +P ++GA +                                  +C   +P+R   
Sbjct: 81  EFSSLLPNSSGASFWVLKMLETVEKAKRNGLDPEVLEDASIGDTVDRGTCEISSPERKLE 140

Query: 149 -------------VRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTN 195
                        +++  + +VG ++      +  S+   LA  IL    + N  + + +
Sbjct: 141 LMCTANNGEATSTIQRSTALAVGLINYFGAIFTTSSVFSSLAISILGVHSLLNEEYTLKH 200

Query: 196 PITYGVFAACIIAMTILTS----MP--TKFTSRMQTISIVSNVFLIILFFIAVPIGVSRS 249
              + V+   +I +T+++     +P  +KF   M  I+       ++ F +++   V RS
Sbjct: 201 WHVFVVYEVLVIFLTLVSCWSLILPALSKFGLGMSLIT------YMLTFIVSL---VCRS 251

Query: 250 DKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAV 307
                 +     IFG+  N + W       I G++  +W     DS  HM +E     ++
Sbjct: 252 SNTEVAWPKPSMIFGEFKNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTASM 311

Query: 308 RAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLG 367
           + VP  I+G+I + ++  +   I +  C+    D    S+    + ++ Y A G +    
Sbjct: 312 KLVPRVIIGTILIGFVTSFTYAIGMFFCIT---DPAKLSDAVLPILELYYQATGNK---- 364

Query: 368 FLSIFIICQFLM-----GASTVVANSRQFWAFARDDGI---------PFSNFFKKVSNTT 413
            LS+F+ C  ++     G ++V   SR  W+  RD                FF  V+ T 
Sbjct: 365 NLSVFLQCCCIVSGITCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTL 424

Query: 414 GVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDF 471
             P+ A +                  A  A+ +  +  + ++   P  +    G+R F
Sbjct: 425 KTPLNAHFFSQLLVAIIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRF 482

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 100/502 (19%), Positives = 196/502 (39%), Gaps = 32/502 (6%)

Query: 61  ELGYKEELKREF-SSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVL 118
              Y + L +   S   I G+   +M  +  + +++  GL + GP  +  G+ I+G  + 
Sbjct: 44  HFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPFTIMLGFLISGVCIW 103

Query: 119 TIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQ 178
              ++L E+ S  P    ++V     AP+ ++   S+  G+L  +       SI +  AQ
Sbjct: 104 FSSLSLGEIVSKFPME--LHVGSAMLAPETLKLVCSWYTGWLMLIGNWTMSTSITFAGAQ 161

Query: 179 QILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIV------SNV 232
             +S +L++N        + +       + +T +  +  KF   ++ I+ V        +
Sbjct: 162 LTISLILMTNSDLISEAHLIFYTVIVFYLVVTAVGLVNLKFARFIEIINKVCVYWIIYAI 221

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGA 292
             I +  +    G  RS K          +F  ++NLS +   +   I G   + +T+  
Sbjct: 222 IFIDILLLVFHKGKFRSLKYA--------LFHFDNNLSGYKSAFISFIIGFQQSNFTLQG 273

Query: 293 YDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGM 352
           +     +A+E +   R +P G+  ++ +    G +  I ++  +  N     +  F    
Sbjct: 274 FSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMIILPDN-----DLLFTNHK 328

Query: 353 TQIIYDALGKRWTLGFLSIFIICQFLM-----GASTVVANSRQFWAFARDDGIPFSNFFK 407
              I +   K      LS F++   L      G  ++  +SR  ++F+RD  IP+ + + 
Sbjct: 329 VLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWT 388

Query: 408 KVS--NTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLT 465
            V   + + VP  +V               +  AA  A    +V  +  A   P+ L L 
Sbjct: 389 YVEPDSQSKVPKNSVILSMIISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLF 448

Query: 466 YGKRDFRPGPFYLGDVWSPIINWXXXXXXXXXXXXXXXPSDATVDPSTMNYTVVIGPGFW 525
             +R  R  P  +   +   IN                P+   V   TMNY +V+   F 
Sbjct: 449 TRRRAIRSAPVKIRYKFGWFINIVSIVWLLLSMVSVCLPTQLPVTFKTMNYALVVYI-FC 507

Query: 526 VLSLI-YYFVWQRKFYQGPKSN 546
           +L +   YF W +  ++ P ++
Sbjct: 508 ILVITGLYFKWGKYNFRLPLAD 529

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 155/390 (39%), Gaps = 66/390 (16%)

Query: 65  KEELK--REFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIG 121
           + E+K  + F+   + G+AFS+      I++++  G+ S GP+ + +G  IA    L  G
Sbjct: 29  RSEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 88

Query: 122 IALAELSSSIPTA------------------------------GAVYVSCYQWAPQ---- 147
           I+L + ++ +P +                              G V++  Y         
Sbjct: 89  ISLGDFAAILPNSSGGSFWVLKMLEQESVALKTPEYEDTSDDDGEVFLENYCQTANVEVC 148

Query: 148 -RVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACI 206
            + +K  S  VG L+      +  SI   L+   +    + +P + + +   + VF    
Sbjct: 149 SKFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHVFVGYQ 205

Query: 207 IAMTILT-----SMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHF 261
               ILT     S P  + S+    +  S +   + F I +   VSRS+     +     
Sbjct: 206 CINAILTFFNIYSSPLPYISQFGLYT--SLLSFAMTFIICI---VSRSNNTVEKWPKASN 260

Query: 262 IFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSIS 319
           IFG  DN + WN      + G++  +W     DS  HM +E     +   VP  I+ +I 
Sbjct: 261 IFGSFDNQTGWNSSGMAFVVGLVNPLWAFVGIDSATHMIDEVGYSRSRFLVPKVIITTII 320

Query: 320 VCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ--- 376
           V ++  ++ C+ L  C+    D     E    + +I Y A G R     LS+F+ C    
Sbjct: 321 VGFVTSFIYCVGLFFCIT---DKTAVVESILPIVEIFYQATGNRN----LSVFLQCMCIT 373

Query: 377 --FLMGASTVVANSRQFWAFARDDGIPFSN 404
             F+ G ++    SR   +F +    PF N
Sbjct: 374 TGFISGIASGTWQSRILQSFGKSYA-PFYN 402

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 89/394 (22%), Positives = 159/394 (40%), Gaps = 69/394 (17%)

Query: 65  KEELK--REFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIG 121
           + E+K  + F+   + G+AFS+      I++++  G+ S GP+ + +G  IA    L  G
Sbjct: 36  RSEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 95

Query: 122 IALAELSSSIPTAGA------------------------------VYVSCYQWA-----P 146
           I+L + ++ +P +                                V++  Y         
Sbjct: 96  ISLGDFAAILPNSSGGSFWVLKMLEQESVTLKTPEYEDPSDDDEEVFLENYCQTFNVEVS 155

Query: 147 QRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAA-- 204
            + +K  S  VG L+      +  SI   L+   +    + +P + + +   + VF    
Sbjct: 156 SKFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHVFVGYE 212

Query: 205 CIIAMTIL---TSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHF 261
           CI A+  L    S P  + S+    +  S +   + F I +   VSRSD     +     
Sbjct: 213 CINAVLTLFNIYSTPLPYISQFGLYT--SLLSFAMTFIICI---VSRSDNTVDPWPKASN 267

Query: 262 IFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSIS 319
           IFG  DN + WN      + G++  IW     DS  HM +E     +   VP  I+ +I 
Sbjct: 268 IFGSFDNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTII 327

Query: 320 VCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ--- 376
           V ++  ++ C+ L  C+    D     E    + +I Y A G R     LS+F+ C    
Sbjct: 328 VGFVTSFIYCVGLFFCIT---DQTAVVESILPIVEIFYQATGNRN----LSVFLQCMCIT 380

Query: 377 --FLMGASTVVANSRQFWAFARDDGIPFSNFFKK 408
             F+ G ++    SR   +F +     ++ F+K+
Sbjct: 381 TGFVSGIASGTWQSRILQSFGKS----YAPFYKE 410

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 158/387 (40%), Gaps = 61/387 (15%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALA 125
           +  + F+   + G+AFS+      I++++  G+ S GP+ + +G  IA    L  GI+L 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLG 69

Query: 126 ELSSSIPTAGA------------------------------VYVSCY-QWA----PQRVR 150
           + +S +P +                                V++  Y Q A      +V+
Sbjct: 70  DFASMLPNSCGGSFWVLKMLEQKSATLKTPDYEDTSDDDEEVFLENYCQTANVEVSSKVQ 129

Query: 151 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAA--CIIA 208
           +  S  VG L+      +  SI   L+   +    + +P + + +   + +F    CI A
Sbjct: 130 RVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHIFVGYQCINA 186

Query: 209 MTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDN 268
           +  L ++ +     +    + +++    + FI     VSRS+     +     IFG  DN
Sbjct: 187 ILTLFNIYSSPLPYISQFGLYTSLLSFAMTFIICI--VSRSNNTIDAWPKASNIFGSFDN 244

Query: 269 LSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSISVCWIVGW 326
            + WN      + G++  IW     DS  HM +E     +   VP  I+ +I V +I  +
Sbjct: 245 QTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFITSF 304

Query: 327 LICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ-----FLMGA 381
           + C+ L  C+    D     E    + +I Y A G R     LS+F+ C      F+ G 
Sbjct: 305 IYCVGLFFCIT---DKTAVVESILPIVEIFYQATGNRN----LSVFLQCMCITTGFVAGI 357

Query: 382 STVVANSRQFWAFARDDGIPFSNFFKK 408
           ++    SR   +F +     ++ F+K+
Sbjct: 358 ASGTWQSRILQSFGKS----YAPFYKE 380

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 77/351 (21%), Positives = 139/351 (39%), Gaps = 54/351 (15%)

Query: 67  ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIALA 125
           +  + F+   + G+AFS+      I++++  G+ S GP+ + +G  IA    L  GI+L 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFTLMCGISLG 69

Query: 126 ELSSSIPTAGA------------------------------VYVSCYQWAPQ-----RVR 150
           + +S +P +                                V++  Y          R++
Sbjct: 70  DFASILPNSCGGSFWVLKMLEREPATLKTPDYEDASDDDEEVFLETYCQTSNVEISSRLQ 129

Query: 151 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTN---PITYGVFAACII 207
           K  S  VG L+      +  S+   L+   +    + +P + + +    + Y    A + 
Sbjct: 130 KGTSMVVGLLNYFGAIFTTASVCSSLSMSCIGIHKLLHPEYELKHWHVFVGYQCINATLT 189

Query: 208 AMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKND 267
              I +S P  + S+    +  S +   + F I +   VSRS+     +     IFG  D
Sbjct: 190 VFNIYSS-PLPYISQFGLYT--SLLSFAMTFIICI---VSRSNNTVDSWPKASNIFGNFD 243

Query: 268 NLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSISVCWIVG 325
           N + W+      + G++  IW     DS  HM +E     +   VP  I+ +I V +I  
Sbjct: 244 NQTGWHSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIVVGFITS 303

Query: 326 WLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQ 376
           ++ C+ L  C+    D     E    + +I Y A G R     LS+F+ C 
Sbjct: 304 FIYCVGLFFCIT---DKTAVVESILPIVEIFYQATGNR----NLSVFLQCM 347

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 104/233 (44%), Gaps = 12/233 (5%)

Query: 167 ASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTI 226
           AS+C+    L+  IL    + +P + + +   +  +    IAM  + S      +  Q  
Sbjct: 158 ASICA---SLSLSILGVYSLMHPDYELRHWNVFLTYELLNIAMAFVASWARWLPAISQFG 214

Query: 227 SIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPA 286
             +S V  ++ F I++   +SRS      +  G  +FG+  N + W+      I G++  
Sbjct: 215 LGISVVSYVLTFLISI---ISRSFNHSEQWPTGKTVFGEFTNTTGWSSSGMAFIVGLINP 271

Query: 287 IWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVL 344
           +W+    DS  HM ++     + + VP  I+ +I + +   +   IV+  C+  +   V+
Sbjct: 272 LWSFAGIDSATHMVDDVGYSASRKLVPRIIIATILLGFATAFPYAIVMFFCITDS-TQVV 330

Query: 345 NSEFGQGMTQIIYDALGKRWTLGFL-SIFIICQFLMGASTVVANSRQFWAFAR 396
           +S     + QI Y A G +    F+ S  II  F+ G S+    +R  W+ +R
Sbjct: 331 SSIL--PILQIYYQATGNKSLSAFMQSCCIITGFICGVSSSTWQNRILWSVSR 381

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 66  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVGLGWGWFIAGGLVLTIGIAL 124
           E+   +F+ + + G+AFS+      ++S+L  GL S GPV + +G  I     +  G++L
Sbjct: 3   EKRFTKFNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLIIYGLIIGAVFTIMCGLSL 62

Query: 125 AELSSSIPTAGAV 137
            E SS +P A  V
Sbjct: 63  CEFSSMLPNASGV 75

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/340 (21%), Positives = 134/340 (39%), Gaps = 36/340 (10%)

Query: 153 ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTIL 212
           ++ +VG L+      +  S+   LA  IL    + + S+ + +   + V+      +TIL
Sbjct: 156 LALAVGLLNYFGAVFTTASVFSSLALSILGVYSLLHASYELKHWHVFVVYELLNFLLTIL 215

Query: 213 TSMPTKFTSRMQTISIVSNVF-LIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSS 271
               +K    +    +  ++F  +I F I++   VSRS+     +     IFG+  N + 
Sbjct: 216 GCW-SKILPALSRFGLYISLFTYLITFVISL---VSRSNYSDISWPKSSDIFGQFRNTTG 271

Query: 272 WNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEA--RDAVRAVPFGIVGSISVCWIVGWLIC 329
           W+      + G++  +W     DS  HM +E   + +   VP  I+ +I + ++  +   
Sbjct: 272 WSSSGMAFVVGLINPLWAFAGIDSATHMVDEVGYKASTTLVPQAILSTIIIGFLTSFTYA 331

Query: 330 IVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM-----GASTV 384
           I +  C+    D    +E    + +I Y A G R     LS+ + C  ++     G ++V
Sbjct: 332 IGMFFCVT---DTEKVTESILPILEIYYQATGNR----NLSVLMQCCCILTGALCGIASV 384

Query: 385 VANSRQFWAFARDDGIPFSN-------------FFKKVSNTTGVPVRAVWXXXXXXXXXX 431
              SR  W+  +D    FS              FF  V++    P+ A            
Sbjct: 385 TWQSRILWSLGKD----FSQVTTTRPVCKKTMGFFGTVNSKLRAPLNAHLFSQLCVAIIG 440

Query: 432 XXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDF 471
                   A  A+ S  +  + +    P  + L  GKR+F
Sbjct: 441 CIFMGSSTAFNAIISACITLLLLTYAVPCLIVLLIGKREF 480

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 115/568 (20%), Positives = 209/568 (36%), Gaps = 98/568 (17%)

Query: 47  VDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGL-SAGPVG 105
           +D  S +   + +       +L + FS   + G++FS+      ++S+L  GL S GP+ 
Sbjct: 10  IDKTSESVSAKSIVPTESSTKLLKNFSWWSLIGISFSLTNSWLGVSSSLVVGLYSGGPLL 69

Query: 106 LGWGWFIAGGLVLTIGIALAELSSSIP-TAGAVYVSCYQWAPQRVRK------------- 151
           + +G  I        G +L+E SS +P ++G+ +     W  + + K             
Sbjct: 70  IIYGLIIGLFFTFMCGWSLSEFSSLLPNSSGSSF-----WVLKMLEKNDDIEDNHNINIK 124

Query: 152 -----------------------------CISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
                                         ++ +VG ++      +  S+   L+   L 
Sbjct: 125 SDSHNCDEELKLEKYCAVSSVKVTSNWQRSVALTVGLINYFGAVFTTASVCSSLSLNFLG 184

Query: 183 AVLVSNPSFNVTNPITYGVFAACIIAMTILTSMP--TKFTSRMQTISIVSNVFLIILFFI 240
              + +P++ + +   + VF    I     T+    +K+   +    +  ++F   L F+
Sbjct: 185 VYSLVHPAYEIKH---WHVFLTYEILNVFFTTFNCWSKWLPAISQFGLYMSMFSFGLTFV 241

Query: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300
                V RS+     +     IF +  N + W+      I G++  +W     DS  HM 
Sbjct: 242 ISL--VCRSNDKVTPWPTKSSIFSEFSNTTGWSSSGMAFIVGLINPLWAFAGIDSATHMV 299

Query: 301 EEARDAVRA--VPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYD 358
           +E   +     VP  I+G++ + ++  +   I +  C+  +  +V+ S     + QI Y 
Sbjct: 300 DEVGHSTSRTLVPRAIIGTVLLGFVTSFTYSIGMFYCIT-DTKSVVESIL--PILQIYYQ 356

Query: 359 ALGKRWTLGFLSIFIIC-----QFLMGASTVVANSRQFWAFARD-DGIP----------F 402
           A G R     LSIF+ C       + G ++    SR  W+ +RD + I           F
Sbjct: 357 ATGNR----NLSIFLQCCCITSGVVCGIASGTWQSRILWSISRDFENIDTNKPRPVFRYF 412

Query: 403 SNFFKKVSNTTGVPVRAVWXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITL 462
              F  V++   VP+ +                    A  A+ +  +  + ++   P T+
Sbjct: 413 CKRFGHVNSLLKVPLTSHLFSQVIVAIIGCIFMGSTTAFNAIITACITLLLLSYAIPCTI 472

Query: 463 RL-TYGKRDF--RPGP------------FYLGDVW-SPIINWXXXXXXXXXXXXXXXPSD 506
            L   GKR F  R G             F+  +VW   I N                P  
Sbjct: 473 LLVVVGKRQFYRRIGQELDELKLSTSSIFHSKNVWFGYIANGFTIAWALFCLIFLSFPYT 532

Query: 507 ATVDPSTMNY-TVVIGPGFWVLSLIYYF 533
             V    MNY +VV G    V+S+I YF
Sbjct: 533 LPVSAGNMNYVSVVYGAIALVISVIVYF 560

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 153/373 (41%), Gaps = 50/373 (13%)

Query: 65  KEELK-REFSSIQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGI 122
           +++LK R  S I I G   SI  GLL    ++L    +AGP+ +   +   G LV     
Sbjct: 87  RKDLKARHISMIAIGG---SIGTGLLIGTGNSL---YTAGPMSMFIAYAFVGVLVFFTMA 140

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
           AL E++S IP  G        +A +     + ++VG+       A +C  +     Q+ +
Sbjct: 141 ALGEMASYIPLDGFT-----SYASRYCDPALGFAVGY-------AYLCKYLILPPNQLTA 188

Query: 183 AVLV---------SNPSFNVTNPITYGVFAACIIAMTIL-TSMPTKFTSRMQTISIVSNV 232
           A LV          NP   +T      +F   I+AM  +      +F   + T  ++  +
Sbjct: 189 AALVIQYWLDREQVNPGVWIT------IFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMI 242

Query: 233 FLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKG-WNWCIAGMMPAIWTIG 291
            LIIL F+ +  G    D+LG  F D    F         +KG +   +A ++ A++   
Sbjct: 243 GLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYL 302

Query: 292 AYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLL----ACMDPNIDNVLNSE 347
             +    +A EA +  +++P  I  ++    IV +L+ I LL    A  DP +     S 
Sbjct: 303 GIELTGIVAAEAANPRKSIPKAIKLTMYRI-IVFYLVTIFLLGMCVAYDDPLLKKAKTSG 361

Query: 348 FGQGMTQIIYDALGKRWTLGFLSIFIIC--QFLMGA--STVVANSRQFWAFARDDGIPFS 403
            G   +  +  A+          IF  C   F+  A  S +   SR  +  A D+  P  
Sbjct: 362 TGAAASPYVV-AIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP-- 418

Query: 404 NFFKKVSNTTGVP 416
             F  V+N  GVP
Sbjct: 419 KIF-AVTNRWGVP 430

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 135/351 (38%), Gaps = 51/351 (14%)

Query: 150 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAM 209
           +K ++ +VG ++      +  SIV  L   I+    + +PSF +    T+       I  
Sbjct: 153 QKNMAIAVGLINYFGCVFTTASIVSALVYSIMGIHSILHPSFELKQWHTF-------ILY 205

Query: 210 TILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIG-----VSRSDKLGRH-FNDGHFIF 263
            ILT   T F    + +  +S+ F + +  ++  I      VSRS+ +    +     IF
Sbjct: 206 EILTVFLTVFNCNYRCLPFLSS-FGLAMSLLSYAITFILCLVSRSNSISEQPWPKSEDIF 264

Query: 264 GKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARD--AVRAVPFGIVGSISVC 321
            K  N + W       +  ++  +W+    DS  HM +E     A   VP  I+ +I + 
Sbjct: 265 YKFHNNTGWKSNGMAFVVSLINPLWSFVGIDSATHMVDEVGHVAAQVLVPKVIITTIFIG 324

Query: 322 WIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGA 381
           +I  +   I L  C+    D     E    +  I Y A G R     L++F      M A
Sbjct: 325 FITSFSYSIALFYCVR---DTAAVLESIAPVVTIYYQATGNR----NLAVF------MQA 371

Query: 382 STVVA-----------NSRQFWAFARD------DGIPFSNF----FKKVSNTTGVPVRAV 420
           ST+VA            SR  W+ +R+      DGI  S F    F  + +   VP+ A 
Sbjct: 372 STIVAGLTCGVASGTWQSRMLWSLSREMETMRPDGI-LSGFVTARFATIDSVNKVPLYAH 430

Query: 421 WXXXXXXXXXXXXXXVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDF 471
           +                  A  A+ S +V  + ++   P  + L  G+  F
Sbjct: 431 FFSQALVVIIGCIMLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKF 481

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 51  SATSDKQVLAELGYKEELKREFSS--IQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLG 107
           S T+D+    E   +E+L R      + +  +A  I  GL  S + +L  G   GP  L 
Sbjct: 33  SFTTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTG---GPASLF 89

Query: 108 WGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCA 167
             + I GG+V    +AL E+S+ +P +G+  V   ++  +     + ++  F D +S+ +
Sbjct: 90  MNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVAS 149

Query: 168 SVCSI 172
            + ++
Sbjct: 150 DLTAL 154

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 129/298 (43%), Gaps = 39/298 (13%)

Query: 66  EELKREFSS--IQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGI 122
            ELK+   S  +Q+  +  +I  GL    +STL    + GP GL   + I   ++  I  
Sbjct: 73  HELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLH---TCGPAGLFISYCIISSVIYPIMQ 129

Query: 123 ALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILS 182
            + E+   +P +G+       +A   V K +  S+GF D  +     C ++   A+   +
Sbjct: 130 GIGEMVCYLPGSGS---KPEGFAAYLVGKYVDESLGFADAWNY--YYCYVILVAAECTAA 184

Query: 183 AVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQ----TISIVSNVFLIILF 238
           + +V   + +V       +F A ++   IL     KF    +    +I I+  V LIIL 
Sbjct: 185 SGVVEYWTTSVPKAAWITIFLAAVV---ILNFTAVKFYGESEFWFASIKILCIVGLIILS 241

Query: 239 FIAVPIGVSRSDKLGRHF--NDGHFI-------FGKNDNLSSW--NKGWNWCIAGMMPAI 287
           FI    G    D+LG  +  N G F        FG   ++ +     G+ + +   M A+
Sbjct: 242 FILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAM 301

Query: 288 WTIGAYDSCLHMAEEARDAV-RAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVL 344
            +    D   ++A+ AR  V R + F I+G++S+          V++A  DP ++N L
Sbjct: 302 TSSEVEDQRRNIAKAARRFVWRLMFFYILGALSIS---------VIVAYNDPALENAL 350

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 65/153 (42%), Gaps = 19/153 (12%)

Query: 14  DTIKNRKSNVEVEVGQ--VRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKRE 71
           D   N +  V+ ++ +  V E   I S      R V     T  KQ     G KE   + 
Sbjct: 6   DESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQ-----GLKERHIKM 60

Query: 72  FSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSI 131
            + + +FG      GL  S   TL      GPVGL   +   G +V    IA+AE++S +
Sbjct: 61  LTLVGVFGT-----GLFLSSGGTLK---KTGPVGLLIAYLFVGIVVGCNQIAIAEVASFM 112

Query: 132 PTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
           P  GA      + A Q + + + ++ G++ T S
Sbjct: 113 PATGA----TIRHAEQFIDESVGFTFGWISTYS 141

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 66/159 (41%), Gaps = 23/159 (14%)

Query: 6   MSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYK 65
           MS SS   + +K      +VE   +R     T   G     V     T  KQ     G K
Sbjct: 1   MSISSQDKEKVKATAYEADVEDCDIRSTDE-TLKQG-----VLHNDRTKLKQ-----GLK 49

Query: 66  EELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALA 125
           E   +  + + +FG      GL  S   TL      GPVGL   +   G +V    IA+A
Sbjct: 50  ERHIKMLTLVGVFGT-----GLFLSSGGTLK---KTGPVGLLIAYLFVGIVVGCNQIAIA 101

Query: 126 ELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
           E++S +P  GA      + A Q + + + ++ G++ T S
Sbjct: 102 EVASFMPATGA----TIRHAEQFIDESVGFTFGWISTYS 136

>KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa]
           {ON} Anc_4.195 YGR055W
          Length = 575

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 61/320 (19%), Positives = 124/320 (38%), Gaps = 25/320 (7%)

Query: 102 GPVGLGWGWFIAGGLVLTIGIAL-AELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFL 160
           G +GL    +  GG++   G+ +  E  +++P  G           +   + I     F 
Sbjct: 87  GSIGLALIMWAVGGIIALAGLYVYMEFGTALPKNGG---------EKNYLELIFKKPRFF 137

Query: 161 DTLSLCASVCSIVYGLAQQILSAVL-VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKF 219
            T    A V  + +     + +AV+ ++    +VT     G+  A I    ++ S+  K 
Sbjct: 138 ITCMYAAYVFFLGWAAGNSVNTAVMFLTAADADVTEWREKGIGCAVIAFAFLVNSINVKI 197

Query: 220 TSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWC 279
              +Q    +  VF++I   +   + +    K G   ++ H  F   +N S++       
Sbjct: 198 GLYLQNALGIFKVFIVIFISVTGWVALGGGLKDGYQSHNFHNAFDGTENASAYG-----I 252

Query: 280 IAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPN 339
           +  +   IW+   Y +  +   E ++ VR +      S+    I+   + I   A +   
Sbjct: 253 VTALYNVIWSYVGYSNVNYALGEVKNPVRTLKLAGPTSLIFITIIYIFVNIAYFAVVPK- 311

Query: 340 IDNVLNSEF--GQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARD 397
            D +++S+         I++    ++    F+ +  +   L   S + +  R      R+
Sbjct: 312 -DKLVSSKLVLAADFFDIVFGGNARKAAAAFVGLSALGNVL---SVIFSQGRIIQQLGRE 367

Query: 398 DGIPFSNFF--KKVSNTTGV 415
             +PFSNFF   K  N+ GV
Sbjct: 368 GVLPFSNFFASSKPFNSPGV 387

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 82/391 (20%), Positives = 156/391 (39%), Gaps = 48/391 (12%)

Query: 47  VDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIM---GLLPSIASTLDGGLSAGP 103
           VD  ++ SD     +   +E L R  S   +  +A + +   GL  S A +L+ G   GP
Sbjct: 41  VDTNNSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAG---GP 97

Query: 104 VGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTL 163
             L   + I GG++    ++L E+S+ +P +G+                 +YS  F+   
Sbjct: 98  GSLLINYVIMGGVIYLTMLSLGEMSTFMPISGSY---------------CAYSRKFVSES 142

Query: 164 SLCASVCSIVYGLAQQILSAVLVSNPSFNV--TNPITYGVFAACIIAMTILTSMPTKFTS 221
              A +C++ Y  A  + S +       +   TN   +  +AA ++   ++  +      
Sbjct: 143 YCFALMCNMWYSDAVSVASDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVK 202

Query: 222 RMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFG-KN--DNLSSWNKGWNW 278
                   +  +L +L  +AV I    +       N  H   G KN     + + +G+  
Sbjct: 203 LYGE----AEYWLAMLKVVAVIIFFIMAIIANCGHNQQHEYIGFKNWSHGDAPFVQGFKG 258

Query: 279 CIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCW-IVGWLICIVLLACMD 337
            +   + + ++ G  ++      EA++ VR  P  I    +V W I+ + +  +    MD
Sbjct: 259 FVTIFVTSSFSYGGTETVTLTGGEAKNPVRNTPKVIK---TVFWRILVFYVFTMFFVGMD 315

Query: 338 -----PNI--DNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGAS-TVVANSR 389
                PN+   +VL S F      I++   G +    F++  I+   +   +  +   SR
Sbjct: 316 IPYDYPNLKTKSVLTSPF-----TIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSR 370

Query: 390 QFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
             +    +  +P+S FF K +N    P  AV
Sbjct: 371 ILYNMGLEGFLPYSRFFTK-TNRNKAPYVAV 400

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 72/160 (45%), Gaps = 18/160 (11%)

Query: 7   SASSSAMDTIKNRKSNVEV--EVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELG- 63
           +  SS+    + RKS V+    + Q  +++ I       I+  DA S T D+++L     
Sbjct: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINI-----IQQTDASSTTEDEEMLNSGSV 57

Query: 64  YKEELKREFSSIQIFGVAFSIM---GLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
           +  E+KRE     I  +A       GL   I++ L+    +GPVG    +   G L   +
Sbjct: 58  HDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLE---DSGPVGSLIAYIFVGTLTYAV 114

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFL 160
             +L E+++ IP   +  V    +A + +   I  +VG++
Sbjct: 115 TQSLGEMATFIPVTSSFTV----FASRFLSPSIGAAVGYM 150

>NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4.195
          Length = 585

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 86/210 (40%), Gaps = 14/210 (6%)

Query: 200 GVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDG 259
           G+  A I     + S+  K    +Q    +  +F+++   +   + +    K G   ++ 
Sbjct: 183 GIAVAVIFFAFFINSVSVKTGLYIQNALGIFKIFIVLFISVTGWVALGGGLKDGYQTHNF 242

Query: 260 HFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIS 319
           H  F   +N +++       +  +   IW+   Y +  +   E +D VR +   I G  S
Sbjct: 243 HDAFAGTENATAYG-----IVTALYNVIWSFVGYSNVNYALGEVKDPVRTLK--IAGPTS 295

Query: 320 VCWI-VGWLICIVLLACMDPNIDNVLNSEF--GQGMTQIIYDALGKRWTLGFLSIFIICQ 376
           + +I + ++   V    + P  + +++S+         I++   GK+    F+ +  +  
Sbjct: 296 MVFIAIVYIFVNVAYFAVVPK-EKLISSKLVLAADFFDIVFGEHGKKAAAAFVGLSALGN 354

Query: 377 FLMGASTVVANSRQFWAFARDDGIPFSNFF 406
            L   S + +  R      R+  +PFSNFF
Sbjct: 355 VL---SVIFSQGRIIQQLGREGVLPFSNFF 381

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 13/111 (11%)

Query: 54  SDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
           +D+  L + G KE   +  + + +FG      GL  S   TL     AGP G+   + + 
Sbjct: 45  NDRTRLKQ-GLKERHIKMLTLVGVFGT-----GLFLSSGGTLK---KAGPAGMFLAYVVV 95

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLS 164
           G +V    IA+AE++S +P  GA      + A Q + + + ++ G++ T S
Sbjct: 96  GIVVGCNQIAIAEVASFMPATGA----TIRHAEQFIDESVGFTFGWISTYS 142

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 31/208 (14%)

Query: 54  SDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
           +D+  L + G KE   +  + + +FG      GL  S   TL      GPVGL   +   
Sbjct: 43  NDRTRLKQ-GLKERHIKMLTLVGVFGT-----GLFLSSGGTLK---KIGPVGLLIAYLFV 93

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIV 173
           G +V    IA+AE++S +P  GA      + A Q + + + ++ G++ T S         
Sbjct: 94  GIVVGCNQIAIAEVASFMPATGA----TIRHAEQFIDESVGFTFGWISTYS--------- 140

Query: 174 YGLAQQILSAVLVSNPSFNVTNPITY-GVFAACIIAMTILTSMPTKFTSRMQTISIVSNV 232
             L    LSA  V    +   +P  +  VF    +A  I T    +F   ++ +     +
Sbjct: 141 -SLMPGELSATAVIMKYWTDVSPAVFITVFGVLFVATNIYT---IRFYGEIEYVFGWLKL 196

Query: 233 FLIILFFIAVPI----GVSRSDKLGRHF 256
            LI +  I+  +    GV   ++LG H+
Sbjct: 197 VLIFILIISGLVIDLGGVKGQERLGFHY 224

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 51  SATSDKQVLAELGYKEELKREFS--SIQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLG 107
           S T+++    E   +E+L+R      I +  +A  I  GL  S A +L  G   GP  L 
Sbjct: 37  SLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQG---GPASLF 93

Query: 108 WGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCA 167
             + I GG+V    + L E+S+ +P +G+      ++  +     + ++  F D +S+ +
Sbjct: 94  MNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVAS 153

Query: 168 SVCSI 172
            + ++
Sbjct: 154 DMTAL 158

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 66/144 (45%), Gaps = 7/144 (4%)

Query: 32  ELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFS--SIQIFGVAFSI-MGLL 88
           +++ + S H   +  V +  +        E   +E+LKR+ S   I +  +A  I  GL 
Sbjct: 33  KVKAVYSTHSV-LEGVHSLESIESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLY 91

Query: 89  PSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQR 148
            S + +L  G   GP  L   + I GG+V    + L E+S+ +P +G+      ++  + 
Sbjct: 92  LSTSKSLHVG---GPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSES 148

Query: 149 VRKCISYSVGFLDTLSLCASVCSI 172
               + ++  F D +S+ + + ++
Sbjct: 149 FACALMWNYWFNDAVSVASDLTAL 172

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 26/138 (18%)

Query: 17  KNRKSNVEVEVGQVRELRTITSAHGAPIRF--------------VDARSATSDKQVLAEL 62
           ++R S  EVE  +  E  T+T A    +R               +DA     + QV    
Sbjct: 47  RHRGSEGEVEYAKSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQV---- 102

Query: 63  GYKEELK-REFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIG 121
             K ELK R    I + G   +  GL   IA+ +    +AGPVG    +   G LV ++ 
Sbjct: 103 --KRELKPRHIGMIALGGTIGT--GLFIGIATPIQ---NAGPVGSLIAYIFMGTLVFSVT 155

Query: 122 IALAELSSSIPTAGAVYV 139
            +L E+++ IP   +  V
Sbjct: 156 QSLGEMATFIPVTSSFTV 173

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 12/109 (11%)

Query: 32  ELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELK-REFSSIQIFGVAFSIMGLLPS 90
           EL+++T A G    F +  +   D Q   E   K  LK R  S I + G   +  GL   
Sbjct: 29  ELQSVTPATG---EFPEDHTEEGDYQ---ETEVKRALKARHISMIALGGTIGT--GLFIV 80

Query: 91  IASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYV 139
           IAS L    +AGPVG    +   G +V +I  +L E+++ IP   +V V
Sbjct: 81  IASPLR---TAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTV 126

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 77/158 (48%), Gaps = 11/158 (6%)

Query: 15  TIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSS 74
           +I +R++ V+V+ G+ +E+  ++S+    +   + RS    +Q + E   +    R  + 
Sbjct: 4   SISDREA-VKVDSGK-QEIYEVSSS----LDIDELRSDFDPEQNIREDLTRALSPRHINM 57

Query: 75  IQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTA 134
           I I G+  +  GL  S A +L  G   GP  L   + I GG+V    + L E+S+ +P +
Sbjct: 58  ISIAGIIGT--GLYLSTAKSLHNG---GPASLFMNYTIIGGVVYLTMLCLGEMSTFMPIS 112

Query: 135 GAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
           G+      ++  +     + ++  F D +S+ + + ++
Sbjct: 113 GSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTAL 150

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 100 SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
           +AGP G+  GW IAG ++  + +++AEL+ + P AG
Sbjct: 116 TAGPAGILIGWIIAGSMIYCMVMSVAELAIAFPVAG 151

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 22/134 (16%)

Query: 21  SNVEVEVGQVRELRT-ITSAHGAPI------RFVDA--RSAT-------SDKQVLAELGY 64
              ++E G+  E  + ++ +  +P+      RF D+  R+ T       +D + +A L  
Sbjct: 13  QETQLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTA 72

Query: 65  KEELKREFSS--IQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIG 121
              LKR   S  +Q+  +  +I  GL       L    +AGP G+  GW + G ++  + 
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALA---TAGPAGILIGWALTGTMIYCMV 129

Query: 122 IALAELSSSIPTAG 135
           +A+ EL+ + P AG
Sbjct: 130 MAMGELAVTFPIAG 143

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 133/305 (43%), Gaps = 38/305 (12%)

Query: 54  SDKQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
           +D+  L + G K    +  + + +FG      GL  S   TL      GPVG+   + + 
Sbjct: 41  NDRTKLKQ-GLKARHIKMLTLVGVFGT-----GLFLSSGGTLK---KTGPVGMLIAYVLV 91

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIV 173
           G +V    IA+AE++S +P  GA      + + Q + + + ++ G++ T S         
Sbjct: 92  GIVVGCNQIAIAEVASFMPATGA----TIRHSEQFIDEAVGFTFGWISTYS--------- 138

Query: 174 YGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPT-KFTSRMQTI---SIV 229
             L    LSA  V    +   +P    +F      + ILT++ T +F   ++       +
Sbjct: 139 -SLMPGELSATAVVMTYWTDLSP---AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKL 194

Query: 230 SNVFLIILFFIAVPIGVSRSDKLGRHF--NDGHFI-FGKNDNLSSWNKGWNWCIAGMMPA 286
           + + ++I+  + + +G ++ ++LG H+  N G F  +    +   +   W    A +   
Sbjct: 195 ALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDTGKFVGFW----AALSSV 250

Query: 287 IWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNS 346
           +++     +   +A E +++  A+  G   ++ V  I+ +LI + +L  + P  D ++ +
Sbjct: 251 VYSYSGIQNIAILAGETKNSRHAIFHG-AKNVFVRIILLYLITVFVLTLIVPYNDKLIAT 309

Query: 347 EFGQG 351
             G  
Sbjct: 310 GSGNA 314

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 65/166 (39%), Gaps = 26/166 (15%)

Query: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60
           +DGN   + +S    +  RK    V   Q  +L                  AT   ++L 
Sbjct: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDL------------------ATEKDELLE 62

Query: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120
               K  LK+    +   G      GL   IA+ L    +AGPVG    +   G +V ++
Sbjct: 63  HHDVKRSLKQRHIGMIALGGTIG-TGLFIGIATPLA---NAGPVGALVAYLFMGTVVFSV 118

Query: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLC 166
             +L E+++ IP   +  V    +A + +   +  + G++  LS C
Sbjct: 119 TQSLGEMATFIPVTSSFSV----FAQRFLSPALGAANGYMYFLSWC 160

>KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 804

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 116/295 (39%), Gaps = 41/295 (13%)

Query: 101 AGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFL 160
           AGP+G   G+ + G L+L    + AE+ + IP    +   C ++    V     +SVG+ 
Sbjct: 260 AGPIGALIGFTVGGSLILATLFSFAEMVALIPLITGISGLCSRF----VGDSFGFSVGWC 315

Query: 161 DTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFT 220
             LS      S V  +A  I+ +   +          T     A ++  T +  M  +  
Sbjct: 316 HWLSYAMGFPSEV--IASTIMLSYYKNMEEVATKKSTTALTITAIVVGSTAINLMDVRVY 373

Query: 221 SRMQTISIVSN---VFLIILFFIAVPIGVSRSDKLG-RHFND----------GHFI---- 262
              +  S       VFL+I+  I +  G  +++ +G R++N           G F     
Sbjct: 374 GEFEYFSSAFKLLVVFLLIIIMIVMNAGGLKNEYIGFRYWNSNKSPISEVTFGPFRPTFD 433

Query: 263 -----FGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGS 317
                FG  + +  +      CIA  + + +     +     A EAR+  +AVP  +   
Sbjct: 434 LQDKGFGSRNGVPGFGGVVLSCIASSLASAFAYVGSEIGFIAAGEARNPRKAVP-SVTKR 492

Query: 318 ISVCWIVGWLICIVLLACM----DPNI---DNVLNS--EFGQGMT--QIIYDALG 361
           I    IV +L+ I ++       DP +   +N  +S  E   G +  Q I DALG
Sbjct: 493 IFTRVIVFYLLSIFVVGLNIYSGDPRLLRFNNAASSIAEVNNGDSGYQAIIDALG 547

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 47  VDARSATSDKQVLAELGYKEELKREFSS--IQIFGVAFSI-MGLLPSIASTLDGGLSAGP 103
           VD     +D Q +A L  +  L+R+  +  +Q+  +  +I  GL    +  L    +AGP
Sbjct: 63  VDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALR---TAGP 119

Query: 104 VGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
            G+  GW +   ++L + ++L E++ + P +G
Sbjct: 120 AGILIGWGLMATMILCMCLSLGEMAVTFPVSG 151

>Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,
           801 aa] {ON} ANNOTATED BY YGOB -
          Length = 801

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 104/251 (41%), Gaps = 29/251 (11%)

Query: 18  NRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQI 77
           N   N  V   ++  L T+T      +  +D  S  S+K V  +   + +L+     +Q+
Sbjct: 192 NFDKNFTVVQEELEPLSTLT------VDVLDENSPPSNKSVPQQSTIQRKLR--VRHLQM 243

Query: 78  FGVAFSI-MGLLPSIASTLDGGLS---AGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
             +  +I +GL       L+ G +   AGP+G   G+ I G L+L    + AE+ + IP 
Sbjct: 244 ISLGATIGVGLF------LNSGKAFSIAGPMGALIGFTIGGTLILATLFSFAEMVALIPL 297

Query: 134 AGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNV 193
              +   C ++    V     +SVG+   LS      S V  +A  I+ +   +      
Sbjct: 298 ITGISGLCSRF----VGDAFGFSVGWCHWLSYAVGFPSEV--IASTIMLSYYKNLEQIAT 351

Query: 194 TNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSN----VFLIILFFIAVPIGVSRS 249
               T       ++ +T++  M  +    ++  S V      VFLIIL  I + +G   +
Sbjct: 352 NRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVFLIIL-MIVMNVGGLHN 410

Query: 250 DKLGRHFNDGH 260
           D +G  + + H
Sbjct: 411 DYIGFRYWNRH 421

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 49/113 (43%), Gaps = 15/113 (13%)

Query: 32  ELRTITSAHG----APIRFVDARSAT-SDKQVLAELGYKEELKREFSSIQIFGVAFSIMG 86
           EL ++T A+      P    DA  A   DKQV      K ELK+    +   G      G
Sbjct: 53  ELASLTHAYSRSRVEPEHDEDAEEADYEDKQV------KRELKQRHIGMIALGGTIG-TG 105

Query: 87  LLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYV 139
           L   IA+ L     AGPVG    +   G +V  +  AL E+++ IP   ++ V
Sbjct: 106 LFVGIATPL---ADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITV 155

>Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR160W
           (SSY1) - regulator of transporters [contig 27] PARTIAL
          Length = 726

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 104/251 (41%), Gaps = 29/251 (11%)

Query: 18  NRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQI 77
           N   N  V   ++  L T+T      +  +D  S  S+K V  +   + +L+     +Q+
Sbjct: 192 NFDKNFTVVQEELEPLSTLT------VDVLDENSPPSNKSVPQQSTIQRKLR--VRHLQM 243

Query: 78  FGVAFSI-MGLLPSIASTLDGGLS---AGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
             +  +I +GL       L+ G +   AGP+G   G+ I G L+L    + AE+ + IP 
Sbjct: 244 ISLGATIGVGLF------LNSGKAFSIAGPMGALIGFTIGGTLILATLFSFAEMVALIPL 297

Query: 134 AGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNV 193
              +   C ++    V     +SVG+   LS      S V  +A  I+ +   +      
Sbjct: 298 ITGISGLCSRF----VGDAFGFSVGWCHWLSYAVGFPSEV--IASTIMLSYYKNLEQIAT 351

Query: 194 TNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSN----VFLIILFFIAVPIGVSRS 249
               T       ++ +T++  M  +    ++  S V      VFLIIL  I + +G   +
Sbjct: 352 NRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVFLIIL-MIVMNVGGLHN 410

Query: 250 DKLGRHFNDGH 260
           D +G  + + H
Sbjct: 411 DYIGFRYWNRH 421

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 100 SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
           +AGP G+  GW I G ++ T+ +AL EL+   P +G
Sbjct: 120 TAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSG 155

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 92/443 (20%), Positives = 175/443 (39%), Gaps = 66/443 (14%)

Query: 10  SSAMDTIKNRKSNVEVE-VGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKE-- 66
           + ++D   ++ S  E+  +  ++E   I + +       D   A + K  +     KE  
Sbjct: 2   NESVDMRMSKVSQYEINSISTIKEEELICARYDGQ----DTEEAVAGKSSINNDSAKETE 57

Query: 67  -------ELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLT 119
                  E+KR+     I  +A         I         AGPVG    +   G ++ +
Sbjct: 58  TSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYS 117

Query: 120 IGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 179
           +  +L E+++ IP   +  V    +A + +   +  + G++  LS C       + L   
Sbjct: 118 VTQSLGEMATFIPVTSSFSV----FAQRFLSPALGATNGYMYWLSWC-----FTFALELS 168

Query: 180 ILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQ----TISIVSNV-FL 234
           +L  ++      +    + + V   C+  +T++   P K+    +    +I +++ + F+
Sbjct: 169 VLGQII--QYWTDAVPLVAWIVIFWCL--LTLMNMFPVKYYGEFEFCIASIKVIALLGFI 224

Query: 235 IILFFIAVPIGVSRSDKLGRHFND----GHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTI 290
              F I    G S      R++ +    G  I  KN N   +  GW   ++ ++ A +T 
Sbjct: 225 FFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRF-LGW---VSSLINAAFTY 280

Query: 291 GAYDSCLHMAEEARDAVRAVPFGI---VGSISVCWIVGWLICIVLLACMDPNIDN----V 343
              +     A EA +  RAVP  I   V  I V +I+      +L+   DP +D+    V
Sbjct: 281 QGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFV 340

Query: 344 LNSEF----GQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDG 399
            +S F        T+++ D         F ++ +I     G S V   SR  ++ +++  
Sbjct: 341 SSSPFMISIENSGTKVLPDI--------FNAVVLITILSAGNSNVYIGSRVLYSLSKNSL 392

Query: 400 IPFSNFFKKVSNTT--GVPVRAV 420
            P     + +SN T  GVP  AV
Sbjct: 393 AP-----RFLSNVTKGGVPYFAV 410

>Ecym_7299 Chr7 (630846..632495) [1650 bp, 549 aa] {ON} similar to
           Ashbya gossypii AGL026W
          Length = 549

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 10/62 (16%)

Query: 47  VDARSATSDKQVLAELG-YKEELKREFSSIQIFGVAFS---------IMGLLPSIASTLD 96
           +D   + +DK+VL E   YK  +K  FS ++++G+AF+         +    PS+  TL+
Sbjct: 308 MDVGESDNDKEVLKEHNSYKFAIKLAFSDLKVWGIAFTVSLLVAASGVQNFFPSVVGTLN 367

Query: 97  GG 98
            G
Sbjct: 368 YG 369

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 100 SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
           +AGP G+  GW I G ++ T+ +AL EL+   P +G
Sbjct: 120 TAGPAGILIGWGITGTMIFTMVMALGELAVVFPVSG 155

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 91/210 (43%), Gaps = 18/210 (8%)

Query: 223 MQTISIVSNVFLIILFFIAVPIGVSRSDKLG-RHFNDGHF--IFGKNDNLSS--WNKGWN 277
           + +  I+  + L +  FI +  G  + D+ G R+  D  F   F  N+  SS  + +G+ 
Sbjct: 199 LASFKILLAIGLFLFTFITMLGGNPKHDRYGFRYITDTKFKQYFPNNEGSSSMGYFQGFL 258

Query: 278 WCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFG---IVGSISVCWIVGWLICIVLLA 334
            C+   + A +TI   D    +A E +   + +P     +   ++V ++ G L   ++ +
Sbjct: 259 ACV---IQASFTIAGPDYVAMIAGECKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCS 315

Query: 335 CMDPNIDNVLNSE---FGQGMTQIIYDALGKRWTLGFL-SIFIICQFLMGASTVVANSRQ 390
             DPN+  V+N+     G     I  + LG +     + +  +   F  G +    +SR 
Sbjct: 316 SNDPNLTAVINNPRPGAGSSPYVIAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRT 375

Query: 391 FWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
            +  + D   P    F+  +  +GVP+ AV
Sbjct: 376 LYGLSLDGYAP--KLFQYCTK-SGVPINAV 402

>NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {ON}
           Anc_8.342
          Length = 845

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 20/143 (13%)

Query: 7   SASSSAMDTIKNRKSNVEVEVGQVRELRT----ITSAHGAPIRFVDARSATS----DKQV 58
           S+ +S+M  I +  S   +E+ + RE+ +    I  + G+   F D     S    D + 
Sbjct: 198 SSRASSMTEIIDNASYGNIEIDEEREISSKSHIIEESPGSMTSFTDRERRKSILPFDLEK 257

Query: 59  L----AELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLS---AGPVGLGWGWF 111
           +        Y  + K     IQ+  +     G   S+   L  G +   AGP G   G+ 
Sbjct: 258 MFNDPGNTKYYVQRKLRVRHIQMLSI-----GTCFSVGFFLTSGRAFSIAGPFGTLLGFA 312

Query: 112 IAGGLVLTIGIALAELSSSIPTA 134
           +AG +VL   ++  ELS+ IP +
Sbjct: 313 LAGSIVLATLLSFTELSTLIPVS 335

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 69/164 (42%), Gaps = 12/164 (7%)

Query: 10  SSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELK 69
           S ++ +  N    + +   Q   L   T+++G           T D +          LK
Sbjct: 2   SKSISSATNSSEEISISKKQQDHLIYETTSYGV------NEVYTIDPEANIREDLTRALK 55

Query: 70  -REFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELS 128
            R  + I I G+  +  GL  S +++L  G   GP  L   + + GG+V    + LAE+S
Sbjct: 56  PRHINMISIAGIIGT--GLYLSTSTSLHKG---GPASLFINYSLIGGIVYLTLLCLAEMS 110

Query: 129 SSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSI 172
           + +P +G+      ++        + ++  F D +S+ + + ++
Sbjct: 111 TYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTAL 154

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 92/426 (21%), Positives = 172/426 (40%), Gaps = 51/426 (11%)

Query: 16  IKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSS- 74
           IK   S  + E   ++E+++    +    R   +   + +  V+++  Y+  LK+  S+ 
Sbjct: 5   IKKEASVSKQEFNGMKEVKSNEETY----RTSHSNLESQNSDVVSD--YEHNLKKGLSNR 58

Query: 75  -IQIFGVAFSI-MGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIP 132
            IQ+  +   I  GL    +STL      GP  L   + I   +V  I   LAE+   +P
Sbjct: 59  HIQLIALGGCIGTGLFVGTSSTLT---QCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLP 115

Query: 133 TAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFN 192
             G+V        P+ V + +  S+GF    +   S   +V   A ++ +A  +      
Sbjct: 116 QQGSV--------PELVTRYVDPSLGFAAGWNYAYSYAMLV---ATELTAAAGIVR---Y 161

Query: 193 VTNPITYGVFAAC-IIAMTILTSMPTKFTSRMQ----TISIVSNVFLIILFFIAVPIGVS 247
            T+ +  GV+    +I + +L     +F    +    ++ I+  + L+++  +    G  
Sbjct: 162 WTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAP 221

Query: 248 RSDKLGRHF--NDGHFIFG-KNDNLSSWNKGWNWCIAGMMPAIWT--------IGAYDSC 296
             D++G  +  N G F +     NL  +   W   I      I +        + A D+ 
Sbjct: 222 NHDRVGFRYWRNPGAFGYHITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTR 281

Query: 297 LHMAEEARDAV-RAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQI 355
            ++ + +R  + R + F +  S+ +  IV      +LLA ++ N     +S F QG+   
Sbjct: 282 RNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLA-LEENRPGAASSPFVQGIANS 340

Query: 356 IYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGV 415
               L     +  L+      +  G S   A+SR   A ++    P    F K+ N  GV
Sbjct: 341 GIPVLNHVINVAILT----SAWSAGNSFFYASSRSILALSKQGDAP--KIFSKI-NRFGV 393

Query: 416 PVRAVW 421
           P  AV+
Sbjct: 394 PYNAVF 399

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 100 SAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCIS--YSV 157
           +AGP G+  GW + G ++  + +A+ EL+ + P AG       ++  +      +  Y++
Sbjct: 108 TAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAM 167

Query: 158 GFLDTLSLCASVCSI 172
           G+L TL L     SI
Sbjct: 168 GWLITLPLEIVAASI 182

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 142/340 (41%), Gaps = 48/340 (14%)

Query: 101 AGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFL 160
           AGPVG    +   G ++ ++  +L E+++ IP   +  V    +A + +   +  + G++
Sbjct: 99  AGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSV----FAQRFLSPALGATNGYM 154

Query: 161 DTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGV-FAACII----AMTILTSM 215
             LS C       + L   +L  ++            T+ V  AA I+     +T++   
Sbjct: 155 YWLSWC-----FTFALELSVLGQII---------QYWTHAVPLAAWIVIFWCLLTLMNMF 200

Query: 216 PTKFTSRMQ----TISIVSNVFLIILFFIAVPIGVSRSD-KLG-RHFND----GHFIFGK 265
           P K+    +    +I +++ +  II  F  V  G  + D  +G R++ +    G  I   
Sbjct: 201 PVKYYGEFEFCIASIKVITLLGFIIFSFCIV-CGAGQPDGPIGFRYWRNPGAWGPGIISS 259

Query: 266 NDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGI---VGSISVCW 322
           N N   +  GW   ++ ++ A +T    +     A EA +  +AVP  I   V  I V +
Sbjct: 260 NKNEGRF-LGW---VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFY 315

Query: 323 IVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLMGAS 382
           I+      +L+   DP +D+             I ++  K     F ++ +I  F  G S
Sbjct: 316 ILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNS 375

Query: 383 TVVANSRQFWAFARDDGIPFSNFFKKVSNTT--GVPVRAV 420
            V   SR  ++ +++   P     K +SN T  GVP  AV
Sbjct: 376 NVYIGSRVLYSLSKNSLAP-----KCLSNVTRGGVPYLAV 410

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 89/420 (21%), Positives = 166/420 (39%), Gaps = 45/420 (10%)

Query: 17  KNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA--ELGYKEELK-REFS 73
            N +S    E   V   R  T   G    F++  + +  + +    +   K +LK R  S
Sbjct: 16  HNDRSAESSESSDVLHHRKETKNEGI---FINQENMSEVESLYGNDDPDVKRDLKPRHMS 72

Query: 74  SIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
            I + G   +  GL   IAS +     AGPVG    +   G +   +  +L E+++ IP 
Sbjct: 73  MISLGGTIGT--GLFMGIASPIR---VAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127

Query: 134 AGAVYVSCYQWAPQR-VRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFN 192
                 S +    QR +   +  + G+L   S C     + + L   I+   L+   +F 
Sbjct: 128 T-----SSFTMYTQRFLSPALGAANGYLYWFSWC-----VTFALELSIIGQ-LIQYWTFA 176

Query: 193 VTNPITYGVFAACIIAMTILTSMPTKFTSRMQ----TISIVSNVFLIILFFIAVPIGVSR 248
           V   +   VF    I +T    +P +F   ++     + ++S +F  +++ + +  G S 
Sbjct: 177 VPLSVWIVVFW---ILLTASNMIPVRFYGEIEFWIAALKVLS-IFGFLIYALVMVCGGSS 232

Query: 249 SDKLGRHF--NDGHFIFG--KNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEAR 304
              LG  +  N G +  G   ++   +   GW   ++ ++ A +T    +     A E++
Sbjct: 233 EGALGFRYWKNPGPWGMGMISSNKYEARFLGW---VSSLIKAAFTYQGTELVGITAGESK 289

Query: 305 DAVRAVPFGI---VGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQG-MTQIIYDAL 360
           +  + VP  I      I   +I+      +L+   DP +    +S+         I ++ 
Sbjct: 290 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSG 349

Query: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420
            K     F  + ++     G S +   SR  +  ++    P  + FKK +N  GVP  AV
Sbjct: 350 TKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP--SLFKK-TNKQGVPFYAV 406

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 117/275 (42%), Gaps = 24/275 (8%)

Query: 65  KEELK-REFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIA 123
           K+EL+ R  S I I G   +  GLL    ++L     AGPV +   +   G LV  +   
Sbjct: 56  KKELEARHVSMIAIGGSLGT--GLLIGTGTSLS---LAGPVSILIAYSFVGFLVYIVMTC 110

Query: 124 LAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSA 183
           L E+++ IP  G        +A +     + ++VG+       + +   +     Q+ +A
Sbjct: 111 LGEMATYIPLDGFT-----SYASRYCDPALGFAVGY-------SYLFKYLIITPNQLTAA 158

Query: 184 VLVSN--PSFNVTNP-ITYGVFAACIIAMTIL-TSMPTKFTSRMQTISIVSNVFLIILFF 239
            LV     S    NP +   +F   I+ + ++      +F   + +  ++  + LI+L F
Sbjct: 159 ALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLF 218

Query: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKG-WNWCIAGMMPAIWTIGAYDSCLH 298
           + +  G    D+LG  F      F       S +KG +   +A  + A++     + C  
Sbjct: 219 VIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGI 278

Query: 299 MAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLL 333
           +A E ++  R VP  I  ++    +V +L+ I LL
Sbjct: 279 VAAECKNPRRNVPRAIKLTLYRI-VVFYLVTIFLL 312

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 93/223 (41%), Gaps = 20/223 (8%)

Query: 35  TITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGVAFSIM---GLLPSI 91
           TIT+  GA I+       TS+ + L E   + ++KRE     +  ++       GL   I
Sbjct: 17  TITAKPGA-IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGI 75

Query: 92  ASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRK 151
           AS +    +AGPVG    +     +   +  +L E+++ IP   +  V    +A + V  
Sbjct: 76  ASPIR---NAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV----FASRFVSP 128

Query: 152 CISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLVSNPSFNVTNPITYGVFAACIIAMTI 211
            +  + G+L  LS C     I + L   ++  +++    ++   PIT    A   + +T 
Sbjct: 129 ALGAANGYLYWLSWC-----ITFALEISVIGRLIL---YWSDAVPIT-AWMAIFWVLLTA 179

Query: 212 LTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGR 254
           +  +P KF    +       V  I+ F     + V    KLGR
Sbjct: 180 INLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR 222

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 51  SATSDKQVLAELGYKEELKREFSSIQIFGVAFSI---MGLLPSIASTLDGGLSAGPVGLG 107
           S  SD+ V+     KEELKR+ +   +  +A       GLL   ASTL+   SAGP GL 
Sbjct: 104 SIPSDEVVIK----KEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLN---SAGPAGLL 156

Query: 108 WGWFIAGGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQ-RVRKCISYSVGFLDTLS-L 165
            G+ + G  V  +  A  EL  +     A  +  +   P   V    ++SVG++ TL  L
Sbjct: 157 IGYALMGTCVYCVIQAAGELGVTY----ANLIGGFNAYPAILVAPSFAFSVGWIYTLQWL 212

Query: 166 CASVCSIV 173
           C +   +V
Sbjct: 213 CMTPLELV 220

>NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4.195
          Length = 590

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 58/309 (18%), Positives = 116/309 (37%), Gaps = 23/309 (7%)

Query: 102 GPVGLGWGWFIAGGLVLTIGIAL-AELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFL 160
           G VGL    +  G ++   G+ +  E  ++IP  G           +   + I     F 
Sbjct: 89  GSVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGG---------EKNYLEAIFKKPRFF 139

Query: 161 DTLSLCASVCSIVYGLAQQILSAVL-VSNPSFNVTNPITYGVFAACIIAMTILTSMPTKF 219
            T    A V  + +     I +AV+ ++  +  VT     G+  A +     + ++  K 
Sbjct: 140 ITSMYAAYVFFLGWAAGNSINTAVMFLTAANAEVTEWNQRGIGVAIVFFAFAINTISVKA 199

Query: 220 TSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWC 279
              +Q I  +  V ++I   I   + +    K G   ++ H  F   +  +++       
Sbjct: 200 GLYLQNILGIFKVGIVIFISITGWVALGGGLKDGYQSHNFHDAFAGTETATAYG-----V 254

Query: 280 IAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPN 339
           +  +   IW+   Y +  +   E +D VR +      S+    I+   + I   A +   
Sbjct: 255 VTALYNVIWSFVGYSNVNYALGEVKDPVRTLKIAGPTSMIFLAIIYIFVNIAYFAVVPK- 313

Query: 340 IDNVLNSEF--GQGMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARD 397
            + +++S+         I++    KR    F+ +  +   L   S + +  R      R+
Sbjct: 314 -EKLISSKLVLAADFFDIVFGGHAKRAAAAFVGLSALGNVL---SVIFSQGRIIQQLGRE 369

Query: 398 DGIPFSNFF 406
             +PFSNFF
Sbjct: 370 GVLPFSNFF 378

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 14/141 (9%)

Query: 8   ASSSAMDTIKNRKSNVEVEVGQVRELRTITS--AHGAPIRFVDARSATSDKQVLAELGY- 64
           AS  +   +++RK   E+   ++  + + TS     A IR   +  +  D +   + GY 
Sbjct: 9   ASVGSSPDMRHRKKAEEMRETKLAAVTSYTSLGESRADIRHRMSFESGEDGESEEQTGYV 68

Query: 65  -KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLS-----AGPVGLGWGWFIAGGLVL 118
              E+KRE     I      ++ L  +I + L  GLS     AGPVG    +   G LV 
Sbjct: 69  HDAEVKRELKQRHI-----GMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVY 123

Query: 119 TIGIALAELSSSIPTAGAVYV 139
           ++  +L E+++ IP   +  V
Sbjct: 124 SVTQSLGEMATFIPVTSSFTV 144

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 15/123 (12%)

Query: 14  DTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFS 73
           + +K+ KS   V+  +V  L +I+          DA +   D   + E   +    R  +
Sbjct: 18  NVVKDPKSAPVVQNYEVTPLDSIS----------DAVTDLEDHDKIRESLNRSLSPRHIN 67

Query: 74  SIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPT 133
            I + GV  +  GL  S A +L  G   GP  L   + I GG+V    + L E+S+ +P 
Sbjct: 68  MISVAGVIGT--GLYLSTAKSLHVG---GPGSLFINYTIMGGVVYLTMLCLGEMSTFMPI 122

Query: 134 AGA 136
           +G+
Sbjct: 123 SGS 125

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 86/224 (38%), Gaps = 36/224 (16%)

Query: 2   DGNLMSASSSAMD---TIKNRKSNVEVEVGQVRELRTITSAHGAPI--RFVDARSATSDK 56
           D N +SA  S  +   TI +   N++ +      L   T      I  R +D+    ++ 
Sbjct: 10  DNNGVSAKLSKNEFVTTIFSDNKNIDDKYEHAESLTDYTKTENRNIFQRVIDSFKPPANG 69

Query: 57  QVLAELGYKEELKREFSSIQIFGVAF--SI-MGLLPSIASTLDGGLSAGPVGLGWGWFIA 113
                  +   LKR   S  +  +A   SI  GL       L  G   GP+ L  GW IA
Sbjct: 70  SF-----HTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANG---GPLALVLGWSIA 121

Query: 114 GGLVLTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLD-TLSLCASVCSI 172
           G  ++     L E++   P  GA                 +Y   FLD +LS   S   +
Sbjct: 122 GSQIVGTIHGLGEITVRFPVVGAF---------------ANYQTRFLDPSLSFVISTIYV 166

Query: 173 V---YGLAQQILSAVLVSNPSFNVTNPITY-GVFAACIIAMTIL 212
           +   + L  +ILS+ +      +  +P+ +  +F   I+++ + 
Sbjct: 167 LQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLF 210

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 11/127 (8%)

Query: 17  KNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELK-REFSSI 75
           +N  S +  E    ++    +      +  V++ S TSD +   +  Y ++L  R   ++
Sbjct: 26  RNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAE---DSRYNKDLSVRHLLTL 82

Query: 76  QIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAG 135
            + G   +  GL  +  S L  G   GP  L   W I    + TI  AL ELSS+ P  G
Sbjct: 83  AVGGAIGT--GLFVNSGSALTTG---GPGSLVIDWVIISTCLFTIVNALGELSSTFPVVG 137

Query: 136 A--VYVS 140
              VY+S
Sbjct: 138 GFNVYIS 144

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 53/131 (40%), Gaps = 10/131 (7%)

Query: 11  SAMDTIKNRKSNVEVEVGQVRELRTITSAHGA--PIRFVDARSATSDKQVLAELGYKEEL 68
            A+D+ K+  S+      Q ++   I   H +  P R +  R   S K  L    +   L
Sbjct: 28  KALDSYKS--SSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHTHNL 85

Query: 69  KREFSSIQIFGVAF--SI-MGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALA 125
           KR   +  +  +A   SI  GL       L  G   GP+ L  GW IAG  ++     L 
Sbjct: 86  KRTLKARHLIMIAIGGSIGTGLFIGSGQALASG---GPLALIIGWSIAGTQIVGTIHGLG 142

Query: 126 ELSSSIPTAGA 136
           E++   P  GA
Sbjct: 143 EITVRFPVVGA 153

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 43  PIRFVDARSATSDKQV---LAELGYKEEL-KREFSSIQIFGVAFSIMGLLPSIASTLDGG 98
           P   +D    T D+Q+   LA   YK+ L +R  + I I G       L   +   L   
Sbjct: 66  PYSELDGDKYTKDEQIQMTLAAQPYKKSLHQRHLTMIAIGGT------LGTGLFIGLGYS 119

Query: 99  LSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGA 136
           L++GP  L  G+ I G  +  +  + AELS   P +G+
Sbjct: 120 LASGPASLLIGFLIVGTSMFCVVQSAAELSCQYPVSGS 157

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 7/130 (5%)

Query: 10  SSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELK 69
           SS    I  RKS +  E+G +     +   HG      D  S T + Q   +   K  LK
Sbjct: 53  SSDKPPITLRKSKLS-EIGSLHSGSNL-HQHGTTSLHDDEESDTEEAQ-YQDTRVKRALK 109

Query: 70  REFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSS 129
           +    +   G      GL   IA+ L    +AGPVG    +   G +V  +  +L E+++
Sbjct: 110 QRHIGMIALGGTIG-TGLFVGIATPLS---NAGPVGSLIAYIFMGSVVYFVTQSLGEMAT 165

Query: 130 SIPTAGAVYV 139
            IP   ++ V
Sbjct: 166 FIPVTSSITV 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,868,226
Number of extensions: 2105020
Number of successful extensions: 6883
Number of sequences better than 10.0: 196
Number of HSP's gapped: 6774
Number of HSP's successfully gapped: 203
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)