Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.197165.699ON46746724130.0
KLTH0E01122g5.699ON47247614020.0
SAKL0E14850g5.699ON4704688581e-110
Ecym_40215.699ON4594605685e-67
AFR283W5.699ON4524595442e-63
ZYRO0G06666g5.699ON5034955262e-60
KLLA0A00660g5.699ON5244964974e-56
TDEL0B022205.699ON4894904842e-54
Smik_9.235.699ON5273813311e-32
Skud_9.225.699ON5373863212e-31
YIL146C (ATG32)5.699ON5293853081e-29
Suva_9.435.699ON5133112992e-28
CAGL0H06545g5.699ON4922072399e-21
KNAG0L021005.699ON4444482325e-20
NCAS0G002605.699ON5103072264e-19
TBLA0E020905.699ON7491662133e-17
KAFR0D022505.699ON5561391722e-12
Smik_16.2817.450ON478102860.050
TBLA0A054801.86ON31696820.12
Kpol_2001.735.699ON41127820.15
Kpol_1028.106.377ON368153800.30
KLTH0E08360g4.129ON1242103741.7
Suva_16.3667.450ON498102714.1
NOTE: 1 genes in the same pillar as Kwal_55.19716 were not hit in these BLAST results
LIST: TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19716
         (467 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   934   0.0  
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   544   0.0  
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   335   e-110
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   223   5e-67
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   214   2e-63
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   207   2e-60
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   196   4e-56
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   191   2e-54
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   132   1e-32
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   128   2e-31
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   123   1e-29
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   119   2e-28
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    97   9e-21
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    94   5e-20
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    92   4e-19
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    87   3e-17
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    71   2e-12
Smik_16.281 Chr16 (520552..521988) [1437 bp, 478 aa] {ON} YPR036...    38   0.050
TBLA0A05480 Chr1 (1356034..1356984) [951 bp, 316 aa] {ON} Anc_1....    36   0.12 
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    36   0.15 
Kpol_1028.10 s1028 (31741..32847) [1107 bp, 368 aa] {ON} (31741....    35   0.30 
KLTH0E08360g Chr5 complement(762740..766468) [3729 bp, 1242 aa] ...    33   1.7  
Suva_16.366 Chr16 (650437..651933) [1497 bp, 498 aa] {ON} YPR036...    32   4.1  

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/467 (97%), Positives = 454/467 (97%)

Query: 1   MSQYTTASRSRVNDRDPRFSTSERLNNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIP 60
           MSQYTTASRSRVNDRDPRFSTSERLNNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIP
Sbjct: 1   MSQYTTASRSRVNDRDPRFSTSERLNNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIP 60

Query: 61  SPHLLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSHQPAGILSSSDTSEDEPDHFL 120
           SPHLLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSHQPAGILSSSDTSEDEPDHFL
Sbjct: 61  SPHLLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSHQPAGILSSSDTSEDEPDHFL 120

Query: 121 SPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSN 180
           SPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSN
Sbjct: 121 SPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSN 180

Query: 181 SFVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIM 240
           SFVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIM
Sbjct: 181 SFVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIM 240

Query: 241 VIFTDPKNGQSLLEMVTGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDH 300
           VIFTDPKNGQSLLEMVTGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDH
Sbjct: 241 VIFTDPKNGQSLLEMVTGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDH 300

Query: 301 QDVHRLLRYLYTLSNEIDSEYDTEVGPXXXXXXXXXXXXXETPAAVNRWVIWSISLTVGV 360
           QDVHRLLRYLYTLSNEIDSEYDTEVGP             ETPAAVNRWVIWSISLTVGV
Sbjct: 301 QDVHRLLRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYKKRETPAAVNRWVIWSISLTVGV 360

Query: 361 GIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQLVLAFKKAVK 420
           GIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQLVLAFKKAVK
Sbjct: 361 GIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQLVLAFKKAVK 420

Query: 421 QVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467
           QVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI
Sbjct: 421 QVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/476 (61%), Positives = 351/476 (73%), Gaps = 13/476 (2%)

Query: 1   MSQYTTASRSRV--------NDRDPRFSTSE-RLNNRNSILDPHLSVLQLLERNEVHSEP 51
           MSQY T  R +         + ++P F+TS   LN RNSILDPHLSVLQLL+R +  SE 
Sbjct: 1   MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL 60

Query: 52  QEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSHQPAGILSSSDT 111
              +H +I  P    RS  E +  SIS+SWQSI+HTD S++N  G+ +HQ AGILSSSDT
Sbjct: 61  SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT 120

Query: 112 SEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETV 171
           SEDEPD  LSPSPN +AF N A ++FPEA H  E  SL   Q+S  E +N  E+NDNETV
Sbjct: 121 SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNS--EIANPREENDNETV 178

Query: 172 TLSLINSSNSFVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTR 231
           T+SL+NSSNSFVMPKLSL Q  +KF ILIVGKPAQRFYRDIPRAY KMFEV D      R
Sbjct: 179 TMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPR 238

Query: 232 DVDQFSAIMVIFTDPKNGQSLLEMVTGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLI 291
           +++++SA+MVIF +PK G+ LLE V   +SNIIAVCQRGQQQQISN+LNR+SK++ +RL+
Sbjct: 239 EMNKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLV 298

Query: 292 YHLTVMSDHQDVHRLLRYLYTLSNEIDSEYDTEVGPXXXXXXXXXXXXXETPAAVNRWVI 351
           YHLTVMSDHQDVHRLLRYL TLS E+DS Y+TEVG                   VNRWVI
Sbjct: 299 YHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNRWVI 358

Query: 352 WSISLTVGVGIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQL 411
           WSISLTVGVG+GYCISCLLSST S    ++TL S DE+ ++E+   SPHE+  +NY R L
Sbjct: 359 WSISLTVGVGLGYCISCLLSSTSSTL--SVTLRSGDEVTIMEDIHNSPHESPFDNYLRHL 416

Query: 412 VLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467
           +LA K+AVKQV+ SFKQ L G SLPVLWMQRIGK+W+SEASD TLPGVTALDLVL+
Sbjct: 417 LLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  335 bits (858), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 282/468 (60%), Gaps = 30/468 (6%)

Query: 16  DPRFSTSERLNNRNSILDPHLSVLQLLERNEVHSE----------PQEFRHS-DIP-SPH 63
           DP  S S     R SILDPH SVLQLLERN    E          P E + + + P SPH
Sbjct: 17  DPSASGSMPFQKR-SILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPH 75

Query: 64  LLSRSSSEPMGRSISDSWQSIRHTDYSILNLIGETSH-QPAGILSSSDTSEDEPDHFLSP 122
              +   E + +SISDSWQSI+  DYSILN + +TS  Q  GILSSSDTSE+E DH  SP
Sbjct: 76  ---KRYPEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVGILSSSDTSEEELDHLNSP 132

Query: 123 SPN-EYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNS 181
           SP+ +  F NG    F   + A    + ATL +       V E++DNETVT+SL  SSNS
Sbjct: 133 SPSSQQVFPNGPPISF--QTQAGVLTASATLPNP-----GVLEEDDNETVTVSLAASSNS 185

Query: 182 FVMPKLSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMV 241
           FVMP+LSL+Q   +F IL+VGKPA++F+ ++P+ YQKMF++ D ES     V  ++A+M+
Sbjct: 186 FVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVMI 245

Query: 242 IFTDPKNGQSLLEMVTGR--SSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSD 299
           IF D K    +L+ +  +     II +CQRGQ+QQ+++LL  F K   +RL++  TVMS+
Sbjct: 246 IFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSN 305

Query: 300 HQDVHRLLRYLYTLSNEIDSEYDTEVGPXXXXXXXXXXXXXETPAAVNRWVIWSISLTVG 359
           HQ++H+LLRYL+ LS EIDS Y+T+                ++    NRWVIW +SLTVG
Sbjct: 306 HQEIHKLLRYLHRLSTEIDSGYETD-ETHLKVRKRKKTHKKKSKGTSNRWVIWGLSLTVG 364

Query: 360 VGIGYCISCLLSSTMSVRGNTLTLHSSDEIALIEEAPISPHETVLENYFRQLVLAFKKAV 419
           VGIG CIS +LSS  S     +   S D++ L+EE P  P +        Q++   +K V
Sbjct: 365 VGIGCCISFILSSYSSSV--QIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTV 422

Query: 420 KQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467
           KQ +   KQ ++     + W+QR+GK+ +SE SD T+  V ALDLVL+
Sbjct: 423 KQFNLVLKQFIYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  223 bits (568), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 157/460 (34%), Positives = 243/460 (52%), Gaps = 40/460 (8%)

Query: 26  NNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSS---------SEPMGRS 76
             + SILDPHLSVL++LE  E++          +  PH LS +S            +  S
Sbjct: 22  TTQRSILDPHLSVLEILEGKELNK---------VEGPHELSGASRVSGKQFEGERVLHHS 72

Query: 77  ISDSWQSIRHTDYSILNLIGETSHQ---PAGILSSSDTSEDEPDHFLSPSPNEYAFANGA 133
           IS+SWQSI+ TDY  L+   +TS Q     GILSSSDTSE+E D   SP P   A +   
Sbjct: 73  ISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFD 132

Query: 134 KTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPL 193
             +   A  A      ATL     E     ED+D ETVT+SL N+  S VMPKLSL+  +
Sbjct: 133 SRIINIAGQAFS----ATLSHLRSED----EDDDGETVTVSLPNTMTSLVMPKLSLSDRI 184

Query: 194 RKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQ-FSAIMVIFTDPKNGQSL 252
            +  +LIVG+PA++F+  IP++YQKMFE+C     + +DVD+ +S IMVIF D      L
Sbjct: 185 IESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPEL 244

Query: 253 LEMVTGR--SSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYL 310
           L+ +  +     II +CQ+GQ+Q +S+LL ++   + ++L  +  VMS+H + HRLL++L
Sbjct: 245 LDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRLLKHL 304

Query: 311 YTLSNEIDSEYDTEVGPXXXXXXXXXXXXXET-PAAVNRWVIWSISLTVGVGIGYCISCL 369
           + LS+  DS Y+TEV                + P+    WV+W+ S+T+G+GIG C+S +
Sbjct: 305 HQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPSTFRDWVVWTASITIGIGIGCCVSLM 364

Query: 370 LSSTMSVRGNTLTLHSSDEIALIEEAPISPHET--VLENYFRQLVLAFKKAVKQVSQSFK 427
           +S+  +       +     +  I  +P+SP  T     N F       K ++K+++ S +
Sbjct: 365 VSTRYA-----FLVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLR 419

Query: 428 QCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467
                      W+  +G +   + S  ++  +  LD +++
Sbjct: 420 PFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  214 bits (544), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 151/459 (32%), Positives = 235/459 (51%), Gaps = 49/459 (10%)

Query: 26  NNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIR 85
           N    ILDPHLSVL++L+R +     Q    + +    +  R     +  SIS+SWQ+I+
Sbjct: 26  NQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT---VGKRRVERSLHHSISESWQAIK 82

Query: 86  HTDYSILNLIGETS--HQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHA 143
            +DYS L+   E    H   GILSSSDTSE+E +  + PS      A+G   +       
Sbjct: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAE--MRPS------AHGTVHL------- 127

Query: 144 PEGPSLAT--LQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLRKFSILIV 201
             G SLA+   Q  V E ++ AE++D +TVT+S+ +SS S VMPKLSL+Q L +  +L+V
Sbjct: 128 --GSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLV 185

Query: 202 GKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQ-FSAIMVIFTDPKNGQSLLEMVTGRS 260
           G+PA++F+  IP+ YQK+F+V +       DV Q + A+MV+F D      LL+ +  ++
Sbjct: 186 GQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKA 245

Query: 261 --SNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEID 318
               +I VCQ+GQ+  ++ LL R++    +R+     +MS+H + HRLL++L+ L NE +
Sbjct: 246 PCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNLCNESE 305

Query: 319 SEYDTEVGPXXXXXXXXXXXXXETPAAVNRWVIWSISLTVGVGIGYCISCLLSSTMSVRG 378
           S Y+TE+                 P A+  W IW+ S T+G+GIG CIS L+++T     
Sbjct: 306 SGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCIS-LMATT----- 359

Query: 379 NTLTLHSSDEIALIEEAPIS----------PHETVLENYFRQLVLAFKKAVKQVSQSFKQ 428
              T  SS  + L    P            PH  V   Y     +  K  ++Q+  S + 
Sbjct: 360 -RFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFY-----MLCKTTIRQLGTSLRL 413

Query: 429 CLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467
                     W+   G D  S+    +L  +  LD +++
Sbjct: 414 FFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  207 bits (526), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 171/495 (34%), Positives = 247/495 (49%), Gaps = 69/495 (13%)

Query: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHT 87
           R SILDPHLSVL+LL R    + P E    ++         ++     SIS SWQ+I H 
Sbjct: 23  RRSILDPHLSVLELLRRPS-DTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTI-HR 80

Query: 88  DYSILNLIGE---TSHQPAGILSSSDTSEDEPDHFLSPSP-----------------NEY 127
           + S L+++ E   +    AGILSSSDTSEDEPD   SPS                   +Y
Sbjct: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDY 140

Query: 128 AFAN-GAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPK 186
              N G   V PE S+          ++     SN  E++DN+T+T SL +SSNSF+MPK
Sbjct: 141 RSLNVGIPLVLPEDSNN----INNNNKNGSTTGSN-GEEDDNDTITKSLNSSSNSFIMPK 195

Query: 187 LSLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDP 246
           LSL+Q  +KF IL++G+P  +FY  IP+ YQ MFE+    S    +  Q++ I+V+F + 
Sbjct: 196 LSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFEL--PRSHDPAEFKQYTGILVVFQEL 253

Query: 247 KNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVH 304
           K   SLL  V   + N  +I VCQ GQ+QQ+ NLL    K   + L+Y   V+++  D+ 
Sbjct: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313

Query: 305 RLLRYLYTLSNEI--DSEYDTE-----VGPXXXXXXXXXXXXXETPA------------- 344
            + R+L  LS  +  +S+ D E                     ET A             
Sbjct: 314 GMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNN 373

Query: 345 -AVNRWVIWSISLTVGVGIGYCISCLLSST-MSVRGNTLTLHSSDEIAL------IEEAP 396
             VNRWV+W +SLT+GVG+GYCIS L+SST +S+  N L     + ++        +E  
Sbjct: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELK 433

Query: 397 ISPHETVLENYFRQLVLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGK----DWMSEAS 452
           +   +   ++ F   +  FK+A+KQ + + KQ L  H   +  M+RIG     +W    S
Sbjct: 434 LGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRH---LSCMERIGPANCLEW--PTS 488

Query: 453 DTTLPGVTALDLVLI 467
           D     V AL  V++
Sbjct: 489 DEHTNRVLALGYVML 503

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  196 bits (497), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 245/496 (49%), Gaps = 65/496 (13%)

Query: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRS-----------SSEPMGRS 76
           R+SILDPH SV+ LL   +  +    F    I +  L+ R            ++    + 
Sbjct: 38  RHSILDPHDSVMDLLNGQQSCA----FDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKG 93

Query: 77  ISDSWQSIRHTDYSILNLI----------GETSHQPAGILSSSDTSEDEPDHFLSPSPN- 125
           ++DSWQ+I   +YS LN            G+ + Q  G+LSS DTSE+E +   +PSPN 
Sbjct: 94  LTDSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNL 152

Query: 126 -----------------EYAFANGAKTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDN 168
                             +     ++T   + S      S  T Q S  E    A   ++
Sbjct: 153 SASQQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELG--AGTGED 210

Query: 169 ETVTLSLINS--SNSFVMPKLSLAQPLRKFSILIV--GKPAQRFYRDIPRAYQKMFEVCD 224
           ET+ ++L +S   + FVMPKLSL++ +++F ILI+  G  A  FY  + R ++ MF+V  
Sbjct: 211 ETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGK 270

Query: 225 AESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRF 282
                  +  +++A M+IF+D K   ++L  +  +  +  +I +CQ+GQ+Q ++  +  F
Sbjct: 271 LNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTF 330

Query: 283 SKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEIDSEYDTEVGPXXXXXXXXXXXXXET 342
           + ++ ++L+ +  V+SDH ++H LLR+L++L  E+DS+Y+T++                 
Sbjct: 331 ANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDI--PKKTKPRKGAKKKPA 388

Query: 343 PAAVNRWVIWSISLTVGVGIGYCISCLLSS--TMSVRGNTLTLHSSD-EIALIEEAPISP 399
           P    RW  W IS+ +GVGIG C++   S   T S   +   + ++D EI  I +A    
Sbjct: 389 PHLAKRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGN 448

Query: 400 HETVLE--------NYFRQLVLAFKKAVKQVSQSFKQCLHGHSLPVLWMQRIGKDWMSEA 451
             ++LE        ++  Q+    K    Q+++  KQ L  H +   W+Q IGK++M   
Sbjct: 449 SPSILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPD 508

Query: 452 SDTTLPGVTALDLVLI 467
           S +T+  VTALDLV+ 
Sbjct: 509 SQSTISKVTALDLVMF 524

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  191 bits (484), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 156/490 (31%), Positives = 229/490 (46%), Gaps = 78/490 (15%)

Query: 28  RNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHT 87
           + S+LDPHLSVL+LLER     + Q        +  + + ++S      IS SWQ+I   
Sbjct: 28  KKSLLDPHLSVLELLERT---GDTQRVGRGVEKADDMANTTNS------ISSSWQAIHRN 78

Query: 88  DYSILNLIGETSHQPA--GILSSSDTSEDEPDHFLSPS------------PNEYAFANGA 133
           D  I  +    S Q A  GILSSSDTSE+E D   SP+            P    F    
Sbjct: 79  DAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDV 138

Query: 134 KTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPL 193
             + P     P G +     D         ++ D+ET+T SL NSSNSFVMPKLSL+Q  
Sbjct: 139 PVILPARDQEPSGQTQTPDND---------DERDDETLTKSLSNSSNSFVMPKLSLSQKS 189

Query: 194 RKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKNGQ 250
            K  ILI+G+P  +FY+ IP+ YQ  FE+    D   F+     QF+ I+++F + K   
Sbjct: 190 HKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFR-----QFTGILIVFQELKEMV 244

Query: 251 SLLEMV--TGRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLR 308
           SLL  V     +  +I VCQ GQ QQ+ N+L    K+  + L+Y   V+S+H D++ + R
Sbjct: 245 SLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYR 304

Query: 309 YLYTLSNEID-----------------------SEYDTEVGPXXXXXXXXXXXXXETPAA 345
           +L  LS  I                               G              ET   
Sbjct: 305 FLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKET--K 362

Query: 346 VNRWVIWSISLTVGVGIGYCISCLLSS---TMSVR--GNTLTLHSSDEIALIEEAPI--S 398
           +N+W++W ISLTVGVG+GYC+S   SS   +MS +   +      +D + + +++ +   
Sbjct: 363 INKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG 422

Query: 399 PHETVLENYFRQLVLAFKKAVKQVSQSFKQCLHGH-SLPVLWMQRIGKDWMSEASDTTLP 457
            ++  LEN F   +   K+ +KQ + + KQ L  H  LP        K+W +E +     
Sbjct: 423 EYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNR-- 480

Query: 458 GVTALDLVLI 467
            V AL  +L+
Sbjct: 481 -VLALGYILL 489

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  132 bits (331), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 107/381 (28%), Positives = 175/381 (45%), Gaps = 49/381 (12%)

Query: 31  ILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYS 90
           +LDPHLSVL+LL +   HS P     S + S   +  S  + +  SIS SWQ+I+  D  
Sbjct: 41  LLDPHLSVLELLGKTG-HS-PSPMGQSLVTS---IDISGHQNVNDSISGSWQAIQPLDLG 95

Query: 91  ILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFANGAK--TVFPEASHA--- 143
              +    S Q     ILSSSDTSE+E +   +P+ +        +  T    +SH    
Sbjct: 96  ASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQ 155

Query: 144 ---------PEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLR 194
                    P        +  + +  + A + D+ T+T SL +S+NSFVMPKLSL+Q   
Sbjct: 156 LHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNP 215

Query: 195 KFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKNGQS 251
            F +LI+G+    FY+ IP+ YQ +FE+    D+ +F      Q++ I++IF + +   S
Sbjct: 216 VFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFP-----QYTGIIIIFQELREMVS 270

Query: 252 LLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRY 309
           LL  +   S    II +CQ GQ  Q+ N+L  F +   ++L++   V+++ +D+ ++ + 
Sbjct: 271 LLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQR 330

Query: 310 LYTLSNEIDS------------------EYDTEVGPXXXXXXXXXXXXXETPAAVNRWVI 351
           L  LS E                      Y                   +       W  
Sbjct: 331 LQDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFT 390

Query: 352 WSISLTVGVGIGYCISCLLSS 372
           W IS+T+G+  G C++  +++
Sbjct: 391 WGISITIGISFGCCVTYFVTA 411

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  128 bits (321), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 110/386 (28%), Positives = 177/386 (45%), Gaps = 59/386 (15%)

Query: 31  ILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYS 90
           +LDPHLSVL+LL +   HS P    HS + S   +  SS   +  SIS SWQ+I   D  
Sbjct: 41  LLDPHLSVLELLGKTG-HS-PSPMGHSLVTS---IDISSHHYVNDSISGSWQAIHPLDLG 95

Query: 91  ILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPN-----------------EYAFAN 131
              +   +S Q     ILSSSDTSE+E +   +P+ +                    F  
Sbjct: 96  ASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGASVTSPSRPFRQ 155

Query: 132 GAKTV---FPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLS 188
             K +    P       G       +   ++ + A + D+ T+T SL +S+NSFVMPKLS
Sbjct: 156 LHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLS 215

Query: 189 LAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTD 245
           L+Q    F +LI+G+    FY+ IP+ +Q +FE+    D+ +F      Q++ I++IF +
Sbjct: 216 LSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFP-----QYTGIIIIFQE 270

Query: 246 PKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDV 303
            +   SLL  +   S    II +CQ GQ  Q+ N+L  F +   ++L+Y   V+++ +D+
Sbjct: 271 LREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDL 330

Query: 304 HRLLRYLYTLSNEID--------------------SEYDTEVGPXXXXXXXXXXXXXETP 343
            ++ + L  LS E                      S Y  +                +  
Sbjct: 331 KKMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSKKKSFKSNKKPKKK 390

Query: 344 A--AVNRWVIWSISLTVGVGIGYCIS 367
              ++ RW  W +S+T+G+  G C++
Sbjct: 391 KQRSLTRWFTWGVSITIGISFGCCVT 416

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 109/385 (28%), Positives = 175/385 (45%), Gaps = 55/385 (14%)

Query: 31  ILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYS 90
           +LDPHLSVL+LL +   HS P     + + S   +  S +  +  SIS SWQ+I+  D  
Sbjct: 41  LLDPHLSVLELLSKTG-HS-PSPMGQNLVTS---IDISGNHNVNDSISGSWQAIQPLDLG 95

Query: 91  ILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFAN----GAKTVFPEASHA- 143
              +    S Q     ILSSSDTSE+E +   +P+ +          GA  V P  SH  
Sbjct: 96  ASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSP--SHPF 153

Query: 144 -----------PEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQP 192
                      P        +       + A + D+ T+T SL +S+NSFVMPKLSL Q 
Sbjct: 154 KQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQK 213

Query: 193 LRKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKNG 249
              F +LI+G+    FY+ IP+ YQ +FE+    D+ +F      Q++ I++IF + +  
Sbjct: 214 NPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFP-----QYTGIVIIFQELREM 268

Query: 250 QSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLL 307
            SLL  +   S    +I +CQ GQ  Q+ N+L  F +   ++L++   V+++ +D+ ++ 
Sbjct: 269 VSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMF 328

Query: 308 RYLYTLSNEIDSEYDTEVGPXXXXXXXXXXXXXETPAA--------------------VN 347
           + L  LS E   + + E                   A                       
Sbjct: 329 QRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFT 388

Query: 348 RWVIWSISLTVGVGIGYCISCLLSS 372
            W  W IS+T+G+  G C++  +++
Sbjct: 389 SWFTWGISITIGISFGCCVTYFVTA 413

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 152/311 (48%), Gaps = 30/311 (9%)

Query: 29  NSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTD 88
             +LDPHLSVL+LL   +  S P     S + S   +  S+   +  +IS SWQ+I+  D
Sbjct: 39  KGLLDPHLSVLELL--GKTGSSPSPLGQSLVTS---IDISNHHNVIDNISGSWQTIQPLD 93

Query: 89  YSILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFANGAK--TVFPEASHA- 143
                +    S Q     ILSSSDTSE+E D   +P+ +        +  T     SH  
Sbjct: 94  LGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPF 153

Query: 144 ---------PEGPSLATLQDSVYEHSNVAEDNDNE-------TVTLSLINSSNSFVMPKL 187
                    P  P   T      +   +  D+DN        T+T SL +S+NSFVMPKL
Sbjct: 154 KQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKL 213

Query: 188 SLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPK 247
           SL++    F +LI+G+    FY+  P+ YQ +FE+   +S  +    Q++ I+++F + +
Sbjct: 214 SLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFEL--PKSHDSTIFPQYTGIVIVFQELR 271

Query: 248 NGQSLLEMVT--GRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHR 305
              SLL  +    +   II +CQ GQ  Q+ N+L  F K   ++L+Y   V ++ +D+ +
Sbjct: 272 EMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKK 331

Query: 306 LLRYLYTLSNE 316
           + + L  LS E
Sbjct: 332 MFQRLQDLSLE 342

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 109/207 (52%), Gaps = 16/207 (7%)

Query: 182 FVMPKLSLA-QPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIM 240
           FVMPKLSL  +P +   +L+VG+ ++RF++DIPR Y++ F +  ++S    +   +  I+
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHI--SQSSDPSEFQNYIGIV 252

Query: 241 VIFTDPKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMS 298
           ++F + K   ++L  +   +    II +CQ GQ+ ++ N+L  F K   + L Y    ++
Sbjct: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312

Query: 299 DHQDVHRLLRYLYTLSNEIDSEYD-----------TEVGPXXXXXXXXXXXXXETPAAVN 347
           + + + +L ++   L N++++E D           ++                +     +
Sbjct: 313 NEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPSTNYS 372

Query: 348 RWVIWSISLTVGVGIGYCISCLLSSTM 374
           +W+ W ISLT+GV IGY  + ++++T+
Sbjct: 373 KWITWGISLTIGVSIGYYATYMITTTL 399

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 111/448 (24%), Positives = 202/448 (45%), Gaps = 82/448 (18%)

Query: 29  NSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGR-SISDSWQSIRHT 87
           NS+LDPHLSVL+LLE++      +   H++ P       S ++  G+  +S+SW ++   
Sbjct: 6   NSVLDPHLSVLELLEKS-----CERGGHAEAPG-----SSRNKGAGQIQLSESWCTVERD 55

Query: 88  DYSILNLIGETSHQPAGILSSSDTSED-EPDHFLSPSPNEYAFANGAKTVFPEASHAPEG 146
           + S +     +     G+LSSSDTSE+ EP+            A+  +   P  S     
Sbjct: 56  ELSAMER-SASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVAD-TRMARPAMSLQSTS 113

Query: 147 PSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKL-----------SLAQPLRK 195
            +L    D V        D+D+ TV+ SL +SSNSF+MPKL           S A   R 
Sbjct: 114 STL----DGV--------DDDSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRC 161

Query: 196 FSILIVGKPAQRFYRD-IPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLE 254
           F + ++G+ A +F ++ +P  ++  FE+        +  D+   I+++  + +   SLL 
Sbjct: 162 FKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADR-QGILIVVQEVRELISLLN 220

Query: 255 MVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYLYT 312
            V        ++AV  R +Q Q+ N+L  F++   + L++    +S+++ + ++  ++  
Sbjct: 221 RVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDN 280

Query: 313 LSNEID-------------------SEYDTEVGPXXXXXXXXXXXXXETPAAVNRWVIWS 353
           L+ + +                   +E D   GP             +      RW++W 
Sbjct: 281 LARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGP------------SKPEGTFKRWLLWG 328

Query: 354 ISLTVGVGIG-YCISCLLSSTMSV-----RGNTLTLHSSDEIALIEEAPISP----HETV 403
           +S+++G+G G YC+S ++SS+M V     R    TL ++   A    A  +P    H+  
Sbjct: 329 VSISLGIGAGYYCVSYVVSSSMCVSCFNFRHTDHTLAATTSTAAAAAAAATPSGIDHDAD 388

Query: 404 LENYFRQLVLAFKKAVKQVSQSFKQCLH 431
                R  +   K ++K+ +   KQ +H
Sbjct: 389 SHTTLRHCLSIVKNSLKRATAFVKQAMH 416

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 95/307 (30%), Positives = 151/307 (49%), Gaps = 49/307 (15%)

Query: 30  SILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDY 89
           S+LDPHLSVL++LER +                   + +  E   R IS SWQ+I     
Sbjct: 37  SLLDPHLSVLEMLERKD-------------------NDTVMEASSR-ISRSWQNIESPAD 76

Query: 90  SILNLIGETSHQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGPSL 149
           S   L+   S Q + ++S   +S D  D        E    N   +    +S     PS 
Sbjct: 77  S-KQLLSAKSSQVSNLVSILSSSSDTSDE-------EVDRINSLNSAGEGSSKNYNNPS- 127

Query: 150 ATLQDSVY--EHSNV-AEDNDN---ETVTLSLINSS---NSFVMP---KLSLAQPLRKFS 197
             LQ+ +Y  E ++V A DND+    T+T SL +SS   NSFVMP     S     RKF 
Sbjct: 128 -PLQNPIYLPEFTDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSSQSQQRKFQ 186

Query: 198 ILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTR-DVDQFSAIMVIFTDPKNGQSLLEMV 256
           ILI G+    FYR IP+ YQ +F V +  +  TR ++D F+A ++IF + K   SLL  +
Sbjct: 187 ILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRI 246

Query: 257 TGRSS------NIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYL 310
           +   S       II +CQ GQ+ ++ ++L  F K + + L+  + +++D + + ++ + +
Sbjct: 247 SEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERALLKMFKTM 306

Query: 311 YTLSNEI 317
            ++S  +
Sbjct: 307 QSISKTV 313

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (85%), Gaps = 1/28 (3%)

Query: 347 NRWVIWSISLTVGVGIGYCIS-CLLSST 373
           N+WV+WSISLTVG G+GY IS C+ +S+
Sbjct: 380 NKWVVWSISLTVGAGMGYIISYCVFNSS 407

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 92/166 (55%), Gaps = 6/166 (3%)

Query: 159 HSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLRKFSILIVGKPAQ-RFYRDIPRAYQ 217
           +S +    +N  +T S+ +SSNSF+MPKLS     RKF ILI+G      FY++IP +Y+
Sbjct: 313 NSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYK 372

Query: 218 KMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSSN---IIAVCQRGQQQQ 274
            +FE+    +F   +   ++ I ++  D  + +S+L  +   S N   II +C++GQ  +
Sbjct: 373 YLFELP-PNNFD-YNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINE 430

Query: 275 ISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEIDSE 320
           + N+L  + KT  L L+Y   V ++   ++ L  +L  LS  ++ E
Sbjct: 431 VKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLSKNVELE 476

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 348 RWVIWSISLTVGVGIGYCISCLLSSTMS 375
           + + W++SL+VGVG+G+C+S   S+  S
Sbjct: 612 KIIYWTVSLSVGVGLGFCLSYYASTIFS 639

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 31/135 (22%)

Query: 27  NRNSILDPHLSVLQLLE--RNEVHSEPQEFRHSDIPSPHL----LSRSSSEPMGRSISD- 79
           ++   LDPH S+++LLE  +  +     E   +++  P      L+    E  G ++ D 
Sbjct: 23  DKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDI 82

Query: 80  ----------------SWQSIRHTDYSILNL-----IGETSHQPAGILSSSDTSEDEPDH 118
                           SWQ I+  DYS L++     I   ++   GILSS+D+SE+E D+
Sbjct: 83  NSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQDN 142

Query: 119 FLSPSPNEYAFANGA 133
               S N Y   N A
Sbjct: 143 I---SLNTYLRVNSA 154

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 80/139 (57%), Gaps = 13/139 (9%)

Query: 182 FVMPKLSLAQPLRK------FSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQ 235
           F+MP+LSL +  R+      F ILIVG+ + + ++ IP  +Q +F++   +S+   +  +
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQL--QKSYDINEYQK 281

Query: 236 FSAIMVIFTDPKNGQSLLEMVTGRSSNI----IAVCQRGQQQQISNLLNRFSKTHHLRLI 291
           F+AI+V+  + +   SLL  ++ RS  +    IA+C++    Q  N+L  + +   + L+
Sbjct: 282 FTAILVVIQETRELISLLNRIS-RSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLL 340

Query: 292 YHLTVMSDHQDVHRLLRYL 310
           Y   V+S+ +++ R+L +L
Sbjct: 341 YQPFVISNTEELDRMLVFL 359

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/29 (65%), Positives = 23/29 (79%)

Query: 347 NRWVIWSISLTVGVGIGYCISCLLSSTMS 375
           N+W+IW ISL++GVGIGYCIS   SS  S
Sbjct: 435 NKWIIWGISLSIGVGIGYCISYFGSSPWS 463

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 36/72 (50%), Gaps = 12/72 (16%)

Query: 29 NSILDPHLSVLQLLERN--EVHSEPQEFRHS---DIPSPHLLSRSSSEPMGRS------- 76
          NSILDPHLSVL+LLER    VH +      +   DI       R +SE  G S       
Sbjct: 28 NSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDI 87

Query: 77 ISDSWQSIRHTD 88
          IS SW +I+  D
Sbjct: 88 ISQSWHTIQRRD 99

>Smik_16.281 Chr16 (520552..521988) [1437 bp, 478 aa] {ON} YPR036W
           (REAL)
          Length = 478

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 202 GKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSS 261
           G    +F+++ P+  +++F+V     F+T  +  F+ + ++  D  +   L+E +  +S+
Sbjct: 110 GDDTVKFFQEDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQDELHNVGLVEKLL-KSN 168

Query: 262 NIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDV 303
           N+I + Q  +Q     +         +RL+  LTV+ +++DV
Sbjct: 169 NLINILQNVEQMDTCYVC--------IRLLQELTVIPEYRDV 202

>TBLA0A05480 Chr1 (1356034..1356984) [951 bp, 316 aa] {ON} Anc_1.86
           YGR046W
          Length = 316

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 17/96 (17%)

Query: 88  DYSILNLIGETSHQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEAS----HA 143
           D  ++ L  ET HQ AGI++S D            +P +Y+FA G+  +F +A     H 
Sbjct: 28  DNQLIKLDNETEHQLAGIVNSFD------------APIQYSFAYGS-GIFKQAGYSEKHK 74

Query: 144 PEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSS 179
           P+   +  + D+   HS   + N N   TL   N +
Sbjct: 75  PQIDIILAVSDTNQFHSINLQQNSNHYSTLKYFNGT 110

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%), Gaps = 2/27 (7%)

Query: 348 RW--VIWSISLTVGVGIGYCISCLLSS 372
           +W  V + IS+T+GVG+GYCIS L+ S
Sbjct: 305 KWLFVYYGISITLGVGVGYCISSLVVS 331

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 8/50 (16%)

Query: 181 SFVMPKLSLAQPL-------RKFSILIVGKPAQRFYRDI-PRAYQKMFEV 222
           +F+MPKL ++Q L            LIVG  +  FY +I P  Y+K F++
Sbjct: 76  TFIMPKLIVSQNLWDTNNDNNNNRFLIVGNNSLFFYNEILPINYKKFFKI 125

>Kpol_1028.10 s1028 (31741..32847) [1107 bp, 368 aa] {ON}
           (31741..32847) [1107 nt, 369 aa]
          Length = 368

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 55/153 (35%), Gaps = 21/153 (13%)

Query: 35  HLSVLQLLERNEVHSEPQEFRHSDIPS--PHLLSRSSSEPMGRSISDSWQSIRHTDYSIL 92
            LS+ Q ++ + +    +E + +  PS  P  L R  SE M     D           IL
Sbjct: 188 ELSIEQEIDDDMITQRIRELQLAKNPSILPEALVRCKSESMEMVNEDDLLEAPKVPERIL 247

Query: 93  NLIGETSHQPAGILSSS--DTSEDEPDH----------FLSPSPNEYAFANGAK------ 134
            LIGE   Q   I+S    DT   + +H          F      EY F    K      
Sbjct: 248 KLIGEAEAQNNTIISQDEIDTKNQDRNHGIFGNQYRLVFNKKERGEYEFYENIKPNIHKD 307

Query: 135 -TVFPEASHAPEGPSLATLQDSVYEHSNVAEDN 166
             V  +    P+ P     Q  ++E  NV +DN
Sbjct: 308 SLVVIKIPIEPKLPEWFKFQRDLWEEKNVKQDN 340

>KLTH0E08360g Chr5 complement(762740..766468) [3729 bp, 1242 aa]
           {ON} similar to uniprot|P39702 Saccharomyces cerevisiae
           YAL002W VPS8 involved in vacuolar protein sorting
           required for localization and trafficking of the CPY
           sorting receptor Vps8p is a membrane-associated
           hydrophilic protein which contains a C-terminal
           cysteine- rich region that conforms to the H2 variant of
           the RING finger Zn2 binding motif.
          Length = 1242

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 12/103 (11%)

Query: 106 LSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGPSLATLQDSVYEH------ 159
           LS  +T + +P + L+PS  E  FA   K VF  +S+ P+  S  +  D V         
Sbjct: 349 LSVFETVDFQPINVLNPS--ETGFACFEKQVFVLSSYCPQIGSFLSWSDIVLRFVQKQAF 406

Query: 160 ----SNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLRKFSI 198
                +VA     E +   ++    S  + +  LAQPLR  SI
Sbjct: 407 LSALKSVAYFLVTENLPTDVLGLQKSLALRRKQLAQPLRNLSI 449

>Suva_16.366 Chr16 (650437..651933) [1497 bp, 498 aa] {ON} YPR036W
           (REAL)
          Length = 498

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/102 (19%), Positives = 52/102 (50%), Gaps = 9/102 (8%)

Query: 202 GKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLEMVTGRSS 261
           G    +F+++ P+  +++F V     F+T  +  F+ + ++  +  +   L+E +  +++
Sbjct: 130 GDDTVKFFQEDPKQLEQLFAVSLNGDFQTVLISGFNVVSLLVQNGLHNVGLVEKLL-KNN 188

Query: 262 NIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDV 303
           N++ + Q  +Q     +         +RL+  LTV+ +++DV
Sbjct: 189 NVLNILQNIEQMDTCYVC--------IRLLQELTVVPEYRDV 222

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,412,178
Number of extensions: 2036594
Number of successful extensions: 7578
Number of sequences better than 10.0: 67
Number of HSP's gapped: 7786
Number of HSP's successfully gapped: 80
Length of query: 467
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 354
Effective length of database: 40,524,141
Effective search space: 14345545914
Effective search space used: 14345545914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)