Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.197075.700ON1143114355080.0
KLTH0E01100g5.700ON1177118639560.0
SAKL0E14872g5.700ON1140115432820.0
KLLA0A00638g5.700ON1155111830680.0
TDEL0B022105.700ON1095112330010.0
ZYRO0G06644g5.700ON1166112729950.0
Kpol_2001.745.700ON1113113128840.0
TPHA0D045905.700ON1127114527650.0
KNAG0L021105.700ON120090926010.0
AFR284W5.700ON1103109525980.0
Ecym_40205.700ON1125108725960.0
NCAS0G002505.700ON118394925710.0
YIL147C (SLN1)5.700ON122092224760.0
Smik_9.225.700ON123093324510.0
Skud_9.215.700ON122193224470.0
Suva_9.415.700ON121995124420.0
Kpol_1043.685.700ON104288621680.0
TPHA0E002505.700ON106889021380.0
CAGL0H06567g5.700ON116970520560.0
KAFR0D022405.700ON118774220260.0
TBLA0E021005.700ON114068415000.0
NDAI0F003105.700ON125948814521e-180
TBLA0I016805.700ON121446013031e-159
Ecym_74744.385ON4961521655e-11
KNAG0M001804.385ON6151381666e-11
ADL388W4.385ON4821201631e-10
KLLA0A10219g4.385ON4751371621e-10
KAFR0B069904.385ON5451201594e-10
CAGL0F09097g4.385ON6301171577e-10
SAKL0B12408g4.385ON4651201559e-10
TDEL0D003204.385ON5471201541e-09
Kpol_265.24.385ON5491371541e-09
YHR206W (SKN7)4.385ON6221401532e-09
NCAS0A064504.385ON6091201532e-09
KLTH0D17182g4.385ON4641201522e-09
NDAI0D034304.385ON5971311532e-09
Suva_15.4124.385ON6171401513e-09
Smik_8.2964.385ON6251401514e-09
Skud_8.2734.385ON6231401514e-09
ZYRO0G00484g4.385ON6471201514e-09
TBLA0A107004.385ON5871201505e-09
TPHA0C001504.385ON5101211471e-08
Kwal_47.167704.385ON4611201442e-08
Ecym_50775.230ON7951641391e-07
Kwal_33.152885.230ON5871601335e-07
KAFR0J007005.230ON6201131327e-07
ADR343C5.230ON7491651319e-07
TDEL0E039805.230ON7301281301e-06
CAGL0D02882g5.230ON6671351291e-06
Suva_10.845.230ON6951351291e-06
KLTH0B02684g5.230ON5951301292e-06
KNAG0B051405.230ON6481151273e-06
NCAS0D029005.230ON7621271273e-06
YLR006C (SSK1)5.230ON7121351263e-06
ZYRO0A11154g5.230ON7761351246e-06
Skud_12.725.230ON7021351239e-06
TPHA0N008505.230ON6701361192e-05
Kpol_1004.45.230ON7141381183e-05
KLLA0E09505g5.230ON635751183e-05
NDAI0I020005.230ON8901311183e-05
Smik_12.685.230ON7121351183e-05
TBLA0D031705.230ON7651411112e-04
SAKL0G12100g5.230ON73871980.007
SAKL0B01210g8.34ON1588126940.023
Klac_YGOB_Anc_8.348.34ON1571110890.090
YFL033C (RIM15)8.34ON1770118860.21
Skud_6.388.34ON1758118840.36
CAGL0K12562g8.34ON1682126840.39
Kwal_55.213935.443ON123374820.62
ACR218W8.34ON1569106820.64
Smik_6.468.34ON1760118820.72
KLLA0E04533g7.222ON42181800.96
TDEL0C005908.34ON1602142791.3
Kpol_1035.408.34ON1517113791.4
TBLA0E049804.385ON79195781.7
ZYRO0F03014g8.34ON1604132763.2
Suva_6.268.34ON1753110763.3
Suva_16.1438.694ON150592744.9
TBLA0G034508.34ON197275745.6
TPHA0D003608.34ON1536126728.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19707
         (1143 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  2126   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...  1528   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1268   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1186   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1160   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1158   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1115   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1069   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1006   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1005   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  1004   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   994   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   958   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   948   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   947   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   945   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   839   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   828   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   796   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   785   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   582   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   563   e-180
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   506   e-159
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    68   5e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    69   6e-11
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    67   1e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    67   1e-10
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    66   4e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   7e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    64   9e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    64   1e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    64   1e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    64   2e-09
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    64   2e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    63   2e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     64   2e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    63   3e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    63   4e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   4e-09
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    63   4e-09
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    62   5e-09
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    61   1e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    60   2e-08
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    58   1e-07
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    56   5e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    55   7e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    55   9e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    55   1e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    54   1e-06
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    54   1e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    54   2e-06
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    54   3e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    54   3e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    53   3e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    52   6e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    52   9e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    50   2e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    50   3e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    50   3e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    50   3e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    50   3e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    47   2e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    42   0.007
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    41   0.023
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    39   0.090
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    38   0.21 
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    37   0.36 
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    37   0.39 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    36   0.62 
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    36   0.64 
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    36   0.72 
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    35   0.96 
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    35   1.3  
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    35   1.4  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   1.7  
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    34   3.2  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    34   3.3  
Suva_16.143 Chr16 complement(241716..246233) [4518 bp, 1505 aa] ...    33   4.9  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    33   5.6  
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    32   8.8  

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 2126 bits (5508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1045/1143 (91%), Positives = 1045/1143 (91%)

Query: 1    MVRLNNIDLGAFFQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLR 60
            MVRLNNIDLGAFFQRRLRRPLVVSIR                      GVYFTSSFKSLR
Sbjct: 1    MVRLNNIDLGAFFQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLR 60

Query: 61   AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD 120
            AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD
Sbjct: 61   AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD 120

Query: 121  KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM 180
            KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM
Sbjct: 121  KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM 180

Query: 181  LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV 240
            LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV
Sbjct: 181  LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV 240

Query: 241  IIVSTVYDDHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFN 300
            IIVSTVYDDHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFN
Sbjct: 241  IIVSTVYDDHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFN 300

Query: 301  NKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSH 360
            NKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSH
Sbjct: 301  NKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSH 360

Query: 361  WAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARA 420
            WAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARA
Sbjct: 361  WAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARA 420

Query: 421  GRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYIT 480
            GRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYIT
Sbjct: 421  GRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYIT 480

Query: 481  STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540
            STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE
Sbjct: 481  STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 541  GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE 600
            GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE
Sbjct: 541  GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE 600

Query: 601  LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD 660
            LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD
Sbjct: 601  LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD 660

Query: 661  SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSS 720
            SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSS
Sbjct: 661  SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSS 720

Query: 721  TEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXX 780
            TEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQR                     
Sbjct: 721  TEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENE 780

Query: 781  XTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESPKKWVISMEVHDTGPGIDPAL 840
             TKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESPKKWVISMEVHDTGPGIDPAL
Sbjct: 781  DTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESPKKWVISMEVHDTGPGIDPAL 840

Query: 841  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900
            HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ
Sbjct: 841  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900

Query: 901  TKELLFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXX 960
            TKELLFEDVENPFEDEFNPDSKKNRKVKFRMG                            
Sbjct: 901  TKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSRSESSGTEGNGGNSPGVEGS 960

Query: 961  XXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRRKILVAEDNNVNQEVIK 1020
                      VSVGSVRVDRPFLQ                ADRRKILVAEDNNVNQEVIK
Sbjct: 961  GGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRRKILVAEDNNVNQEVIK 1020

Query: 1021 RMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELG 1080
            RMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELG
Sbjct: 1021 RMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELG 1080

Query: 1081 YSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNE 1140
            YSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNE
Sbjct: 1081 YSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNE 1140

Query: 1141 SEK 1143
            SEK
Sbjct: 1141 SEK 1143

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1177

 Score = 1528 bits (3956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 792/1186 (66%), Positives = 895/1186 (75%), Gaps = 56/1186 (4%)

Query: 1    MVRLNNIDLGAFFQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLR 60
            M RL   DLGA+ +R+L+ P ++SIR                      GVYFTSSFKS+R
Sbjct: 1    MARLKKFDLGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMR 60

Query: 61   AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD 120
            AERL+VA+QLK+SQIDQNL YLYYQCY+LSTRD+LQNALTQYLAGNT+TENW+DA TTLD
Sbjct: 61   AERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLD 120

Query: 121  KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM 180
            KFLGSSNLFSLARVYDSSFQDVLN SNN SGNL+PE++LTQLFPLST+V+LPSSLE  GM
Sbjct: 121  KFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGM 180

Query: 181  LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV 240
            LTDPVLN + YLMSMSLPIFANPSIILST+KVYGYITVVISAEGLK+V+NDTTAL+DSSV
Sbjct: 181  LTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV 240

Query: 241  IIVSTVYDDHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFN 300
            I+VSTVYD+ ELAGYHLVFPPY M  D+I++ Y I N SFL DA K  KGGSIKST F  
Sbjct: 241  ILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLY 300

Query: 301  NKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSH 360
            +K +A+GYSPC+S L QWVAIITQPE+ FL PSTRLA+IIVGTC+AIAVVTC VTFPLSH
Sbjct: 301  SKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSH 360

Query: 361  WAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARA 420
            WAVQPIVRLQKATEIITAGRGLRSDN STL+SHKR+STAESFSS     S+RRSGSVAR+
Sbjct: 361  WAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARS 420

Query: 421  GRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYIT 480
             + KYIP+S+K     N  + I     EN ED  +QKV+SPTP S+ +E ++ +SERYIT
Sbjct: 421  SKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYIT 480

Query: 481  STNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540
            STNLIEARVP Y RLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE
Sbjct: 481  STNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAE 540

Query: 541  GANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTE 600
            GANEAKTVFIANISHELRTPLNGILGMTAIAMAE D  KVKSSLKLIFRSGELLLHIMTE
Sbjct: 541  GANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTE 600

Query: 601  LLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGD 660
            LLTFSKNVLKRTKLEERDF + +IALQVESIFGKLAKDQHVNLTISI+PN+LR+MVLWGD
Sbjct: 601  LLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGD 660

Query: 661  SNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTES-RTS 719
            SNRIVQIVMNLVSNALKFTPVDG+V+VKF LLGEYDE K+    +    V+P  ES + S
Sbjct: 661  SNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKES 720

Query: 720  STEAKDEKNA-----ESCVDSDTNVLSLPSTAES-------TDEKNVKIGQRXXXXXXXX 767
            ST    EK       ES   S+      PST+E+       T    +             
Sbjct: 721  STLGPTEKGGIKDVTESASSSNATWPPSPSTSETSNGSKAETTSGKLTESSEEDEKEEKL 780

Query: 768  XXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALES-------- 819
                           +  G    S  DD   +T+ R+DS+  +NE+ R++ES        
Sbjct: 781  DHDDKDEGDEESEEEEYRGEAEVSGKDDTNNETQ-REDSNENQNEDARSIESENASSYDD 839

Query: 820  -----------------------PKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLS 856
                                   P++  I+MEV DTGPGI+PAL ESVFEPFVQGDQTLS
Sbjct: 840  AIFHSRLRKGNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLS 899

Query: 857  RQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDE 916
            RQYGGTGLGLSICRQLA MM+G+M LDS+VGVGSKF+FTVPLTQTKEL FE+ ENPFEDE
Sbjct: 900  RQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDE 959

Query: 917  FNPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVGSV 976
            FNPDSKKNRKVKF++                                       VSVGSV
Sbjct: 960  FNPDSKKNRKVKFKVS----------KNNKRKKSHSSSSGQNSSVGTPTVSESEVSVGSV 1009

Query: 977  RVDRPFLQXXXXXXXXXXXXXXXXADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACD 1036
            RVDRPFLQ                A++ K+LVAEDNNVNQEVIKRMLNLEGL+DV+LACD
Sbjct: 1010 RVDRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACD 1069

Query: 1037 GQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSN 1096
            GQDAFDKVKA++  GK YDLIFMDVQMPRVDGL+ATRMIR EL Y+HPIVALTA+ADD N
Sbjct: 1070 GQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADDRN 1129

Query: 1097 IKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNESE 1142
            IKEC+DAGMNGFL+KPI+RPKIK IL EYCP    + +GE K ++E
Sbjct: 1130 IKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYF-KADGEKKGKTE 1174

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1154 (59%), Positives = 820/1154 (71%), Gaps = 59/1154 (5%)

Query: 13   FQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKS 72
             + +L+ P  V IR                      GVYFT+++KSLRA+RLHVAAQLKS
Sbjct: 7    LRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKS 66

Query: 73   SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132
            SQIDQNLNYLYYQCYWLSTRD LQ++L +Y AGNT+ ENWS+A   L+KFLGSS+LFS+A
Sbjct: 67   SQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVA 126

Query: 133  RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192
            R+YDS+F+ VLN +NNGSGNL+PE++LT LFPLSTD  L SSL+ +G+LTDPVLN +VY+
Sbjct: 127  RIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186

Query: 193  MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHEL 252
            MSMSLPIFA+PSI+L+ +++ GYITVV+SAE LK V+NDTTALD S V I+S  Y +  L
Sbjct: 187  MSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSL 246

Query: 253  -AGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311
               YH VFPP+ +  D+I+  + IENGSF++ A  D K GS+K T FF  K +AVGYSPC
Sbjct: 247  PVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306

Query: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371
                 QWVA+I+QPE +FLSPSTRL  II+GT + IAV  C+VTFPL+HWAV+PIVRLQK
Sbjct: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366

Query: 372  ATEIITAGRGLRSDNSSTLFSH-----KRTSTAESFSSIFGTGSVRRSGSVARAGRDKYI 426
            ATEIITA RGLRS N S   S      KR ST+ S  S+F T                 I
Sbjct: 367  ATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRT-----------------I 409

Query: 427  PDSSKEVPRGNSSDAIHEVNQENIEDIE----------MQKVNSPTPYSMMNESQAVKSE 476
             D   E   G+S+  +H     +++  E          +   N  TP S  N+  + KS+
Sbjct: 410  TDRPHERDNGHSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSD 469

Query: 477  RYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAK 536
             ++ STNLI+ARVPVY RLFSDELSELT+TFNTMTDELDRHYALLEDRVRART+QLEAAK
Sbjct: 470  NFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAK 529

Query: 537  IEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLH 596
            IEAE ANEAKTVFIANISHELRTPLNGILGMTAI+MAE+D  KV++SLKLIFRSGELLLH
Sbjct: 530  IEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLH 589

Query: 597  IMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMV 656
            I+TELLTFSKNVL+RTKLEER+F I+D+ALQV+SIFGKLAKDQHVNL+I + PN++R+M+
Sbjct: 590  ILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMI 649

Query: 657  LWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTES 716
            LWGDSNRI+QIVMNLVSNALKF+PVDGKV V+ +LLGEYD +KSK S Y +VF+ P TE 
Sbjct: 650  LWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEI 709

Query: 717  RTSSTEAKDEKNAE-SCVDSDTNVLSLPSTAESTDEKNVK---IGQRXXXXXXXXXXXXX 772
              +S         E + VD+    L+    ++S+D + +K   I                
Sbjct: 710  PDASASKSSLSTLEYTKVDAIQRRLA----SKSSDSQKLKEEPIASSDVSSSDGKDESEA 765

Query: 773  XXXXXXXXXTKS-------IGSGNTSSYDDAIFQTRLRKDSSNEENEE-----GRALESP 820
                     + S       + S N SSYDDAI   +LRK  S    E+     GR LE  
Sbjct: 766  DTDTDTDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEIS 825

Query: 821  KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM 880
            K WVI++EV DTGPGI+PALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTM
Sbjct: 826  KTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTM 885

Query: 881  KLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXX 940
            KL+S+VGVGSKF+FTVPLTQT+E+ F+DVENPFEDEFN  SKKNRKVKF+M         
Sbjct: 886  KLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMN-----KNS 940

Query: 941  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXX 1000
                                          VSVGSVRVDRPFLQ                
Sbjct: 941  GGSKSRPSVNTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKS 1000

Query: 1001 ADRR-KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFM 1059
             +R  KILVAEDNNVNQEV+KRMLNLEGL D++LACDGQ+AFDKVKA      HY +IFM
Sbjct: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060

Query: 1060 DVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIK 1119
            DVQMPRVDGL +T+MIR+EL YSHPIVALTAFADDSNIK CLD+GMNGFLSKPIKRPK+K
Sbjct: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120

Query: 1120 AILKEYCPRPIDEK 1133
            ++L E+CP  ++++
Sbjct: 1121 SVLSEFCPDFVEKR 1134

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1118 (56%), Positives = 783/1118 (70%), Gaps = 45/1118 (4%)

Query: 49   GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
            GVYFT+++KS+RAERL VAAQLKSSQ+DQNLNYLYYQ YWLSTRD LQ+AL  + AGN+S
Sbjct: 50   GVYFTTNYKSVRAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSS 109

Query: 109  TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
             +NW+ A  +L+KFLGSS LFS ARVYD+SF  V+N +NNGSG+ IPEN+L +LFPLS  
Sbjct: 110  RDNWNSAEDSLEKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGV 169

Query: 169  VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
              L SSL  TG++TDPV N + YL+SMSLP+  NPSIIL+T ++ GYITV+ SAE LK+V
Sbjct: 170  EPLSSSLLTTGIVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAV 229

Query: 229  YNDTTALDDSSVIIVSTVYD-DHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
             NDT ALD SSV I+S V+D +  L GYH VFPP+          + I+NG+F+ DA ++
Sbjct: 230  VNDTIALDKSSVSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFEN 289

Query: 288  GKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAI 347
            GK GS+  T     + IAVGYSP    L  WVA++TQPE +FLSP+ RL KII GT  AI
Sbjct: 290  GKVGSVMKTNMVQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAI 349

Query: 348  AVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLR------SDNSSTLFSHKRTSTAES 401
            AV  C++TFP++HWAVQPIVRLQKATEIIT+GR L+      + +S+T  +H RT +  +
Sbjct: 350  AVFMCLLTFPIAHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSN 409

Query: 402  FSSIFGTGSVRRSGSVARAGRDKYIPDSSKEVPRGNS-SDAIHEVNQENIE----DIEMQ 456
             + +        + SV +     Y+  +    P   + S ++   N + I     D+   
Sbjct: 410  QNQVMKL----FNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRS 465

Query: 457  KVNSPTPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDR 516
                 TP+S  N+S +  SERYI STNL+EA VPVY+R F DELSELT+TFNTMTDELDR
Sbjct: 466  ATTGSTPFS--NDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDR 523

Query: 517  HYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEED 576
            HYALLE+RVRART+QLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAIAMAE D
Sbjct: 524  HYALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETD 583

Query: 577  TAKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLA 636
              KV++SLKLIFRSGELLLHI+TELLTFSKNVLKRTKLEERDF ++DIALQ++SIFGKLA
Sbjct: 584  MQKVQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLA 643

Query: 637  KDQHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYD 696
            KDQHV L+I++ PN +R++VLWGDSNRI+QIVMNLVSNALKFTPVDGKVDV+ +LLGEYD
Sbjct: 644  KDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYD 703

Query: 697  EEKSKASEYKEVFVLPPTESR-------TSSTEAKDEKNAES-CVDSDTNVLSLPSTAES 748
             ++S++ +Y+EVFV+P +E+        TS+T  +   N+ S  V++ T   S   T + 
Sbjct: 704  SKRSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTK- 762

Query: 749  TDEKNVKIGQRXXX------XXXXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRL 802
            T E ++++                                  + +  +SSYDDAIF ++ 
Sbjct: 763  TKEGSIQVESETSTEGNDNDESSIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQF 822

Query: 803  RK-----DSSNEENEEGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSR 857
            +K     DS  EEN   R L+ PK WVISMEV DTG GIDP+L ESVFEPFVQGDQTLSR
Sbjct: 823  KKVLSSTDSDTEEN-TFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSR 881

Query: 858  QYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEF 917
            QYGGTGLGLSICRQLA MM GTMKLDS+VGVGSKF FTVPL QTKE++F+  E  FEDEF
Sbjct: 882  QYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEF 941

Query: 918  NPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVGSVR 977
            N  S+KNRKVKF++                                        SVG+VR
Sbjct: 942  NIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTEN-----SVGNVR 996

Query: 978  VDRPFLQXX-XXXXXXXXXXXXXXADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACD 1036
            VDRPFLQ                   R ++LVAEDNNVNQEVIKRML LEGL D+++ACD
Sbjct: 997  VDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACD 1056

Query: 1037 GQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSN 1096
            GQ+A++KV+     G+ Y +IFMDVQMPRVDGL AT+MIR +L Y  PIVALTA+ADDSN
Sbjct: 1057 GQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSN 1116

Query: 1097 IKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKE 1134
            IK CL++GM+GFL KPIKRP +K I+ +YC +   ++E
Sbjct: 1117 IKVCLESGMDGFLPKPIKRPLLKKIIAQYCSKKEKQRE 1154

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1160 bits (3001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1123 (55%), Positives = 781/1123 (69%), Gaps = 45/1123 (4%)

Query: 9    LGAFFQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAA 68
            LG   + +   P  +SIR                      GVYFTS++KSLR+ERL+VAA
Sbjct: 3    LGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAA 62

Query: 69   QLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNL 128
            QLKSSQIDQNLNYLYYQCYWLS++  LQ +L  Y++GN +  NW D+S+ L KFL SS L
Sbjct: 63   QLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSAL 122

Query: 129  FSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNG 188
            FS+ARVYD+ FQ VLN +NNG+G+++ +++L +L PLS+++ALP+SLE  GMLTDPVLNG
Sbjct: 123  FSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNG 182

Query: 189  SVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYD 248
            + YLMSMSLPI+ANPSIIL+ ++VYGY+T+++SA+ LKSVY+D TAL+ SSV IVS +Y 
Sbjct: 183  TSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYK 242

Query: 249  -DHELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVG 307
             D  L  Y  VF PY   P +++E + I N SFL  A++ GK GS + T  F N+  AVG
Sbjct: 243  KDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVG 302

Query: 308  YSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIV 367
            YSPC+     WVAII+Q EA+F+ PSTRL KII+G  + I    C+ TFPL+HWAVQPIV
Sbjct: 303  YSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIV 362

Query: 368  RLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIP 427
            RLQKATEIIT GRGLRS             T  S S    +  +RR  S + + R   + 
Sbjct: 363  RLQKATEIITEGRGLRS------------GTPGSSSVSRNSSFIRRRFSGSSSVRSPSLA 410

Query: 428  DSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLIEA 487
            D    V R ++  + +        D  +  +NS        E  + ++ +Y+TS+NL+EA
Sbjct: 411  DEKGAVGRASTEGSFNY-------DQAVPSLNSNA------EISSDRTRKYMTSSNLVEA 457

Query: 488  RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547
            RVPVY+  FSDE SELT+TFNTMT+ LD+HYALLEDRVRART+QLEAAK+EAE ANEAKT
Sbjct: 458  RVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKT 517

Query: 548  VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607
            VFIANISHELRTPLNGILGMTAI+M E D  K++SSLKLIFRSGELLLHI+TELLTFSKN
Sbjct: 518  VFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKN 577

Query: 608  VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667
            VL+RTKLE+RDF I D+A+Q++SIFGK+AKDQ V  +I++ PN +R MVL+GDSNRI+QI
Sbjct: 578  VLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQI 637

Query: 668  VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKDEK 727
            VMNLVSNALKFTPVDGKV V+ RLLGEYD+++S+  ++K V+V+  TE R         K
Sbjct: 638  VMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVK 697

Query: 728  NAESCVDSDTNVLSLPST---AESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXTKS 784
              E   D +   +S       A ++D +   +  +                        S
Sbjct: 698  QFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKRSDADDQV-----------S 746

Query: 785  IGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESPKKWVISMEVHDTGPGIDPALHESV 844
            + S +TSSYDD IF T+ +K +S+  +E G  LE PK W IS+EV DTGPGIDP+LHESV
Sbjct: 747  LISISTSSYDDTIFHTQFKKHTSSSGDENGHLLEHPKNWAISVEVEDTGPGIDPSLHESV 806

Query: 845  FEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKEL 904
            FEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTMKLDS++GVGSKF+FT+PLTQT+E+
Sbjct: 807  FEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREI 866

Query: 905  LFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 964
             FED EN FEDEFNP SKKNRKVKF++                                 
Sbjct: 867  EFED-ENAFEDEFNPLSKKNRKVKFKVA---KSIKSRKSKSSLSNSSGKGGSSDKSSKQL 922

Query: 965  XXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR-KILVAEDNNVNQEVIKRML 1023
                   SVG+V +DRPFLQ                 ++  +ILVAEDN+VNQEVIKRML
Sbjct: 923  KGSESEFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRML 982

Query: 1024 NLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSH 1083
             LEG++ ++LA DGQDAFDKVKA    G+HY+LIFMDVQMP+VDGL AT+MIRK+L Y +
Sbjct: 983  TLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQY 1042

Query: 1084 PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
            PIVALTAFADDSNI+ CL+AGMNGFLSKPIKRPK+K I+ +YC
Sbjct: 1043 PIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1158 bits (2995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1127 (54%), Positives = 785/1127 (69%), Gaps = 46/1127 (4%)

Query: 16   RLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSSQI 75
            + + P+ + IR                      GVYFT ++K+LR+ERL++AAQLKS+QI
Sbjct: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69

Query: 76   DQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVY 135
            DQNLNY+YYQCYWLS+RD LQ AL  Y+AGN +  NW D+   + KFL SS LFS+A +Y
Sbjct: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129

Query: 136  DSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSM 195
            D++F  VL+ +NNG+GN IPE+ L +L PLS +  LPSSL+  G+LT+PVLNG+ YLMSM
Sbjct: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189

Query: 196  SLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHE-LAG 254
            SLPIFANPSIIL+T+ VYGYIT+V+SA+ LK+V++DTTAL+ S+V I+S VYD +E L+ 
Sbjct: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249

Query: 255  YHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNST 314
            Y+ VF P  +   ++ E   I+NG+FL  A++ GKGG+++ T+F   KK+AVGYSPC+  
Sbjct: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 315  LAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATE 374
               W+A++ Q EA+F+ P+T+L KII GT + I V  C+VTFPL+HWAV+PIVRLQKATE
Sbjct: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 375  IITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIPDSSKEVP 434
            +IT GRGLR+ +                    G+ +V R  S     R      S +   
Sbjct: 370  LITEGRGLRASSPGA-----------------GSSNVSRRSSFFH--RPSNCGSSIRSRV 410

Query: 435  RGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMM-------NESQAVKSERYITSTNLIEA 487
              N ++  H+++ E I+      +N    +S+        NE+ + KS+   TS NLIEA
Sbjct: 411  TDNHNEKGHDLHGEQIQH-GFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEA 469

Query: 488  RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547
            RVPVY+R FSDELSELT+TFNTMTD LD+HYALLEDRVRARTRQLEAAKI+AE ANEAKT
Sbjct: 470  RVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKT 529

Query: 548  VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607
            VFIANISHELRTPLNGILGMTAI+M E D  K+++SLKLIFRSGELLLHI+TELLTFSKN
Sbjct: 530  VFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKN 589

Query: 608  VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667
            VLKRTKLE+R+F + D+ALQ++SIFGK+AKDQ V L+I++ PNL+R+MVL+GDSNRI+QI
Sbjct: 590  VLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQI 649

Query: 668  VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKD-- 725
            VMNLVSNALKFTPVDGKV+V   LLGEYD E+S+   +K+V+V+P TE + +  + K   
Sbjct: 650  VMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKDKGGI 709

Query: 726  EKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXTKSI 785
            E+     +++  N  S  S+ + +D +    G                          S 
Sbjct: 710  EEKERFSIENTPNDTSSNSSNKHSDTETTP-GLNDTDEKQASDDMDGGEEDVEDADEVSS 768

Query: 786  GSGNTSSYDDAIFQTRLRK-----DSSNEENEEGRALESPKKWVISMEVHDTGPGIDPAL 840
             S +TSSY+D +F ++ +K     D S+E  E G  ++  KKWVIS+ V DTGPGID +L
Sbjct: 769  FSTSTSSYNDTVFHSQFKKTPKVCDDSSE--ELGVEVKDKKKWVISIVVEDTGPGIDSSL 826

Query: 841  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900
            HESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM L S++GVGS+F+FTVPLTQ
Sbjct: 827  HESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQ 886

Query: 901  TKELLFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXX 960
            T+E+ F+D+   FEDEFNPDSKKNRKVKF++                             
Sbjct: 887  TREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPKSSSSDKSLSQ 946

Query: 961  XXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRRKILVAEDNNVNQEVIK 1020
                       S  SVR+DRPFLQ                 +  KILVAEDN+VNQEVIK
Sbjct: 947  LKLTD------SDRSVRLDRPFLQSTGTASSNTNLGTTSTIN--KILVAEDNDVNQEVIK 998

Query: 1021 RMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELG 1080
            RMLNLEG+ ++EL CDGQ+A DKVK     G+HY+LIFMDVQMP++DGL +T+MIR++L 
Sbjct: 999  RMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLN 1058

Query: 1081 YSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127
            Y+HPIVALTAFADDSNI+ECLDAGM+GFL+KPIKR +++ I++E+CP
Sbjct: 1059 YTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1131 (53%), Positives = 791/1131 (69%), Gaps = 48/1131 (4%)

Query: 13   FQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKS 72
            +++  + P  ++IR                      GVYFT ++K LR+ RL++AA+LKS
Sbjct: 5    WRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKS 64

Query: 73   SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132
            SQIDQ LNYL+YQC +L++RD LQNAL  Y AGN + ENW ++   + KFL SS+LF +A
Sbjct: 65   SQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVA 124

Query: 133  RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192
            R+YD +F+ V+N +NNG+G+LIP  +L++LFPLST+ +LPSSL   G+LTDPVLNGS+YL
Sbjct: 125  RLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYL 184

Query: 193  MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-E 251
            MSMSLPI  NPSIILS+++VYGYIT+V+SA+GLK+VY + TAL++S+V ++S +Y+D  +
Sbjct: 185  MSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGK 244

Query: 252  LAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311
            + G+H VF   N     + E Y I+NG++L  A+ +GK GSIK T++  N+++A+GYSPC
Sbjct: 245  VDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303

Query: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371
            + +L+ WVA++TQPEA+FLSPST+L KII GT +AIAV  C++TFPLSHWAV+PIVRLQK
Sbjct: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363

Query: 372  ATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIPDSSK 431
            ATE+I+ GRGL+   +S   +   +ST++++     +  VR S  + ++ R+    + S 
Sbjct: 364  ATELISQGRGLKP--TSNFSNGDSSSTSDNWRESVES-HVRASLGIFKSLRN----NGSN 416

Query: 432  EVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKS--ERYITSTNLIEARV 489
            E+    S+D ++E+N       E    N+ T  ++ +      S  +RY TS NL++ARV
Sbjct: 417  EL---QSNDDMNEIN-------ERSSKNNSTGDNIKSSDNDSSSSFQRYTTS-NLVQARV 465

Query: 490  PVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVF 549
            PVY R   DELSELT+TFN MT+ LD+HY LLEDRVRART+QLEAAKIEAE ANEAKTVF
Sbjct: 466  PVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVF 525

Query: 550  IANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVL 609
            IANISHELRTPLNGILGMTAI+M E+D+ K+K +LKLIFRSGELLLHI+TELLTFSKNVL
Sbjct: 526  IANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVL 585

Query: 610  KRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVM 669
            KRT LE+RDF I +IALQ++SIFGK+A+DQHV L I ++PN +RSMVLWGDSNRI+QIVM
Sbjct: 586  KRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVM 645

Query: 670  NLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKD---- 725
            NLVSNALKFTP+DGKVDV+ +LLGEYDEE+S   +YKEV++   TE    + +  D    
Sbjct: 646  NLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRK 705

Query: 726  ---EKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXT 782
               E + + C++ DT       +  S  +K ++  ++                       
Sbjct: 706  KIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEIL------- 758

Query: 783  KSIGSGNTSSYDDAIFQTRLRKDSSNEENEE--GRALESPKKWVISMEVHDTGPGIDPAL 840
             S+ + +T SYDDA  Q + +K    ++ EE  G  L  PK WVIS+EV DTGPGI+P L
Sbjct: 759  -SMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKL 817

Query: 841  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900
             E+VFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMHGTMKL+S VGVGSKF FTVPL Q
Sbjct: 818  QEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQ 877

Query: 901  TKELLFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXXXXXXXXXXXXXXXXXXXXXX 960
            T+E+ F+D    FEDEFN +SKKNR++KF++                             
Sbjct: 878  TREIHFDD--EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNE 935

Query: 961  XXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR------KILVAEDNNV 1014
                       +   VR+DRPFLQ                 +        +ILVAEDN+V
Sbjct: 936  HKDENGTSPD-NHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHV 994

Query: 1015 NQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRM 1074
            NQEVIKRMLNLE +++++LACDGQDAFDKVK+     ++YD+IFMDVQMP+VDGL +T+M
Sbjct: 995  NQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKM 1054

Query: 1075 IRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            IRK+L Y HPIVALTAFA+D NIKECLDAGM+GFL KPIKRPK+K IL+EY
Sbjct: 1055 IRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1145 (51%), Positives = 768/1145 (67%), Gaps = 61/1145 (5%)

Query: 14   QRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSS 73
            ++  + P  +SIR                      GVYFT+++K+L+  RL++AAQLK+S
Sbjct: 6    KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 74   QIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLAR 133
            QIDQ LNYLYYQCY+LS+ + LQN+L  Y AGN S+ NW ++S  L+KFL SS+LFS+AR
Sbjct: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 134  VYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLM 193
            +YD++F  ++N +NN SGN +PE+++ +LF LS +++LPSSLE  G+ TDPVLNGS +LM
Sbjct: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185

Query: 194  SMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYD-DHEL 252
            SMSLPIFANPSIILS +++YGY++V++SAEGLKSV+NDTTAL++S V ++S  Y     L
Sbjct: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245

Query: 253  AGYHLVFP-PYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311
              ++ +F   Y+      + HY+I+N +F+ + + +GKGG++K T  F     AVGYS C
Sbjct: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305

Query: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371
            + +L  W+AI+ QPEA F   +T+L +II G  +A+AV  C++TFPLSHWAVQP++RLQK
Sbjct: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQK 365

Query: 372  ATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIPDSSK 431
            ATE I  GRGLR    +   S  R S            S++   S+    R     +++K
Sbjct: 366  ATERIAEGRGLRPPQPTVGSSVSRNS------------SIKWRNSLENHVRSSLGFNANK 413

Query: 432  EVPRGNSSDAIHEVNQENIEDIEMQKV--NSPTPYSMM----NESQAVKSERYITSTNLI 485
                G+ +    + N  +   I    +  N+ + +S M    ++  +  S++Y TS NLI
Sbjct: 414  LSDSGSITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLI 473

Query: 486  EARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEA 545
            EARVPVY RL  DELSELT+TFNTMTD LD+HY LLE+RVRART+QLEAAKI+AE ANEA
Sbjct: 474  EARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEA 533

Query: 546  KTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFS 605
            KTVFIANISHELRTPLNGILGMTAI+M E+D  K++ +LKLIFRSGELLLHI+TELLTFS
Sbjct: 534  KTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFS 593

Query: 606  KNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIV 665
            KNVL+RTKLE+RDF I ++ALQ++SIFGKLAKDQHV L+I ++PN+LRS VLWGDSNRI+
Sbjct: 594  KNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRII 653

Query: 666  QIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKD 725
            Q+VMNLVSNALKFTPVDG VDV+  LLGEYDEE+SKA +YK+V+V   TE   + +  K 
Sbjct: 654  QVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKT 713

Query: 726  EKN------AESCVDSD---TNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXX 776
            E+N      +E+ +++D   T+ +S   TA+S+    +KIG                   
Sbjct: 714  EENNDISRKSETELNNDENETHTISKDDTADSS----IKIGNEDVEISEVDKMGMA---- 765

Query: 777  XXXXXTKSIGSGNTSSYDDAIFQTRLRK--DSSNEENEEGRALESPKKWVISMEVHDTGP 834
                   S+ + ++ SYDD     +L K  D  ++EN+ G  L+  K WVIS+EV DTG 
Sbjct: 766  -------SLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGS 818

Query: 835  GIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSF 894
            GIDP L ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+TMM+GTM+L+S+VGVGSKF F
Sbjct: 819  GIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIF 878

Query: 895  TVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRM-GXXXXXXXXXXXXXXXXXXXXX 953
            T+PL QT+E+   D E  F DEFN  SKKNRKVKF+  G                     
Sbjct: 879  TLPLKQTREISIPDDE-LFNDEFNAVSKKNRKVKFKFSGSSSAKSIKTRNSIGSSLNNRH 937

Query: 954  XXXXXXXXXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXX--XXXXXXADRRK------ 1005
                             V   SVR++RPFLQ                   D+ K      
Sbjct: 938  STTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNK 997

Query: 1006 -----ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMD 1060
                 ILVAEDN+VNQEVIKRML LEG+ +++LA DGQDAFDK K       +YD+IFMD
Sbjct: 998  MDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMD 1057

Query: 1061 VQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKA 1120
            VQMPR+DGL AT+MIR+EL Y+ PIVAL+AF  + N+KECLD GMN FLSKPIKRP +K 
Sbjct: 1058 VQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKI 1117

Query: 1121 ILKEY 1125
            ILK+Y
Sbjct: 1118 ILKKY 1122

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/909 (58%), Positives = 663/909 (72%), Gaps = 51/909 (5%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFTS++K+LR++RL++AAQLKSSQIDQNLNYLYYQCYW+++RD LQ  L  Y+AGN S
Sbjct: 42  GVYFTSNYKNLRSDRLYIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKS 101

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
             NW D+ + L+KFLGSSNLFS+ARVYDSSF  VLN +NN +G+LIPE++LTQL PLST+
Sbjct: 102 DANWMDSQSVLEKFLGSSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTN 161

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
           V LPSSLE  G++T+PV NGS YLMSMSLPIFANPSIIL+ ++VYGY+TVV+SAEGL SV
Sbjct: 162 VPLPSSLETNGIVTNPVKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSV 221

Query: 229 YNDTTALDDSSVIIVSTVYDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
           +NDTTAL+ S V IVS VY +  +L  Y  VFPP+     ++NE + + N +FL  A++ 
Sbjct: 222 FNDTTALERSYVAIVSAVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQ 281

Query: 288 GKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAI 347
           GKGG++KSTR F   K+AVGYSP  S LA WVAI+ Q E++F+SP+T+LAKII GT + I
Sbjct: 282 GKGGALKSTRLFYRLKLAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGI 341

Query: 348 AVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSI-- 405
            V   ++TFPL+HWAV+PIVRLQKATE+IT  RGLR    ++    +  S     SS+  
Sbjct: 342 GVFAMLITFPLAHWAVKPIVRLQKATELITESRGLRPTTPTS--GSRANSILRDKSSLIS 399

Query: 406 FGTGSVRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYS 465
           F    V  +        +K  P S ++    NSS +I   N           V S    S
Sbjct: 400 FPLHPVSTNNINNNNSNEKAQPPSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLS 459

Query: 466 MMN---ESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLE 522
            ++   E  +  S+ Y T+ NLI+ARVP Y+ LF DELS+LTETFNTMTD LD+HYALLE
Sbjct: 460 NVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLE 519

Query: 523 DRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKS 582
           +RVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D  K+++
Sbjct: 520 ERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRN 579

Query: 583 SLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVN 642
           SLKLIFRSGELLLHI+TELLTFSKNVLKRTKLE+R+F I D+ALQ++SIFGK+AKDQHV 
Sbjct: 580 SLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVR 639

Query: 643 LTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKA 702
           L+I + PN++RSMVL+GDSNRI+QIVMNLVSNALKFTPVDGKVDV+ ++LG YDE  S+ 
Sbjct: 640 LSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEK 699

Query: 703 SEYKEVFVLPPTE--------SRTSSTEAKDEKNAESC----VDSDTNVLSLPST---AE 747
             + +V+V P TE        +  S  + KD+  +++       SDT   + P+T   A+
Sbjct: 700 YNHNKVYVKPGTEITDSTPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQ 759

Query: 748 STDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSS 807
            +DE N+                            +S+ S  TSSYDDAIF ++ +K ++
Sbjct: 760 ESDEDNM------------------------YEDNESMISSTTSSYDDAIFNSQFKKTTN 795

Query: 808 ----NEENEEGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTG 863
               ++E+E G  LE+PK WVIS EV D+GPGID  L ESVFEPFVQGDQTLSRQYGGTG
Sbjct: 796 LYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTG 855

Query: 864 LGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKK 923
           LGLSICRQLA MM G M L+S+VGVGSKF+FT+PLTQT+E+ F +VE+PFEDEFN  SKK
Sbjct: 856 LGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKK 915

Query: 924 NRKVKFRMG 932
           NRKVKFRM 
Sbjct: 916 NRKVKFRMA 924

 Score =  207 bits (528), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 3/134 (2%)

Query: 1005 KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMP 1064
            KILVAEDN+VNQEVIKRML LEG++D++LACDGQDAFDKVK     G  Y+LIFMDVQMP
Sbjct: 1066 KILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMP 1125

Query: 1065 RVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKE 1124
            +VDGLT+T+MIR +L    PIVALTAFADDSNIKECLDAGM+GFLSKPIKR K+K ILKE
Sbjct: 1126 KVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKE 1185

Query: 1125 YCPRPIDEKEGEVK 1138
            +C    DE+E + K
Sbjct: 1186 FCS---DEREEDSK 1196

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1095 (51%), Positives = 717/1095 (65%), Gaps = 60/1095 (5%)

Query: 49   GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
            GVYFTS++++LRA+RLHVAA+L SSQ+DQ+L  LYYQC  LST+D +QNAL+ Y AGN S
Sbjct: 45   GVYFTSNYRTLRADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRS 104

Query: 109  TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
             ENW +A   L  FL  S  F +A +YD  +Q+VL+  NN +   + E  L +L PL  D
Sbjct: 105  AENWIEADKILGGFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMD 164

Query: 169  VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
                +      + T P  N ++ LMSM+LP+ A  S I+    V G++T+V+SA+ + +V
Sbjct: 165  KYEYNEALDVQVETLP-YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV 221

Query: 229  YNDTTALDDSSVIIVSTVYDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
             NDT+ L +S V I++ + +D   L  Y  VFPP      V    Y I+N SFL DA  +
Sbjct: 222  -NDTSVLGESMVSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLN 280

Query: 288  GKGGSIKSTRFFNN--------KKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKI 339
                 + ST  F +        KK+AVGYS C      WVA+++Q E++FLSP+ +L KI
Sbjct: 281  RSDNYVTSTSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKI 340

Query: 340  IVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTA 399
            I+GT + +AV  C+VTF L+ WAV+PIVRLQKATE I AGRGLR+ N S   S + TS  
Sbjct: 341  IIGTVLGVAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSID 400

Query: 400  ESFSSIFGTGSVRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVN 459
             S +S     S+ R     +     ++ ++        SS + HE    +I        +
Sbjct: 401  RS-NSRGSDHSLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYH----D 455

Query: 460  SPTPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYA 519
              T  +++++ +   +    ++TN I+ RVPVY+RLF+DELSELT+TFNTMTDELDR Y 
Sbjct: 456  GETSTNILSDHEKGST----SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYV 511

Query: 520  LLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAK 579
            +LEDRVRART+QLEAAKI+AE ANEAKTVFIANI HELRTPLNGILGMTAIAMAE+D  K
Sbjct: 512  VLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEK 571

Query: 580  VKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQ 639
            +++SLKLIFRSGELLLHI+TELLTFSKNVLKRTKLEER F I+DIALQV+SIFGKLAKDQ
Sbjct: 572  IQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQ 631

Query: 640  HVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEK 699
            HV L+I ++PN +R+MVLWGDSNRI+QIVMNLVSNALKFTPVDGKVDV+ +L+GEYD  +
Sbjct: 632  HVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSAR 691

Query: 700  SKASEYKEVFVLPPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQR 759
            S+A  + EV++LP TE   SS       N  + V+ +        TA+ T E+  K  + 
Sbjct: 692  SEACNFSEVYILPGTEVTNSSV-----NNIPTVVEEEEKACEEEPTADDTPERKKKDSET 746

Query: 760  XXXXXXXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRK--------DSSNEEN 811
                                    SI S   +SYDDA+   +L+K        DS N  N
Sbjct: 747  VDDADAI-----------------SISSSVATSYDDAVLHAQLKKIPTFIDLEDSDN--N 787

Query: 812  EEGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQ 871
                 LE P+ WVI +EV DTGPGI+P+LHESVF+PFVQGDQTLSRQYGGTGLGLSICRQ
Sbjct: 788  VTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQ 847

Query: 872  LATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRM 931
            LATMM GTMKL+S+VG GSKF+FTVPL QT  + F D +  FEDEFN  SKKNRKVKF++
Sbjct: 848  LATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQL 907

Query: 932  GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVGSVRVDRPFLQXXXXXXX 991
                                                    S GSVRVDRPFLQ       
Sbjct: 908  N-----RSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATS 962

Query: 992  XXXXXXXXXADRR-KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDAT 1050
                     A+   +ILVAEDNNVNQEVIKRML+LEG  +++LACDG+DA+ KV A    
Sbjct: 963  TRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQ 1022

Query: 1051 GKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLS 1110
            G+HYDLIFMDVQMPR+DGL  T+++R++L Y +PIVALTAFADDSNIKECL++GMN FL+
Sbjct: 1023 GEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLA 1082

Query: 1111 KPIKRPKIKAILKEY 1125
            KPIKRP +K IL E+
Sbjct: 1083 KPIKRPMLKKILLEH 1097

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1087 (53%), Positives = 731/1087 (67%), Gaps = 48/1087 (4%)

Query: 49   GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
            GVYFT+++KSLRA+RL VAAQL S+QI+Q LN +YYQCYWLS+RD +QNAL  Y  GNTS
Sbjct: 55   GVYFTTNYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTS 114

Query: 109  TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
            + N  +A   L KFL SSN      +YDS+F +VL+VS N +GN+I ++LL  L PLS++
Sbjct: 115  SLNLDNAKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSN 174

Query: 169  VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
              LPSS+   GML++PV NGS + MSMSLP+ A  SI+   +   GYIT+V+SA+ + SV
Sbjct: 175  SPLPSSIIDDGMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSV 234

Query: 229  YNDTTALDDSSVIIVSTVYDDHE-LAGYHLVFPPYNM-YPDVINEHYQIENGSFLEDAIK 286
                 AL+ S+V +++ VYD++  L  Y ++FPP  +  P ++   + I N SFL +A  
Sbjct: 235  CAGKPALNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFV 294

Query: 287  DGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIA 346
            +   GS+  T  F    +AVGY+ C+  L  WVA++ Q EA+FLSPST+L KII+GT I 
Sbjct: 295  NRSSGSVSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIG 354

Query: 347  IAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIF 406
            IA   C+VTF +++WAV+PIVRLQKATE+I AGRGLRS   S+  S + TS   S S   
Sbjct: 355  IAFFICIVTFIVANWAVKPIVRLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGS 414

Query: 407  GTGSVRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSM 466
             + ++R    + +     Y P  S   P  +     + V+      IE+       P S 
Sbjct: 415  PSPTLREGDGLRKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEV-------PSSH 467

Query: 467  MNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVR 526
             +E    + + + TS N IE RVPVY+RLFSDELSELT+TFN+MTDELDRHYALLEDRVR
Sbjct: 468  PSE----RVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVR 523

Query: 527  ARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKL 586
            ART+QLEAAKI+AE ANEAKT+FIANISHELRTPLNGILGMTAIAMAE D  KV++SLKL
Sbjct: 524  ARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKL 583

Query: 587  IFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTIS 646
            IFRSGELLLHI+TELLTFSKN+LKR KLE+R+F +VD+ALQV+SIFGKLAKDQ+V  +I 
Sbjct: 584  IFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIF 643

Query: 647  ILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYK 706
            ++PNL+R MVLWGDSNRI+QIVMNLVSNALKFTPVDGKV ++ +LLGEYDEE+S+     
Sbjct: 644  LMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNA 703

Query: 707  EVFVLPPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXX 766
            EVF+          TE  DE   ++  D+ T    +  + ESTD+  ++ GQ        
Sbjct: 704  EVFI-------KQGTEISDE--TKNVFDTITEEKYVSCSGESTDD-TIETGQEGAQKPDK 753

Query: 767  XXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGR-----ALESPK 821
                             S+ S  TSSYDDAIF +R +K  +  + +EG        E  K
Sbjct: 754  ADNI-------------SVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKK 800

Query: 822  KWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 881
             WVIS+EV DTGPGIDP+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+TMM GTMK
Sbjct: 801  VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860

Query: 882  LDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGXXXXXXXXX 941
            L S+VGVGSKF FTVPL QT  +   D E+ FEDEFN  SK NR+VKF++          
Sbjct: 861  LHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSS 920

Query: 942  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXA 1001
                                             SVRVDRPFLQ                 
Sbjct: 921  LSVPEISGVPDSPLNSMGRSESELSVS------SVRVDRPFLQSTGTATSTRSIPTVGSL 974

Query: 1002 DRR-KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMD 1060
            +   K+LVAEDNNVNQEVIKRML LEG+ D+ELACDG++A +KV        HY+++FMD
Sbjct: 975  ESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMD 1034

Query: 1061 VQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKA 1120
            VQMP++DGL ATR IRKEL Y++PIVALTAFADDSNIK CL++GM+GFLSKPIKR K++ 
Sbjct: 1035 VQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRK 1094

Query: 1121 ILKEYCP 1127
            IL EYCP
Sbjct: 1095 ILLEYCP 1101

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/949 (56%), Positives = 679/949 (71%), Gaps = 46/949 (4%)

Query: 17  LRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSSQID 76
           L+ P  + IR                      GVYFTS++K+LR++RL++AAQLKSSQID
Sbjct: 11  LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 77  QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136
           QNLNYLYYQ YWLS+RD LQ  LT Y+AGN + ENW+D+   + KFL S+NLFS A++YD
Sbjct: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 137 SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196
           SSF  VL  +NNG+G+LIPE++L +L+PL+T+  L SSLE  G+LTDPVLNGS Y+MSMS
Sbjct: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 197 LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHE-LAGY 255
           LPIFANPSIIL+ +KVYGYIT+V+SAEGLK+V+NDTTAL+ S+V IVS VY++   L  Y
Sbjct: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 256 HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTL 315
           H VF PY     VIN  ++I N SFL  A+++GKGGS+K T+FF  K IAVGYSPC  + 
Sbjct: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 316 AQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEI 375
             W+AI++Q E++FLSPST+LAKII GT +AI V   ++TFPL+HWAV+PIVRLQKATE+
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 376 ITAGRGLRS--------DNSSTLFSHKRT---STAESFSSIFGTG-SVRRSGSVARAGRD 423
           ++ GRGL+S          SS++  + R+   STA S  +  G   S   +G + + G  
Sbjct: 371 MSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGLT 430

Query: 424 KYIPDSSKEVPRGNSSD-AIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITST 482
              P  + ++P  + S+ A   ++  N      Q+ NS + ++   +  + +S++  TS 
Sbjct: 431 P-TPMPTTDLPSPSDSNFATEMISNANTS----QRANSISRFTDHTD-LSNRSKKLTTSA 484

Query: 483 NLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542
           NLIEARVP Y+RLFSDELS+LT+TFN MTD LD+HYALLEDRVRART+QLEAAKIEAE A
Sbjct: 485 NLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETA 544

Query: 543 NEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELL 602
           NEAKT+FIANISHELRTPLNGILGMTAI+M E D AK++SSLKLIFRSGELLLHI+TELL
Sbjct: 545 NEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELL 604

Query: 603 TFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSN 662
           TFSKNVLKRT LE+RDF I D+ALQ++SIFGK+AKDQ V L+I +LPN++R+M+L+GDSN
Sbjct: 605 TFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSN 664

Query: 663 RIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTE 722
           RI+QIVMNLVSNALKFTPVDGKV+V+ +L+GEYDE  S+ S +K+V V   TE     T+
Sbjct: 665 RIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTE--FIETK 722

Query: 723 AKDEKNAESCVDSDTNVLSLPSTAE----------------STDEKNVKIGQRXXXXXXX 766
           AK    A    D  T+  S+    E                ++DEK     +        
Sbjct: 723 AKAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEK-----KYDEKEDEG 777

Query: 767 XXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGR---ALESPKKW 823
                          T+SI S +TSSYDDA+F  + +K     E+E+G     L +PK W
Sbjct: 778 EEDNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTW 837

Query: 824 VISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLD 883
           VI++EV DTGPGIDP+L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM+GTM+L 
Sbjct: 838 VIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELK 897

Query: 884 SQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMG 932
           S+VGVGS F+FTVPL QT+EL   + ++PFEDEFNP S+KNR+VKF++ 
Sbjct: 898 SEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLA 946

 Score =  228 bits (581), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 128/156 (82%), Gaps = 1/156 (0%)

Query: 973  VGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR-KILVAEDNNVNQEVIKRMLNLEGLEDV 1031
            +G+V +DRPFLQ                A ++ KILVAEDN+VNQEVIKRMLNLEG+E++
Sbjct: 1013 LGTVNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENI 1072

Query: 1032 ELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAF 1091
            ELA DGQDAF++VKA    G+H+D+IFMDVQMP+VDGL +T+MIR +L Y++PIVALTAF
Sbjct: 1073 ELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAF 1132

Query: 1092 ADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127
            ADDSNIKECL+AGMNGFLSKPIKRPK+K IL+EYCP
Sbjct: 1133 ADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCP 1168

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/922 (58%), Positives = 672/922 (72%), Gaps = 42/922 (4%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFTS++K+LR++RL++AAQLKSSQIDQ LNYLYYQ Y+L++RD LQ++LT Y+AGN S
Sbjct: 43  GVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKS 102

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
            +NW D+ + + KFL SSNLF +A+VYDSSF  VLN +NNG+G+LIPE++L  LFPLSTD
Sbjct: 103 ADNWVDSLSVIQKFLSSSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTD 162

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
             LPSSLE  G+LTDPVLN + YLMSMSLPIFANPSIIL+ ++VYGYIT+++SAEGLKSV
Sbjct: 163 TPLPSSLETIGILTDPVLNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSV 222

Query: 229 YNDTTALDDSSVIIVSTVYDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
           +NDTTAL+ S++ I+S VY+   + +GYH VFPPY    D+  + + I+N +F+  A ++
Sbjct: 223 FNDTTALEHSTIAIISAVYNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRN 282

Query: 288 GKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAI 347
           GKGGS+K T   + +  A+GYSPC+  L  WVAI++QPE++FLSP+T+LAKII GT IAI
Sbjct: 283 GKGGSLKQTNILSTRNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAI 342

Query: 348 AVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFG 407
            V   ++T PL+HWAVQPIVRLQKATE+IT GRGLR     T+   + +S    FSS F 
Sbjct: 343 GVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRPSTPRTI--SRASSFKRGFSSGFA 400

Query: 408 TGSVRRSGSVARAGRDKYIPDSSKEVPR------GNSS--DAIHEVNQENIEDIEMQKV- 458
             S     + A AG    +                NSS   AI+  N++     E  K+ 
Sbjct: 401 VPSSLLQFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIP 460

Query: 459 NSPT----------------PYSMMNESQAVKSER---YITSTNLIEARVPVYKRLFSDE 499
           N+ T                P+S+ +      S R     TS NL EAR+P Y+RLFSDE
Sbjct: 461 NNHTDAKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDE 520

Query: 500 LSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRT 559
           LS+LTETFNTMTD LD+HYALLE+RVRART+QLEAAKIEAE ANEAKTVFIANISHELRT
Sbjct: 521 LSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRT 580

Query: 560 PLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDF 619
           PLNGILGMTAI+M E D  K+++SLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+RDF
Sbjct: 581 PLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDF 640

Query: 620 QIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFT 679
            I D+ALQ++SIFGK+AKDQ V L+IS+ PNL+R+MVLWGDSNRI+QIVMNLVSNALKFT
Sbjct: 641 CITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFT 700

Query: 680 PVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKDE------KNAESCV 733
           PVDG VDV+ +LLGEYD+E S+  +YKEV++   TE  T + E  D+       N    V
Sbjct: 701 PVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEV-TENLETTDKYDLPTLSNHRKSV 759

Query: 734 DSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXTKSIGSGNTSSY 793
           D +++  SL S  +++  +  +I +R                        SI S  TSSY
Sbjct: 760 DLESSATSLGSNRDTSTIQE-EITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSY 818

Query: 794 DDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQ 850
           D+AIF ++  K   +++ E    GR +E+PK WVIS+EV DTGPGIDP+L ESVF PFVQ
Sbjct: 819 DNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQ 878

Query: 851 GDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVE 910
           GDQTLSRQYGGTGLGLSICRQLA MMHGTMKL+S+VGVGSKF+FT+PL QTKE+ F D+E
Sbjct: 879 GDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADME 938

Query: 911 NPFEDEFNPDSKKNRKVKFRMG 932
            PFEDEFNP+S+KNR+VKF + 
Sbjct: 939 FPFEDEFNPESRKNRRVKFSVA 960

 Score =  224 bits (570), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (79%), Gaps = 4/158 (2%)

Query: 973  VGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR----KILVAEDNNVNQEVIKRMLNLEGL 1028
            +GSV +DRPFLQ                 D+     KILV EDN+VNQEVIKRMLNLEG+
Sbjct: 1053 LGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGI 1112

Query: 1029 EDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVAL 1088
            E++ELACDGQ+AFDKVK   + G++Y++IFMDVQMP+VDGL +T+MIR++LGY+ PIVAL
Sbjct: 1113 ENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1172

Query: 1089 TAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
            TAFADDSNIKECL++GMNGFLSKPIKRPK+K IL E+C
Sbjct: 1173 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/933 (56%), Positives = 673/933 (72%), Gaps = 64/933 (6%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFTS++K+LR++RL++AAQLKSSQIDQ LNYLYYQ Y+L++RD LQ++LT ++AGN S
Sbjct: 43  GVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKS 102

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
            +NW D+ + + KFL SSNLF +A+VYDSSF  VLN +NNG+G+LIPE++L  LFPLSTD
Sbjct: 103 ADNWVDSLSVVQKFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTD 162

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
             LPSSLE TG+LTDPV+N + YLMSMSLPIFANPSIIL+ ++VYGYIT+++SAEGLKSV
Sbjct: 163 TPLPSSLETTGILTDPVVNNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSV 222

Query: 229 YNDTTALDDSSVIIVSTVYDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
           +NDTTAL+ S+V I+S +Y++  + +GYH +FPPY     +    + I+N +F+  A ++
Sbjct: 223 FNDTTALEKSNVAIISALYNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRN 282

Query: 288 GKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAI 347
           GKGGS+K T  F  K +A+GYSPC+  L  WVA+++QPE++FLSP+T+LAKII GT IAI
Sbjct: 283 GKGGSLKQTNSFGIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAI 342

Query: 348 AVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFG 407
            V   ++T PL+HWAVQPIVRLQKATE+IT GRGLR     T+      S A SF   FG
Sbjct: 343 GVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRPSTPRTV------SRASSFKRGFG 396

Query: 408 TG----------SVRRSGSVARA--------------------------GRDKYIP-DSS 430
           +G          +   SGS   A                          G +K +P +  
Sbjct: 397 SGFTVPSSLLQFNTGESGSTISASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDE 456

Query: 431 KEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSER---YITSTNLIEA 487
           K++P  N++DA   ++     D+         P S+ N      S R     TS NL EA
Sbjct: 457 KKIP-NNNTDAKVSMDGSLNHDLL-------APNSLRNNDTDRSSNRSHILTTSANLTEA 508

Query: 488 RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547
           R+P Y+RLFSDELS+LTETFNTMTD LD+HYALLEDRVRART+QLEAAKIEAE ANEAKT
Sbjct: 509 RLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKT 568

Query: 548 VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607
           VFIANISHELRTPLNGILGMTAI+M E D  K+++SLKLIFRSGELLLHI+TELLTFSKN
Sbjct: 569 VFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKN 628

Query: 608 VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667
           VL+RTKLE+RDF I D+ALQ++SIFGK+AKDQ V L+IS+ PNL+R+MVLWGDSNRI+QI
Sbjct: 629 VLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQI 688

Query: 668 VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTE-----SRTSSTE 722
           VMNLVSNALKFTPVDG VDV+ +LLGEYD++ S+  ++KEV V   TE       T+  +
Sbjct: 689 VMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCD 748

Query: 723 AKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXT 782
                N    VD ++   S+ S  +++  +  +I +R                       
Sbjct: 749 IPISSNHRKHVDLESTTTSITSNRDTSIIQE-EITKRNTAANENIYKRMNDAEKLSSDDV 807

Query: 783 KSIGSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEVHDTGPGIDPA 839
            SI S  TSSYDDAIF ++  K   ++E+E    G+ +E+PK WVIS+EV DTGPGIDP+
Sbjct: 808 SSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPS 867

Query: 840 LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLT 899
           L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MM+GTM+L+S+VGVGSKF+FT+PL 
Sbjct: 868 LQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLP 927

Query: 900 QTKELLFEDVENPFEDEFNPDSKKNRKVKFRMG 932
           QTKE+ F +++ PFEDEFNP+S+KNR+VKF + 
Sbjct: 928 QTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960

 Score =  224 bits (571), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (78%), Gaps = 4/159 (2%)

Query: 972  SVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR----KILVAEDNNVNQEVIKRMLNLEG 1027
            S+GSV +DRPFLQ                 D+     KILV EDN+VNQEVIKRMLNLEG
Sbjct: 1053 SLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEG 1112

Query: 1028 LEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVA 1087
            +E++ELACDGQ+AFDKVK   + G +Y++IFMDVQMP+VDGL +T+MIR++LGY  PIVA
Sbjct: 1113 IENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVA 1172

Query: 1088 LTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
            LTAFADDSNIKECL++GMNGFLSKPIKRPK+K IL E+C
Sbjct: 1173 LTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1211

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/932 (57%), Positives = 659/932 (70%), Gaps = 62/932 (6%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFTS++K+LR++RL++AAQLKSSQ+DQ LNYLYYQ Y+L++RD LQ++LT Y+AGN S
Sbjct: 43  GVYFTSNYKNLRSDRLYIAAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKS 102

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
            +NW D+ + + KFL SSNLF +ARVYDSSF  VLN +NNG+G+LIPE++L  LFPLSTD
Sbjct: 103 EDNWVDSLSVVQKFLSSSNLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTD 162

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
           + LPSSLE TG+LTDP++N + YLMSMSLPIFANPSIIL+ ++VYGYIT+V+SAEGLKSV
Sbjct: 163 IPLPSSLETTGILTDPIVNNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSV 222

Query: 229 YNDTTALDDSSVIIVSTVYDDHELA-GYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKD 287
           +NDTTAL+ S+V I+S  Y+    A GYH VFPPY     +    + IEN +F+    ++
Sbjct: 223 FNDTTALEKSNVAIISATYNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRN 282

Query: 288 GKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAI 347
           GKGGS+K T  F  K +A+GYSPC+  L  WVA+++QPE++FLSP+T+L KII GT IAI
Sbjct: 283 GKGGSLKKTNNFGTKNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAI 342

Query: 348 AVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFG 407
            V   ++T PL+HWAV+PIVRLQKATE+IT GRGLR     T+      S A SF   F 
Sbjct: 343 GVFVILLTLPLTHWAVKPIVRLQKATELITEGRGLRPSTPRTV------SRASSFRRGFS 396

Query: 408 TGSVRRSG------------------------------------SVARAGRDKYIPDSSK 431
           +G    S                                     S    G +K  P   +
Sbjct: 397 SGFTAPSSLLQFNTGEACSTTSANGHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEE 456

Query: 432 EVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSER---YITSTNLIEAR 488
                N +D    ++     D+         P S+ N      S R     TS NL EAR
Sbjct: 457 NKIPNNHNDVKISMDGSLNHDLL-------APNSLRNNDTDRSSSRSHILTTSANLTEAR 509

Query: 489 VPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTV 548
           +P YKRLFSDELS+LTETFNTMTD LD+HYALLEDRVRART+QLEAAKIEAE ANEAKTV
Sbjct: 510 LPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTV 569

Query: 549 FIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNV 608
           FIANISHELRTPLNGILGMTAI+M E D  K++++LKLIFRSGELLLHI+TELLTFSKNV
Sbjct: 570 FIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGELLLHILTELLTFSKNV 629

Query: 609 LKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIV 668
           L+RTKLE RDF I D+ALQ++SIFGK+AKDQ V L+IS+ PNL+R+MVLWGDSNRI+QIV
Sbjct: 630 LQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIV 689

Query: 669 MNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKDEKN 728
           MNLVSNALKFTPVDG VDV+ +LLGEYD++ S+  ++KEV V   TE  T   E+ D+++
Sbjct: 690 MNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEI-TDVVESIDKRD 748

Query: 729 AESCVDSDTNVLSLPSTAESTDEKN-----VKIGQRXXXXXXXXXXXXXXXXXXXXXXTK 783
             + +     V    +TA  T  ++      +I +R                        
Sbjct: 749 LPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDREKSSNDDVS 808

Query: 784 SIGSGNTSSYDDAIFQTRLRK--DS-SNEENEEGRALESPKKWVISMEVHDTGPGIDPAL 840
           SI S  TSSYDDAIF ++  K  DS S+E    GR +E+PK WVIS+EV DTGPGI+P+L
Sbjct: 809 SIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSL 868

Query: 841 HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900
            ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKL+SQVGVGSKF+FT+PL Q
Sbjct: 869 QESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQ 928

Query: 901 TKELLFEDVENPFEDEFNPDSKKNRKVKFRMG 932
           TKE+ F ++E PFEDEFNP+SKKNR+VKF + 
Sbjct: 929 TKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960

 Score =  221 bits (562), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 100/159 (62%), Positives = 125/159 (78%), Gaps = 4/159 (2%)

Query: 972  SVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR----KILVAEDNNVNQEVIKRMLNLEG 1027
            ++GSV +DRPFLQ                 D+     KILV EDN+VNQEVI+RMLNLEG
Sbjct: 1053 NLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEG 1112

Query: 1028 LEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVA 1087
            ++++ELACDGQ+AFDKVK   + G++Y++IFMDVQMP+VDGL +T+MIR++LGY  PIVA
Sbjct: 1113 IDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVA 1172

Query: 1088 LTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
            LTAFADDSNIKECL++GMNGFLSKPIKRPK+  IL E+C
Sbjct: 1173 LTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/951 (56%), Positives = 679/951 (71%), Gaps = 42/951 (4%)

Query: 20  PLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSSQIDQNL 79
           P  +SIR                      GVYFTS++K+LR++RL++AAQLKSSQIDQ L
Sbjct: 14  PFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73

Query: 80  NYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSF 139
           NYLYYQ Y+L++RD LQN+LT Y+AGN S++NW D+ + + KFL SSNLF +A+VYDSSF
Sbjct: 74  NYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSSF 133

Query: 140 QDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI 199
             VLN +NNG+G+LIP+++  +LFPLSTD+ALPSSLE TG+LTDP+LN + YLMSMSLPI
Sbjct: 134 TTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLPI 193

Query: 200 FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHELA-GYHLV 258
           FANPSIIL+ ++VYGYIT+++SAEGLKSV+NDTTAL+ S+V I+S VY++   A  YH V
Sbjct: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHFV 253

Query: 259 FPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQW 318
           FPPY     +    + I+N +F+  A K+GKGGS+K T  F  K +A+GYSPC+  L  W
Sbjct: 254 FPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVNW 313

Query: 319 VAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITA 378
           VA+++QPE++FLSPST+LAKII GT IAI V   ++T PL+HWAVQPIVRLQKATE+IT 
Sbjct: 314 VAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

Query: 379 GRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSV------RRSGSVARAGRDKYIPDSSKE 432
           GRGLR     T+   + +S    FSS F   S         +GS   A         S  
Sbjct: 374 GRGLRPSTPRTV--SRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSASGHGCSGRGSAA 431

Query: 433 VPRGNSS-DAIHEVNQENIEDIEMQKVNSPTPY---------SMMNESQAVKSERY---- 478
           V   +SS  +   +  E +  +E +K  +P  +         S+ ++  A  + R+    
Sbjct: 432 VMSTDSSMKSAMNIGNEKLSPLEEEK-RTPNDHNNAKISMDGSLNHDLLAPNALRHSDND 490

Query: 479 ---------ITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRART 529
                     TS NL EAR+P Y+RLFSDELS+LTETFNTMTD LD+HYALLEDRVRART
Sbjct: 491 RSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRART 550

Query: 530 RQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFR 589
           +QLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D  K+++SLKLIFR
Sbjct: 551 KQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFR 610

Query: 590 SGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILP 649
           SGELLLHI+TELLTFSKNVL+RTKLE+RDF I D+ALQ++SIFGK+AKDQ V L+IS+ P
Sbjct: 611 SGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP 670

Query: 650 NLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVF 709
           N +R+MVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+ +LLGEYD+E S+  ++KEV 
Sbjct: 671 NFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVH 730

Query: 710 VLPPTE-----SRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXX 764
           V   TE        +  +AK  +N +  +DS++   S+ S  +++  +  +I +R     
Sbjct: 731 VRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQE-EITKRNTAAN 789

Query: 765 XXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESPK 821
                              SI S +TSSYDDAIF ++  K   ++++E    G+ +E+PK
Sbjct: 790 ENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDLGKPIENPK 849

Query: 822 KWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 881
            W IS+EV DTGPGIDP+L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMK
Sbjct: 850 TWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909

Query: 882 LDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMG 932
           L+S+VGVGSKF+FT+PL QTKE+ F ++  PFEDEFNP+S++NR+VKF + 
Sbjct: 910 LESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960

 Score =  228 bits (581), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/159 (66%), Positives = 127/159 (79%), Gaps = 4/159 (2%)

Query: 972  SVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR----KILVAEDNNVNQEVIKRMLNLEG 1027
            SVGSV +DRPFLQ                +D+     KILV EDN+VNQEVIKRMLNLEG
Sbjct: 1053 SVGSVNLDRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEG 1112

Query: 1028 LEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVA 1087
            +E++ELACDGQDAFDKVK   + G+ Y++IFMDVQMP+VDGL +T+MIR++LGY+ PIVA
Sbjct: 1113 IENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVA 1172

Query: 1088 LTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
            LTAFADDSNIKECL++GMNGFLSKPIKRPK+K IL E+C
Sbjct: 1173 LTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/886 (51%), Positives = 599/886 (67%), Gaps = 72/886 (8%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFT +++ LR ++L++AA+LKSSQIDQ +N LYYQC WL+ RD +++ALT Y AGN S
Sbjct: 42  GVYFTKNYRDLRLQQLYIAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRS 101

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
            ENW+  S  L  FL SS +F    +YDS F  +LN +NN + + IP+++L+ L PLS  
Sbjct: 102 AENWASTSDVLSTFLESSVVFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGT 161

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
            +LPS L  TG+LTDPVLN S YLMSMSLPI ANPS+ LS ++V+GY+TVV+SAE +++V
Sbjct: 162 DSLPSYLGTTGLLTDPVLNDSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAV 221

Query: 229 YNDTTALDDSSVIIVSTVYDDHELAG--YHLVFPPYNMYPDVINEHYQIENGSFLEDAIK 286
            NDTTAL+ S V ++S+  + +  +G  YH VFPP+    D++N  Y +EN +FL DA  
Sbjct: 222 VNDTTALEKSIVAVISST-NTNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFS 280

Query: 287 DGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIA 346
             +GGSI  ++   +K +A+GY PC+  LA WV  ++QPE +F+S S +L KII GT IA
Sbjct: 281 SPEGGSINKSKSLYSKAVAIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIA 340

Query: 347 IAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIF 406
           I V  CV+TFPLS W+VQPIVRLQKATE+I+   G     S++  S + T ++       
Sbjct: 341 ITVFVCVITFPLSRWSVQPIVRLQKATEVISKRDGNEVHRSNSSSSSRSTFSSNR----- 395

Query: 407 GTGSVRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSM 466
                 + G    +  + Y  D  K    G ++ +   +++ENI D           YS 
Sbjct: 396 ----RSKDGRHNSSSYNLY-EDVEKYTEIGKANKSTESLSKENITD-----------YSS 439

Query: 467 MNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVR 526
            N S  V  +      NL + +VP  +R   DELSELTET+  MTD LD H  LLE RV+
Sbjct: 440 SNSSAIVMRK------NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVK 493

Query: 527 ARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKL 586
            RT+QLEAAKIEAE ANEAKTVFIAN++HELRTPLNGILGMTAIAM E D  +++SSLKL
Sbjct: 494 ERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKL 553

Query: 587 IFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTIS 646
           I+RSGELLLHI+TELLTFSKNVLK+TKLE+  F ++D+ALQ+ESIFGK++KDQHV L+I 
Sbjct: 554 IYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIF 613

Query: 647 ILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYK 706
           ILPN LRSMVLWGD NRI+Q++MNLVSNALKFTPVDGK+ V  +LLGEYD+++S A  YK
Sbjct: 614 ILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYK 673

Query: 707 EVFVLPPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXX 766
           +V++             K+ +N+    D    +++L S+ ++                  
Sbjct: 674 DVYM-------------KEIRNSNG--DKIKPLMTLISSKDT------------------ 700

Query: 767 XXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE--GRALESPKKWV 824
                           KS+ S    S ++ I+  + +  S+ ++ ++  G  L+  +KWV
Sbjct: 701 -------MSVADNISNKSVASDTERSTNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWV 753

Query: 825 ISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDS 884
           IS+EV DTGPGI+P+L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +MHGTMKL+S
Sbjct: 754 ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLES 813

Query: 885 QVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFR 930
           +VGVGSKF FTVPL QT+E+ F   E  FEDEFN +SKKNR+VKF+
Sbjct: 814 EVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ 859

 Score =  176 bits (445), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 101/124 (81%)

Query: 1005 KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMP 1064
            K+L+ EDN VNQ V+ RML LEG+E+  +ACDGQ+A +K+K   + G++Y L+ MD+QMP
Sbjct: 918  KLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMP 977

Query: 1065 RVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKE 1124
            +VDG+TAT++IR+EL Y  PIVALTAFADDSNI+ C  +GM+GFL+KPIKR ++K IL E
Sbjct: 978  KVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTE 1037

Query: 1125 YCPR 1128
            +CP+
Sbjct: 1038 FCPK 1041

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/890 (50%), Positives = 599/890 (67%), Gaps = 53/890 (5%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFT+++KSLRAE+L +AAQLKSSQ+DQ+LNYLYYQ  W    D+L +AL +Y +GN +
Sbjct: 42  GVYFTNNYKSLRAEQLFIAAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKT 101

Query: 109 TENWSDASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTD 168
           TENW ++ +++  FL SS++FS A +YD++F ++ NVSNNG+G  IP++++ QL PLS+D
Sbjct: 102 TENWVESISSVSAFLTSSSIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSD 161

Query: 169 VALPSSLERTGMLTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSV 228
             LP+S+   G LTDPVLN S YLMS+SLPIF NPSIILS ++VYGY+T++  A  + +V
Sbjct: 162 ERLPASIGTIGFLTDPVLNTSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAV 221

Query: 229 YNDTTALDDSSVIIVSTVYDDHELA--GYHLVFPPYNMYPDVINEHYQIENGSFLEDAIK 286
           +NDTTAL++S+V I+S  Y +      GYH VFPPY     VI+  Y + N SFL DA  
Sbjct: 222 FNDTTALENSNVAIISAKYRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFT 281

Query: 287 DGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIA 346
           +   GS+ ST FF +  +AVGYS C  +LA WVA+++QPE++F S + +L KII GT + 
Sbjct: 282 EDTTGSVSSTTFFYSSLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVG 341

Query: 347 IAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRS--DNSSTLFSHKRTSTAESFSS 404
           IA V C VTF +S++ V+PI++L++ATE+I+ GRGLR   +N S   S   TST  +   
Sbjct: 342 IAAVVCFVTFIMSYYIVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTT--- 398

Query: 405 IFGTGSVRRSGSVARAGRDKYIPDSSKEVP---RGNSSDAIHEVNQENIEDIEMQKVNSP 461
                       +  +  D Y  +  K +P       S ++  +  ++I     + +   
Sbjct: 399 ------------IDLSDLDGYTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFS 446

Query: 462 TPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALL 521
           +   M++ +    S  +I + +    RVPV+    +DEL+EL ETFN M D LD H  LL
Sbjct: 447 SRSGMLSPT----STNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLL 502

Query: 522 EDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVK 581
           E+RV+ART++LEAAKI AE  NEAKTVFIANISHELRTPLNGILGMTAIA+ E+D  K++
Sbjct: 503 EERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQ 562

Query: 582 SSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHV 641
            SLKLI+RSGELLLHI+TELLTFSKNVL++TKLE+  F I DIALQ++SIFGK+AKDQ V
Sbjct: 563 GSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGV 622

Query: 642 NLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSK 701
           N +I I PNL+R+MV +GDSNRI+Q++MNLVSNALKFTP+DG VDV+ +LLGEYDEEKS 
Sbjct: 623 NFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSS 682

Query: 702 ASEYKEVFVLPPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEK-NVKIGQRX 760
            + Y +V++   T S T   +A   +     +       S+      TDE  N+K     
Sbjct: 683 LNNYDKVYIKEGT-SFTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDENDNIK----- 736

Query: 761 XXXXXXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEEGRALESP 820
                                 KS  S  +   ++ I  +     +  +E   G  +  P
Sbjct: 737 -------------------TEIKSDDSTISDYSEENIMGSYYENKNPGQE-LLGVPIPKP 776

Query: 821 KKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM 880
           KKWVIS++V DTGPGI P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM
Sbjct: 777 KKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTM 836

Query: 881 KLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFR 930
           +LDS  G+GSKF+FTVPL Q ++++F + E  FEDEFN +SKKNRKV F+
Sbjct: 837 ELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFK 886

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 77/127 (60%), Positives = 98/127 (77%)

Query: 1005 KILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMP 1064
            K+L+ EDN VNQEVIKR+L LE ++ +E A DGQ+A D VK + +    +D+IFMD+QMP
Sbjct: 941  KVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMP 1000

Query: 1065 RVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKE 1124
             VDG TATR+IR EL Y +PIVALTAFADDSN KEC ++GMN FL+KPIKR ++K I+KE
Sbjct: 1001 NVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKE 1060

Query: 1125 YCPRPID 1131
            +   P D
Sbjct: 1061 FQNPPND 1067

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/705 (57%), Positives = 518/705 (73%), Gaps = 15/705 (2%)

Query: 14  QRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSS 73
           +R L+ P  + IR                      GVYFTS++K+LR++RL++AAQLKSS
Sbjct: 11  RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 74  QIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLAR 133
           Q+DQNLNYLYYQCYWL++RD LQNAL  Y+AGN + ENW +++  + KFL SSNLF L+R
Sbjct: 71  QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 134 VYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLM 193
           VYD  F+ VLN +NNG+G+ +PE++  QLFPLSTDV LPSSL   GMLTDPVLNG+ YLM
Sbjct: 131 VYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLM 190

Query: 194 SMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-EL 252
           SMSLPIFANPSII S  KVYGYITVV+SAEGL+SV+NDTTAL+ S+V IVS  Y ++ ++
Sbjct: 191 SMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI 250

Query: 253 AGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCN 312
             Y  VFPPY + P ++N  +++++ SFL  A K  KGGSIK T+FF  K +A+GY PC+
Sbjct: 251 DSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCS 310

Query: 313 STLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKA 372
                WVA+++Q E++FLSPST+L KII GT + IAV   ++TFPL+ WAV+PIVRLQKA
Sbjct: 311 FNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKA 370

Query: 373 TEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIPDSSKE 432
           TE+I  GRGLR   + +       +++     I     + R     +  R  Y  DS+ +
Sbjct: 371 TELIAEGRGLRPAGAGSGSRSGSRTSSMK-KDINDLNFISRLSLSEKNHRPAY--DSASD 427

Query: 433 VPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLIEARVPVY 492
                     H++          Q  N P+     N+  + +S    TSTNL EAR+P Y
Sbjct: 428 SNYATDGSLSHDLQTS-------QASNRPSD----NDRSSSRSRFLTTSTNLNEARLPDY 476

Query: 493 KRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIAN 552
           +RLFSDELS+LT TFN MTD LD+HYALLEDRVRART+QLEAAKI+AE ANEAKTVFIAN
Sbjct: 477 RRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIAN 536

Query: 553 ISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRT 612
           ISHELRTPLNGILGMTAI+M E D AK+++SLKLIFRSGELLLHI+TELLTFSKNVLKRT
Sbjct: 537 ISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRT 596

Query: 613 KLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLV 672
            LE+R+F I D+ALQ++SIFGK+AKDQHV L+IS+ PN++R+MVLWGDSNRI+QIVMNLV
Sbjct: 597 ALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLV 656

Query: 673 SNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESR 717
           SNALKFTPVDGKV+V+ +LLGEYDEE +KA  +K++  +  +++ 
Sbjct: 657 SNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAH 701

 Score =  215 bits (547), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 126/169 (74%), Gaps = 1/169 (0%)

Query: 976  VRVDRPFLQXXXXXXXXXXXXXXXXADRR-KILVAEDNNVNQEVIKRMLNLEGLEDVELA 1034
            V +DRPFLQ                   R KILVAEDN+VNQEVIKRMLNLEG+ +++LA
Sbjct: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050

Query: 1035 CDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADD 1094
            CDGQDAFDKV++       YD+IFMD+QMP+VDGL +T+MIR++L Y   IVALTAFADD
Sbjct: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110

Query: 1095 SNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVKNESEK 1143
            SNIKEC++AGMNGFLSKPIKRPK+K IL+EYCP  I+ K+ +   + +K
Sbjct: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENKDGDK 1159

 Score =  188 bits (478), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/141 (68%), Positives = 115/141 (81%), Gaps = 3/141 (2%)

Query: 793 YDDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEVHDTGPGIDPALHESVFEPFV 849
           YD+A+F T+ +K     E+     G  L   K WV ++EV DTGPGIDP LHESVFEPFV
Sbjct: 769 YDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFV 828

Query: 850 QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDV 909
           QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKL+S+VGVGSKF+FTVPL QT+ + F++ 
Sbjct: 829 QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEE 888

Query: 910 ENPFEDEFNPDSKKNRKVKFR 930
           E+ FEDEFNP+SKKNR+VKF+
Sbjct: 889 EDLFEDEFNPESKKNRRVKFK 909

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/742 (56%), Positives = 528/742 (71%), Gaps = 63/742 (8%)

Query: 15  RRLRR--------PLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHV 66
           +RL+R        P  +SIR                      GVYFTSS+K+LRA RL++
Sbjct: 13  QRLKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYI 72

Query: 67  AAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSS 126
           AAQLKSSQIDQ L YLYYQ YW+STRD LQ++L  ++AGN S+ NW    + L+KFL SS
Sbjct: 73  AAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSS 132

Query: 127 NLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVL 186
           + FS  +VYD +F  VL+V+NNG+GN I  ++L +LFPLST++ L SSLE TG+LTDPVL
Sbjct: 133 DYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVL 192

Query: 187 NGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTV 246
           NG+ YLMSMSLP+FANPSIILST++VYGYIT++++A+GL SV+NDTTA++ S+V IVS V
Sbjct: 193 NGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAV 252

Query: 247 YDDH-ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIA 305
           Y++  EL  YHL  PPY     V + ++Q++N SFL  A+K GKGGSIK T F  NK +A
Sbjct: 253 YNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVA 312

Query: 306 VGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQP 365
           VGYSPC+  LA WV++++Q E++F  PST+L KII G  + I+V   +VT PL+++AV+P
Sbjct: 313 VGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKP 372

Query: 366 IVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKY 425
           IVRL+KATEIIT GRGLR                       G+GSV R+ S+ R    + 
Sbjct: 373 IVRLKKATEIITEGRGLRPTTP-------------------GSGSVSRTSSMRREKSPRT 413

Query: 426 -IPDSSKEVPRGNSSDAIHE-------------------------------VNQENIEDI 453
            I  S K    GNS ++++E                               +NQE ++  
Sbjct: 414 SIVSSRKSTATGNS-NSLNENSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRA 472

Query: 454 EMQKVNSPTPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDE 513
               VN+ T  S  N+  + +S+  IT TNL EARVP+ ++LF DELS+LTETFNTMTD 
Sbjct: 473 SASTVNTLTIDS--NDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDA 530

Query: 514 LDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMA 573
           LD HY LLEDRVRART+QLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAI+M 
Sbjct: 531 LDEHYTLLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISME 590

Query: 574 EEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFG 633
           EED  K++SSLKLIFRSGELLLHI+TELLTFSKNVL+RTKLE+R+F I D+ALQ++SIFG
Sbjct: 591 EEDITKIRSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFG 650

Query: 634 KLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLG 693
           K+AKDQHV L+I + PN++R+MVL+GDSNRI+Q+VMNLVSNALKFTPVDGKV VK +LLG
Sbjct: 651 KVAKDQHVRLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLG 710

Query: 694 EYDEEKSKASEYKEVFVLPPTE 715
           EYDEE SK S++++V+V   TE
Sbjct: 711 EYDEESSKNSKFEKVYVKGGTE 732

 Score =  390 bits (1002), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/353 (54%), Positives = 233/353 (66%), Gaps = 17/353 (4%)

Query: 793  YDDAIFQTRLRKDSSNEENEEG---RALESPKKWVISMEVHDTGPGIDPALHESVFEPFV 849
            YDDAIF ++ +K     E+E+G     L   K WV  +EV DTGPGID +L ESVFEPFV
Sbjct: 815  YDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFV 874

Query: 850  QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDV 909
            QGDQTLSRQYGGTGLGLSICRQLATMM+GTM L+S VG GSKF FTVPLTQT+ +  ++ 
Sbjct: 875  QGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDES 934

Query: 910  ENPFEDEFNPDSKKNRKVKFRMG-------------XXXXXXXXXXXXXXXXXXXXXXXX 956
            E+P+EDEFNP SK NRKVKF +                                      
Sbjct: 935  EHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETRSNHSD 994

Query: 957  XXXXXXXXXXXXXXVSVGSVRVDRPFLQXXXXXXXXXXXXXXXXADRR-KILVAEDNNVN 1015
                           S  ++ +DRPFLQ                  +   +LVAEDN+VN
Sbjct: 995  VSTSNKNESASPQPESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVN 1054

Query: 1016 QEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMI 1075
            QEVIKRML+LEG+++++LACDGQDAFD VK+    G+ YD+IFMDVQMP+VDGL+AT+MI
Sbjct: 1055 QEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMI 1114

Query: 1076 RKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPR 1128
            R +L Y HPIVALTAFADDSNIKECLDAGM+GFLSKPIKRP++K IL EYCP+
Sbjct: 1115 RNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCPK 1167

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/684 (47%), Positives = 452/684 (66%), Gaps = 22/684 (3%)

Query: 49  GVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTS 108
           GVYFT+ +K L   RL++A+QLKSSQIDQ LNYLYYQCYW+++R+ +Q   T   + +T 
Sbjct: 49  GVYFTTHYKDLNVNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQ---TMVFSNHTG 105

Query: 109 TENWS---DASTTLDKFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPL 165
             N S   ++ + LDKF+G+S+LF    +YD + + ++N +NN SG+ +  ++L++L PL
Sbjct: 106 MHNASGIIESQSVLDKFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPL 165

Query: 166 S-TDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI---FANPSIILSTAKVYGYITVVIS 221
           S T+  +P  +  TG+LTDP+LN + YLMSMSLPI   ++  + I + + +YGY+TVV+S
Sbjct: 166 SSTNTTIPPLINNTGILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMS 225

Query: 222 AEGLKSVYNDTTALDDSSVIIVSTVYDDHELAGY-HLVFPPYNMYPDVINEHYQIENGSF 280
           AE LKSV+NDT  L DS+  ++S +Y +  L  Y H VFPP+++   +I+E   I+NG+F
Sbjct: 226 AESLKSVFNDTAGLSDSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTF 285

Query: 281 LEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKII 340
              A    K GS K  +  N K  A+GY+P N  L +WVA++  P+  F S S +L KII
Sbjct: 286 QYRAFDKNKSGSKKKVKLVNKKNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKII 345

Query: 341 VGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAE 400
            GT + IAV   +++ PLS+WAVQPIVRLQ+A+E+IT  RGLR+ N  +        T +
Sbjct: 346 CGTVVGIAVFVFLISLPLSYWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYD 405

Query: 401 SFSSIFGTGSVRRSGSVARAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNS 460
           S +      S   S +      D  I D      RG+++      N     +   +  N 
Sbjct: 406 S-NDDHTYESKLISSTPTLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNR 464

Query: 461 PTPYSMMNESQAVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYAL 520
                     + V    +++ +   E +VPVY++LF DEL+ELT+TFN M++ LD HYAL
Sbjct: 465 L--------RRNVSVSTHVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYAL 516

Query: 521 LEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKV 580
           LE RV  RT+QLEAAK++AE ANEAKTVFIANISHELRTPLNGILGMT+ ++ E D  K+
Sbjct: 517 LEKRVHQRTKQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKI 576

Query: 581 KSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQH 640
           K  LKLIFRSGELLL+I+TELLTFSKNVL +TKLE R+F I++I  Q+++IF KL + Q 
Sbjct: 577 KDGLKLIFRSGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQE 636

Query: 641 VNLTISILP-NLLRSMVLWGDSNRIVQIVMNLVSNALKFTP-VDGKVDVKFRLLGEYDEE 698
           V L I +LP   L+S++ +GDSNRI+Q++MNL+SNA+KFTP V+GKV+V   LLGEYDEE
Sbjct: 637 VKLFIRLLPKKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEE 696

Query: 699 KSKASEYKEVFVLPPTESRTSSTE 722
           +SK   Y +V + P T+  T S E
Sbjct: 697 ESKTENYSKVCIKPSTQIVTESGE 720

 Score =  163 bits (412), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 77/123 (62%), Positives = 97/123 (78%)

Query: 1003 RRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQ 1062
            + K+LVAEDN VNQEVIKRML LE + D+ELA DG +AF+KVK    + K YD+IFMD+Q
Sbjct: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073

Query: 1063 MPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAIL 1122
            MP++DGL +T  IR+EL Y   IVALTAFAD+SNIKEC DAGM+GF+ KPIKR  +  +L
Sbjct: 1074 MPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133

Query: 1123 KEY 1125
            +E+
Sbjct: 1134 EEF 1136

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (74%), Gaps = 2/110 (1%)

Query: 793 YDDAIFQTRLRKDSSNEENE--EGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQ 850
           YD+ +F   ++++   + N+      +E  KKWVI  EV D GPGID  LH+SVF+PFVQ
Sbjct: 798 YDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQ 857

Query: 851 GDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQ 900
           GDQTLSRQYGGTGLGLSIC+QL  MM GT++L+S++G GSKF +T+PL Q
Sbjct: 858 GDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  563 bits (1452), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 362/488 (74%), Gaps = 36/488 (7%)

Query: 472 AVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQ 531
           + KS    TS NLIEARVP Y+RLFSDELS+LT+TFNTMTD LD+HYALLEDRVRART+Q
Sbjct: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573

Query: 532 LEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSG 591
           LEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D +K++SSLKLIFRSG
Sbjct: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633

Query: 592 ELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNL 651
           ELLLHI+TELLTFSKNVLKRT LE+RDF I D+ALQ++SIFGK+AKDQ V L+I++ PN 
Sbjct: 634 ELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693

Query: 652 LRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVL 711
           +R+MVL+GDSNRI+QIVMNLVSNALKFTPVDGKV+VK +L+GEYDE  S  + +KEV+V 
Sbjct: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753

Query: 712 PPTE-----------------------SRTSSTEAKDEKNAESCVDSDTNVLSLPSTAES 748
             TE                       + +S+T  KD  N+E+  + +        +A+ 
Sbjct: 754 QGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDE-------KSADD 806

Query: 749 TDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXXTKSIGSGNTSSYDDAIFQTRLRKD--- 805
            D++  KI  +                        S+ S +TSSYDDAIF ++ +K    
Sbjct: 807 LDDE--KIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGL 864

Query: 806 -SSNEENEEGRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGL 864
              +E N+ G  +E PK WVI + V DTGPGID  L ESVF+PFVQGDQTLSRQYGGTGL
Sbjct: 865 YDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGL 924

Query: 865 GLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKN 924
           GLSICRQLA MMHGTMKL S+VGVGS F+FTVPL QT+E+ F+D+E+PFEDEFNP+S+KN
Sbjct: 925 GLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKN 984

Query: 925 RKVKFRMG 932
           RKVKF++ 
Sbjct: 985 RKVKFKLA 992

 Score =  470 bits (1210), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 287/371 (77%), Gaps = 1/371 (0%)

Query: 17  LRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLKSSQID 76
           L+ P  + IR                      GVYFT+++K+LR++RL++AAQLKSSQID
Sbjct: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68

Query: 77  QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136
           Q LNYLYYQCY++S+RD LQ ALT Y+AGN S ENW+D+++ L KFL SSNLFS+A+VYD
Sbjct: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128

Query: 137 SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196
           +SF  VLNV+NNG+G+ IP+++L +L PLST++ L SSLE TG+LTDPVLN S YLMSMS
Sbjct: 129 ASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188

Query: 197 LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDD-HELAGY 255
           LPIFANPS+IL+ ++VYGY+TVV+SAEGL++V+NDTTAL+ S+V IVS VY++   L  Y
Sbjct: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248

Query: 256 HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTL 315
             VF P      +IN  Y++ NGSFL  A+++GKGGS+KST+FF +K +A+GYSPC  + 
Sbjct: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308

Query: 316 AQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEI 375
             WVA+++Q E++FLSPST+LAKII GT +AI V   ++TFPL+HWAV+PIVRLQKATE+
Sbjct: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368

Query: 376 ITAGRGLRSDN 386
           I+ GRGL+S N
Sbjct: 369 ISEGRGLKSTN 379

 Score =  216 bits (549), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 100/159 (62%), Positives = 120/159 (75%), Gaps = 7/159 (4%)

Query: 976  VRVDRPFLQXXXXXXXXXXXXXXXXADRR-------KILVAEDNNVNQEVIKRMLNLEGL 1028
            V +DRPFLQ                +++        KILVAEDN+VNQEVIKRMLNLEG+
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1029 EDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVAL 1088
              ++LACDGQ+AFDKVK        Y++IFMDVQMP+VDGL +T+MIRK+L Y HPIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1089 TAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127
            TAFADDSNIKECL++GMNGFLSKPIKRPK++ I+KEYCP
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  506 bits (1303), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 286/460 (62%), Positives = 355/460 (77%), Gaps = 15/460 (3%)

Query: 482 TNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEG 541
           + ++E +VPVY+RLF DELSELT+TFNTM+D LD+HYALLE+RVRART+QLEAAKIEAE 
Sbjct: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 542 ANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTEL 601
           ANEAKTVFIANISHELRTPLNGILGMTAI+M E+D   +KSSLKLIFRSGELLLHI+TEL
Sbjct: 532 ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 602 LTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDS 661
           LTFSKNVL+RTKLEERDF I D+ALQ++SIFGK+AKDQHV L+I ++PN +R++VLWGDS
Sbjct: 592 LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 662 NRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSST 721
           NRI+QIVMNLVSNALKFTP+DGKV V+  LLGEYD+EKSKA++YKEVFV   TE   + +
Sbjct: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 722 EAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRXXXXXXXXXXXXXXXXXXXXXX 781
           +   + N E  + + +       + ++ +  N  IG++                      
Sbjct: 712 KILQKLNTEKLIATRS-----ARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766

Query: 782 TK----SIGSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEVHDTGP 834
           T+    S+ S +TSSYD+ +F  + +K +  ++++E   G  ++ PK WVI +EV DTGP
Sbjct: 767 TRDDTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGP 826

Query: 835 GIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSF 894
           GI PAL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM L+S+VG GSKF+F
Sbjct: 827 GIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTF 886

Query: 895 TVPLTQTKELLF---EDVENPFEDEFNPDSKKNRKVKFRM 931
           TVPLTQT+E++    ED+   F+DEFN  SKKNRKVKF +
Sbjct: 887 TVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAI 926

 Score =  461 bits (1185), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/381 (55%), Positives = 277/381 (72%), Gaps = 2/381 (0%)

Query: 12  FFQRRLRRPLVVSIRXXXXXXXXXXXXXXXXXXXXXXGVYFTSSFKSLRAERLHVAAQLK 71
            F+  LR PL + IR                      G+YFT ++K +R +RL +AA+LK
Sbjct: 6   MFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELK 65

Query: 72  SSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSL 131
           SSQ+DQ LN+LYYQCYWLS RD LQ A+  Y AGN S+  W D+   ++KFL SS++FS+
Sbjct: 66  SSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSI 125

Query: 132 ARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVY 191
           +R+YD++F  V+N +NNG+GN++P ++L +L PLS+   LP+SL  +GMLTDPVLN + Y
Sbjct: 126 SRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTY 185

Query: 192 LMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH- 250
           LMSMSLPI ANPSIIL+ +KVYGYIT+++SAE L SVYNDTTAL+ S+V IVS  Y D+ 
Sbjct: 186 LMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYS 245

Query: 251 -ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYS 309
             L  YH VFPPY   P +I+ +Y ++NGSFL DA+ + K GSI  T+FF N  +A+GYS
Sbjct: 246 ASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYS 305

Query: 310 PCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRL 369
           PC+  L  WVAI++QPE++FLSPST+L +II GT +AIAV  C VTFPLSHWAV+PIVRL
Sbjct: 306 PCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRL 365

Query: 370 QKATEIITAGRGLRSDNSSTL 390
           QKATE+I  GRGLRS ++ TL
Sbjct: 366 QKATELIAEGRGLRSSSNRTL 386

 Score =  185 bits (469), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (81%), Gaps = 5/126 (3%)

Query: 1007 LVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVK-----AQDATGKHYDLIFMDV 1061
            LV EDN+VNQEVIKRML LE L +++LACDG++A+ KVK     +      +YDLIFMDV
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 1062 QMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAI 1121
            QMPR+DGL +T++IR EL Y+ PIVALTAFAD+SNIKECLD GM+GFLSKPIKRPK+K I
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1122 LKEYCP 1127
            L E+CP
Sbjct: 1193 LNEFCP 1198

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 22/152 (14%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V  ++  + L   G   VE+  DG  A + V+        YDL+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEK-----FQYDLVLMDIVMPN 384

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1126 C---------------PRPIDEKEGEVKNESE 1142
                            PRP D  +  +  E++
Sbjct: 444  LKDRVPLAEQNSSTAQPRPQDTSQPSILKENQ 475

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 73/138 (52%), Gaps = 9/138 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ ++ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRYDLVLMDIVMPN 458

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   DD ++   L  GMN  L+KP  R  + ++L  Y
Sbjct: 459  LDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

Query: 1126 CP--RPIDEKEGEVKNES 1141
                 P+ E++ ++ +ES
Sbjct: 518  LKDRTPLCEQKRQLASES 535

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V  ++  + L   G   VE+  DG  A + V+        YDL+ MD+ MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEK-----FQYDLVLMDIVMPN 373

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 374  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 70/137 (51%), Gaps = 9/137 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V  ++  + L   G   VE+  DG  A   ++ Q      +DL+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEKQ-----RFDLVLMDIVMPN 384

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T   DD ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 385  LDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1126 CPR--PIDEKEGEVKNE 1140
                 P+ E+     N+
Sbjct: 444  LKDRIPLSEQRQNSNND 460

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ ++ ++  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 408

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +D ++   L  GMN  L+KP  R  + ++L  Y
Sbjct: 409  LDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 7/117 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V+ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEK-----FRYDLVLMDIVMPN 460

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAIL 1122
            +DG TAT ++R       PI+A+T   +D ++   L  GMN  L+KP  R  + +IL
Sbjct: 461  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSIL 516

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V  ++  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 362

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T   +D ++   L+ GMN  L+KP  +  + ++L  Y
Sbjct: 363  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V  ++  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 336  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 389

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R    ++ PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 390  LDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 448

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 72/137 (52%), Gaps = 9/137 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED++V+ ++  + L   G   V++  DG  A   ++        +DL+ MD+ MP 
Sbjct: 384  VLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEK-----FRFDLVLMDIVMPN 437

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +  ++   L  GMN  L+KP  R  + +IL  Y
Sbjct: 438  LDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILIRY 496

Query: 1126 CPR--PIDEKEGEVKNE 1140
                 PI +++ +++ E
Sbjct: 497  LKDRVPISDQKNQLQQE 513

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 379  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEKY-----RYDLVLMDIVMPN 432

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T    + ++   L  GMN  L+KP  R  + +IL  Y
Sbjct: 433  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

Query: 1126 CPR--PIDEKEGEVKNESEK 1143
                 P+ E++   +N S +
Sbjct: 492  LKDRIPLCEQQLPPRNSSPQ 511

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+  +  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 436

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 437  LDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+++  ++  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 360

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 361  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+ ++  + L   G   VE+  DG  A   ++A       YDL+ MD+ MP 
Sbjct: 426  VLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEA-----FRYDLVLMDIVMPN 479

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT +IR       PI+A+T   +D ++   L  GM   L+KP  R  + ++L  +
Sbjct: 480  LDGATATSIIRN-FDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIRH 538

Query: 1126 CPR--PIDEKE 1134
              +  P+ E++
Sbjct: 539  LSKRIPLCERQ 549

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 380  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 433

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T    + ++   L  GMN  L+KP  R  + +IL  Y
Sbjct: 434  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

Query: 1126 CPR--PIDEKEGEVKNESEK 1143
                 P+ E++   +N S +
Sbjct: 493  LKDRIPLCEQQLPPRNSSPQ 512

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 381  VLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 434

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T    + ++   L  GMN  L+KP  R  + +IL  Y
Sbjct: 435  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

Query: 1126 CPR--PIDEKEGEVKNESEK 1143
                 P+ E++   +N S +
Sbjct: 494  LKDRIPLCEQQLPPRNSSPQ 513

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V+ ++  + L   G   V++  DG  A   ++        YDL+ MD+ MP 
Sbjct: 381  VLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEK-----FRYDLVLMDIVMPN 434

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T    + ++   L  GMN  L+KP  R  + +IL  Y
Sbjct: 435  LDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

Query: 1126 CPR--PIDEKEGEVKNESEK 1143
                 P+ E++   +N S +
Sbjct: 494  LKDRIPLCEQQLPPRNSSPQ 513

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V  ++  + L   G   VE+  DG  A   ++        YDL+ MD+ MP 
Sbjct: 378  VLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEK-----FRYDLVLMDIVMPN 431

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 432  LDGATATSIVR-SFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 490

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+ V  ++  + L   G   V +  DG  A   ++        +DL+ MD+ MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLENH-----RFDLVLMDIVMPN 471

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R    Y+ PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKH-YDLIFMDVQMP 1064
            +L+ ED+ V+ ++  + L       ++  C  Q   D + A     K+ +DL+ MD+ MP
Sbjct: 352  VLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTLEKYRFDLVLMDIVMP 404

Query: 1065 RVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKE 1124
             +DG TAT +IR       PI+A+T   +  ++   L  GMN  L+KP  R  + ++L  
Sbjct: 405  NLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTR 463

Query: 1125 Y 1125
            Y
Sbjct: 464  Y 464

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ ED+++  ++  + L ++    VE+  DG  A   ++        +DL+ MD+ MP 
Sbjct: 304  VLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEK-----FRFDLVLMDIVMPN 357

Query: 1066 VDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125
            +DG TAT ++R       PI+A+T   +D ++   L  GMN  L+KP  +  + ++L  Y
Sbjct: 358  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 416

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 78/164 (47%), Gaps = 35/164 (21%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   E+A +G +A +K +     G H  LI MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQ---GGIH--LILMDLQLPL 604

Query: 1066 VDGLTATRMIRK--------------------------ELGYSHP--IVALTAFADDSNI 1097
            + GL AT+ IR                              +  P  IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1098 KECLDAGMNGFLSKPIKRPKIKAILKEY-CPRPIDEKEGEVKNE 1140
            +E L AG N +L+KP+    + + + E+ C + + + +G  K E
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEWGCMQALIDFDGWTKGE 708

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 70/160 (43%), Gaps = 29/160 (18%)

Query: 977  RVDRPFLQXXXXXXXXXXXXXXXXADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACD 1036
            R D PFL+                  +  +LV EDN +NQ ++   L    +   ++A +
Sbjct: 392  REDSPFLRSAMETFTTESITRDKVFPKISVLVVEDNMINQTILSSFLRKHKIS-YKVAKN 450

Query: 1037 GQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRK-----ELGYSHP------- 1084
            G +A D+ K     G H  LI MD++MP + G+ A + IR+      +G   P       
Sbjct: 451  GIEAVDRWKE---GGMH--LILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAP 505

Query: 1085 -----------IVALTAFADDSNIKECLDAGMNGFLSKPI 1113
                       IVALTA    S+  E L AG N +L+KP+
Sbjct: 506  AKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPV 545

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 11/113 (9%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A +  K     G H  LIFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWKN---GGLH--LIFMDLQLPV 530

Query: 1066 VDGLTATRMIR---KELGYSHP--IVALTAFADDSNIKECLDAGMNGFLSKPI 1113
            + G+ A + IR   KE     P  IVALTA     + +  L +G N +L+KP+
Sbjct: 531  LSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPV 583

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 35/165 (21%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   E+A +G +A +K +     G H  LI MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWRK---GGIH--LILMDLQLPL 564

Query: 1066 VDGLTATRMIRK-----------------------ELG---YSHP--IVALTAFADDSNI 1097
            + G+ A + IR                        EL    +  P  IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1098 KECLDAGMNGFLSKPIKRPKIKAILKEY-CPRPIDEKEGEVKNES 1141
             E L AG N +L+KP+    +   + E+ C + + + +G  K ES
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEWGCMQALIDFDGWTKGES 669

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 26/128 (20%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ +++  L    +   ++A +GQ+A D+ K         DLIFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKEGG-----IDLIFMDLQLPV 556

Query: 1066 VDGLTATRMIR--KELGYSHP------------------IVALTAFADDSNIKECLDAGM 1105
              G+ A + IR  ++L  S                    IVA TA    ++ +E L +G 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1106 NGFLSKPI 1113
            N +L+KP+
Sbjct: 617  NDYLTKPV 624

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 33/135 (24%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A DK K  +       LIFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKEGN-----LHLIFMDLQLPV 518

Query: 1066 VDGLTATRMIR---KELGYSHP------------------------IVALTAFADDSNIK 1098
            + G+ A + IR   KE G ++                         IVALTA     + +
Sbjct: 519  LSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKR 578

Query: 1099 ECLDAGMNGFLSKPI 1113
            E L +G N +L+KP+
Sbjct: 579  EALISGCNDYLTKPV 593

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 33/135 (24%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   +LA +GQ+A +  K     G H  LIFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE---GGLH--LIFMDLQLPV 541

Query: 1066 VDGLTATRMIR-----------KELGYSHP----------------IVALTAFADDSNIK 1098
            + G+ A + IR           K L  S+P                IVALTA     + +
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1099 ECLDAGMNGFLSKPI 1113
            + L +G N +L+KP+
Sbjct: 602  KALVSGCNDYLTKPV 616

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 28/130 (21%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +LV EDN +NQ ++   L    +   ++A +G +A D+ K     G H  LI MD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWKE---GGMH--LILMDLEMPL 461

Query: 1066 VDGLTATRMIRK-----ELGYSHP-----------------IVALTAFADDSNIKECLDA 1103
            + G+ A + IRK      +G   P                 IVALTA    ++  E L A
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1104 GMNGFLSKPI 1113
            G N +L+KP+
Sbjct: 522  GCNDYLTKPV 531

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 63/115 (54%), Gaps = 13/115 (11%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A D  K     G H  LIFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE---GGLH--LIFMDLQLPV 572

Query: 1066 VDGLTATRMIR-----KELGYSHP--IVALTAFADDSNIKECLDAGMNGFLSKPI 1113
            + G+ A + IR     +    + P  IVALTA     + ++ L +G N +L+KP+
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPV 627

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 25/127 (19%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A D  K     G H  LIFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE---GGLH--LIFMDLQLPV 600

Query: 1066 VDGLTATRMIR---KELG-----YSHP-----------IVALTAFADDSNIKECLDAGMN 1106
            + G+ A R IR   KE G     +S+            IVALTA     + +  L +G N
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1107 GFLSKPI 1113
             +L+KP+
Sbjct: 661  DYLTKPV 667

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 33/135 (24%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   +LA +GQ+A +  K     G H  LIFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE---GGLH--LIFMDLQLPV 559

Query: 1066 VDGLTATRMIR-----------KELGYSHP----------------IVALTAFADDSNIK 1098
            + G+ A + IR           K L  SH                 IVALTA     + +
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1099 ECLDAGMNGFLSKPI 1113
            + L +G N +L+KP+
Sbjct: 620  KALLSGCNDYLTKPV 634

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 34/135 (25%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +GQ+A D  +     G H  LIFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWRE---GGIH--LIFMDLQLPV 620

Query: 1066 VDGLTATRMIRKELGYSHP---------------------------IVALTAFADDSNIK 1098
            + G+ A + IR EL   H                            IVA TA    S+ K
Sbjct: 621  LSGIDAAKKIR-ELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKK 679

Query: 1099 ECLDAGMNGFLSKPI 1113
            E L +G N +L+KP+
Sbjct: 680  EALISGCNDYLTKPV 694

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 33/135 (24%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   +LA +GQ+A +  K     G H  LIFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE---GGLH--LIFMDLQLPV 548

Query: 1066 VDGLTATRMIR-----------KELGYSHP----------------IVALTAFADDSNIK 1098
            + G+ A + IR           K L  SH                 IVALTA     + +
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1099 ECLDAGMNGFLSKPI 1113
            + L +G N +L+KP+
Sbjct: 609  KALLSGCNDYLTKPV 623

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 34/136 (25%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +    +A +G++A +K K     G H  LIFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE---GGIH--LIFMDLQLPV 526

Query: 1066 VDGLTATRMIR-----KELGYSHP-----------------------IVALTAFADDSNI 1097
            + G+ A + IR     K +G  +P                       +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1098 KECLDAGMNGFLSKPI 1113
            +E L +G N +L+KP+
Sbjct: 587  REALVSGCNDYLTKPV 602

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 36/138 (26%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A DK K     G H  LIFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWKE---GGLH--LIFMDLQLPV 566

Query: 1066 VDGLTATRMIR-----KELGYSHP-------------------------IVALTAFADDS 1095
            + G+ A + IR     K +G                             IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1096 NIKECLDAGMNGFLSKPI 1113
            + +E L +G N +L+KP+
Sbjct: 627  DKREALISGCNDYLTKPV 644

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 6/75 (8%)

Query: 1003 RRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQ 1062
            R  +L+ EDN +NQ ++   L   G+   ++A DG +A +K K  D+      LI MD+Q
Sbjct: 393  RINVLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWKEGDS-----HLILMDLQ 446

Query: 1063 MPRVDGLTATRMIRK 1077
            +P + GL AT+ IR+
Sbjct: 447  LPLLSGLEATKKIRE 461

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 29/131 (22%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A D  K     G H  LIFMD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE---GGLH--LIFMDLQLPV 725

Query: 1066 VDGLTATRMIR---KELGY------------------SHP--IVALTAFADDSNIKECLD 1102
            + G+ A R IR   KE G                     P  IVALTA     + ++ L 
Sbjct: 726  LSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKALL 785

Query: 1103 AGMNGFLSKPI 1113
            +G N +L+KP+
Sbjct: 786  SGCNDYLTKPV 796

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 33/135 (24%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   +LA +GQ+A +  K     G H  LIFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE---GGLH--LIFMDLQLPV 558

Query: 1066 VDGLTATRMIR-----------KELGYSH--------------P--IVALTAFADDSNIK 1098
            + G+ A + IR           K    SH              P  IVALTA     + +
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1099 ECLDAGMNGFLSKPI 1113
            + L +G N +L+KP+
Sbjct: 619  KALLSGCNDYLTKPV 633

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 65/141 (46%), Gaps = 36/141 (25%)

Query: 1003 RRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQ 1062
            R  IL+ EDN +NQ ++   L    +   ++A +G++A DK K     G H  LIFMD+Q
Sbjct: 564  RINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE---GGIH--LIFMDLQ 617

Query: 1063 MPRVDGLTATRMIR---KELGYS-------------------------HP--IVALTAFA 1092
            +P + G  A + IR   K++G                            P  IVA TA  
Sbjct: 618  LPVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASN 677

Query: 1093 DDSNIKECLDAGMNGFLSKPI 1113
              ++ +  L AG N +L+KP+
Sbjct: 678  SLADKRAALIAGCNDYLTKPV 698

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +L+ EDN +NQ ++   L    +   ++A +G++A DK K     G H  LI +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWKQ---GGIH--LILLDLQLPI 517

Query: 1066 VDGLTATRMIR 1076
            + G+ AT+ IR
Sbjct: 518  LSGIEATKEIR 528

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIR-- 1076
            I R   ++ LE +  +  G  A D++  +   G  +DLI   +++P++  +   +++R  
Sbjct: 1450 IHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHT 1509

Query: 1077 KELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGE 1136
                 + PIVA+TA+  ++   +  D      L KP+   +I+ ++ +Y  +   E E  
Sbjct: 1510 NSANCNTPIVAVTAYYGEAESTQVFD----DVLEKPVGIEQIRCLIAKYALQKSQEDEDT 1565

Query: 1137 VKNESE 1142
            + +++E
Sbjct: 1566 IISDTE 1571

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 52/110 (47%), Gaps = 6/110 (5%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIR-- 1076
            I R    E LE +  +       +++  +  TG  +DLI   +++P++  +   ++IR  
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELVRRATTGVKFDLIITAMKLPKLGAIDIAKLIRHT 1508

Query: 1077 KELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
              +  + PIVALT +  D+   +  D      L KP+   +++ ++ +Y 
Sbjct: 1509 NSVNCTTPIVALTVYYHDAKESKVFD----DVLEKPVSVEQLRKLVSKYA 1554

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078
            I R    + LE++        A D++ ++  +G  +DLI   +++P++  +   +++++ 
Sbjct: 1645 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1704

Query: 1079 LGYSH--PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKE 1134
             G +   PIVA+T +  ++      D      L KP+K  ++K ++ +Y  +   E E
Sbjct: 1705 NGANSTTPIVAITNYFQEAATSRVFD----DVLEKPVKLDELKKLVAKYALKKSQEDE 1758

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078
            I R    + LE++        A D++ ++  +G  +DLI   +++P++  +   +++R+ 
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1079 LGYSH--PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKE 1134
             G +   PIVA+T +  ++   +  D      L KP+   ++K ++ +Y  +   E E
Sbjct: 1693 NGANSTTPIVAITNYFQEAITSKVFD----DVLEKPVNLDELKKLVAKYALKKSQEDE 1746

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 1003 RRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQ 1062
            R  ILV E   +++  + R L   G   V +      A D++ ++  +G  +DLI   ++
Sbjct: 1541 RMDILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRANSGVKFDLIVTALK 1595

Query: 1063 MPRVDGLTATRMIRKELGYSH--PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKA 1120
            +P++  +   ++I+   G +   PI+A+T F  ++   +  D      L KPI   +I+ 
Sbjct: 1596 LPKLGAIDIVKLIKHTNGINSRTPIIAITNFYHEAISAKVFD----DVLEKPIMLDEIRH 1651

Query: 1121 ILKEYC 1126
            ++ +Y 
Sbjct: 1652 LVAKYA 1657

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 72  SSQIDQNLNYL-YYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFS 130
           S +ID+N N++    CY+ + +DI++N  TQ L    +   + DA T +    GS  L +
Sbjct: 409 SQEIDRNYNFMNLSSCYYYTDKDIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIA 468

Query: 131 LARVYDSSFQDVLN 144
             R  D   ++ L+
Sbjct: 469 YCRKQDVVGKEALD 482

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 54/106 (50%), Gaps = 13/106 (12%)

Query: 1042 DKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRK--ELGYSHPIVALTAFADDSNIKE 1099
            D++  +  +G  +DLI   +++P++  +  TR++R+   +  + PIVA+T          
Sbjct: 1471 DEIVRRATSGVRFDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTV--------N 1522

Query: 1100 CLDAGMNGF---LSKPIKRPKIKAILKEYCPRPIDEKEGEVKNESE 1142
              DAG + F   L +PI   +++ ++ +Y      + E  + ++SE
Sbjct: 1523 YHDAGTHIFDDVLERPIGTEQLRKLVSKYALFKSQQHEDTILSDSE 1568

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078
            I R    + LE++        A D++ ++  +G  +DLI   +++P++  +   +++++ 
Sbjct: 1635 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1694

Query: 1079 LGYSH--PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKE 1134
             G +   PIVA+T +  ++   +  D      L KP+   ++K ++ +Y  +   E E
Sbjct: 1695 NGANSTTPIVAITNYFQEAITSKVFD----DVLEKPVNLDELKKLVAKYALKKSQEDE 1748

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 825 ISMEVHDTGPGIDPALHESVFEPFV------QGDQTLS---------RQYGGTGLGLSIC 869
           + + + D G GIDP + + VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 870 RQLATMMHGTMKLDSQVGVGS 890
           +    + +GT+ + S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/142 (18%), Positives = 68/142 (47%), Gaps = 11/142 (7%)

Query: 1003 RRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQ 1062
            R  +LV E   +++  + + L   G   + +      A D++ ++  +G  +DLI   ++
Sbjct: 1467 RMDVLVCEPIPIHRYRVTKDLESLGCTVISVG-----AGDELVSRATSGVKFDLIITALK 1521

Query: 1063 MPRVDGLTATRMIR--KELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKA 1120
            +P++  +   R+++    +  + P+VA+T +  ++      D      L KP+   +++ 
Sbjct: 1522 LPKLGAVDIVRLLKHTNSINATTPVVAVTNYYQEAVSGNVFD----DVLEKPVAYDQLRK 1577

Query: 1121 ILKEYCPRPIDEKEGEVKNESE 1142
            I  +Y    + ++E  + ++S+
Sbjct: 1578 IAAKYTLEKVQQQEDTIVSDSD 1599

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078
            I R     GLE +        A D++  +  +G  +DLI   +++P++  +   ++++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1079 LGYSH--PIVALTAF---ADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
             G +   PIVA T +   A ++N+        +  L KPI    ++ ++ +Y 
Sbjct: 1454 NGINSTTPIVAATCYFEEASNTNV-------FSDVLEKPISIQTLRKLISKYA 1499

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 2/95 (2%)

Query: 1028 LEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVA 1087
            LE   +  D    + K K +    K YDL+ +D  +  ++      M+   + Y  PI+ 
Sbjct: 511  LEQYRITVDIMQDWPKTK-EKILNKCYDLVIIDAHVKFLNVPILESML-SSIQYHPPIIL 568

Query: 1088 LTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAIL 1122
            +T+  +D  +   L  G+N  L KP    K+   L
Sbjct: 569  MTSSLNDQQLIFYLQHGINSILEKPFHSHKLLKFL 603

>ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1604

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            +LV E  ++++  + R L     ED+  A     A D++  +  +G  +DLI   +++P+
Sbjct: 1475 VLVCEPISIHRYRVTREL-----EDLGCAVIAVGAGDELIGRATSGIKFDLIMTALKLPK 1529

Query: 1066 VDGLTATRMIRKELGYSH--PIVALTAFADDSNIKECLDAGM-NGFLSKPIKRPKIKAIL 1122
            +       +++   G +   P+VALT +      +E +   + N  L KP+    ++ I+
Sbjct: 1530 LGAADIVSLLKYTNGTNSTTPVVALTNY-----YQEAVSLNLFNDVLEKPVLADSLRKIV 1584

Query: 1123 KEYCPRPIDEKE 1134
             +Y  +   ++E
Sbjct: 1585 AKYALKKSQQQE 1596

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/110 (20%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078
            I R    + LE++        A D++ ++  +G  +DLI   +++P++  +   +++++ 
Sbjct: 1628 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1687

Query: 1079 LGYSH--PIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126
             G +   PIV++T +  ++   +  D      L KP+   ++K ++ +Y 
Sbjct: 1688 NGVNSTTPIVSITNYFQEAIASKAFD----DVLEKPVNLDELKRLVAKYA 1733

>Suva_16.143 Chr16 complement(241716..246233) [4518 bp, 1505 aa]
           {ON} YPL167C (REAL)
          Length = 1505

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 9/92 (9%)

Query: 409 GSVRRSGSVARAGRDKYIPDSSK-------EVPRGNSSDAIHEVNQENIEDIEMQKVNSP 461
           GS  R   V+R  +    PD           VP     D + E+  E    +E Q+    
Sbjct: 495 GSAERISPVSRKRKKTMTPDLYYGENYFVYRVPPFGYRDILEELEAEGFPKMEYQEPFFS 554

Query: 462 TPYSMMNESQAVKSERY-ITSTNLIEARVPVY 492
            P  + N+  A   +R+ ITST+L  AR+PV+
Sbjct: 555 NPVDLENKPYAYAGKRFEITSTHL-SARIPVH 585

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 1054 YDLIFMDVQMPRVDGLTATRMIRKELGYSH--PIVALTAFADDSNIKECLDAGMNGFLSK 1111
            +DLI   +++P++D +   ++I++  G +   PI+A T +  ++          N  + K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEAETCHVF----NDIMEK 1939

Query: 1112 PIKRPKIKAILKEYC 1126
            PI+   ++ ++  Y 
Sbjct: 1940 PIQLDILRRVVSRYA 1954

>TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1536

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 62/126 (49%), Gaps = 17/126 (13%)

Query: 1006 ILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPR 1065
            IL+ E   +++  I + L   G   V +A     A D++ ++  +G  +DLI   +++P+
Sbjct: 1406 ILLCEPIPIHRYYITKDLETLGCTVVSVA-----AGDELISRATSGIKFDLIITALKLPK 1460

Query: 1066 VDGLTATRMIRKELGYSH--PIVALTAF---ADDSNIKECLDAGMNGFLSKPIKRPKIKA 1120
            +  +   ++++   G +   P+VA+T++   A ++NI        +    KPI    +K 
Sbjct: 1461 LGAVDIVKLLKHTNGINSFTPVVAVTSYYHEATNANI-------FSDVFEKPITLDVLKK 1513

Query: 1121 ILKEYC 1126
            ++ +Y 
Sbjct: 1514 LVSKYA 1519

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,150,313
Number of extensions: 4589202
Number of successful extensions: 17630
Number of sequences better than 10.0: 125
Number of HSP's gapped: 18086
Number of HSP's successfully gapped: 157
Length of query: 1143
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1022
Effective length of database: 39,606,813
Effective search space: 40478162886
Effective search space used: 40478162886
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)