Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196975.702ON1760176081980.0
KLTH0E01056g5.702ON1771170340930.0
SAKL0E14916g5.702ON1779147626670.0
Ecym_40185.702ON1769135623170.0
ZYRO0G06600g5.702ON1820140420900.0
TDEL0B021905.702ON1810140419220.0
AFR286W5.702ON1758139618860.0
KLLA0A00594g5.702ON1748140618690.0
Skud_11.3345.702ON1885136718580.0
YKR095W (MLP1)5.702ON1875141418380.0
Smik_11.3585.702ON1878142417980.0
NCAS0A032005.702ON1788139116400.0
CAGL0G02497g5.702ON1780137914541e-170
NDAI0E050405.702ON1973149313201e-151
TBLA0E017305.702ON1820123411091e-123
Smik_9.205.702ON168214189511e-104
YIL149C (MLP2)5.702ON167914219001e-97
Suva_9.395.702ON168213888912e-96
Skud_9.195.702ON168013858893e-96
NCAS0G002305.702ON173514308332e-89
KNAG0C065905.702ON165113416832e-71
KAFR0D022205.702ON167412356053e-62
NDAI0F002905.702ON15546065624e-57
KAFR0H002105.702ON14549915445e-55
Kpol_1043.705.702ON13214834811e-47
TPHA0E002305.702ON12847403371e-30
TPHA0D046105.702ON11832102341e-18
KNAG0L021405.702ON16081111931e-13
Suva_11.3315.702ON18981771786e-12
Kpol_2001.755.702ON10064681104e-04
CAGL0E03454g4.46ON867285880.21
Suva_8.2518.604ON829430830.65
Skud_15.2582.191ON1648153811.5
Ecym_82585.244ON200123771.5
YKL179C (COY1)1.162ON679357801.7
Kpol_1056.22.572ON11668732.3
KNAG0A033608.604ON756343755.5
TBLA0B002702.33ON22083735.6
KAFR0A061504.217ON65080756.5
KLLA0A03509g7.21ON776141756.6
CAGL0H01144g5.296ON820109756.7
Kpol_1028.226.364ON19971728.1
KNAG0C015301.268ON92880748.5
NCAS0B082401.188ON337137738.7
SAKL0F00594g3.575ON545180739.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19697
         (1760 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...  3162   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...  1581   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1031   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   897   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   809   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   744   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   731   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   724   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   720   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   712   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   697   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   636   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   564   e-170
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   513   e-151
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   431   e-123
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   370   e-104
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   351   1e-97
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   347   2e-96
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   347   3e-96
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   325   2e-89
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   267   2e-71
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   237   3e-62
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   221   4e-57
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   214   5e-55
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   189   1e-47
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   134   1e-30
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    95   1e-18
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    79   1e-13
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    73   6e-12
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    47   4e-04
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    39   0.21 
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    37   0.65 
Skud_15.258 Chr15 complement(453837..458780) [4944 bp, 1648 aa] ...    36   1.5  
Ecym_8258 Chr8 complement(525029..525631) [603 bp, 200 aa] {ON} ...    34   1.5  
YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON} ...    35   1.7  
Kpol_1056.2 s1056 complement(3670..4020) [351 bp, 116 aa] {ON} c...    33   2.3  
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    33   5.5  
TBLA0B00270 Chr2 (49747..50409) [663 bp, 220 aa] {ON} Anc_2.33 Y...    33   5.6  
KAFR0A06150 Chr1 complement(1246051..1248003) [1953 bp, 650 aa] ...    33   6.5  
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    33   6.6  
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    33   6.7  
Kpol_1028.22 s1028 complement(59190..59789) [600 bp, 199 aa] {ON...    32   8.1  
KNAG0C01530 Chr3 (303316..306102) [2787 bp, 928 aa] {ON} Anc_1.2...    33   8.5  
NCAS0B08240 Chr2 complement(1570244..1571257) [1014 bp, 337 aa] ...    33   8.7  
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    33   9.2  

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 3162 bits (8198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1616/1760 (91%), Positives = 1616/1760 (91%)

Query: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60
            MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC
Sbjct: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60

Query: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120
            SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL
Sbjct: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120

Query: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180
            RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA
Sbjct: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180

Query: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240
            RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL
Sbjct: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240

Query: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300
            ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV
Sbjct: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300

Query: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360
            ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV
Sbjct: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360

Query: 361  EQLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLS 420
            EQLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLS
Sbjct: 361  EQLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLS 420

Query: 421  SFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLAR 480
            SFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLAR
Sbjct: 421  SFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLAR 480

Query: 481  QVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQ 540
            QVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQ
Sbjct: 481  QVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQ 540

Query: 541  AKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVI 600
            AKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVI
Sbjct: 541  AKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVI 600

Query: 601  TRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLM 660
            TRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLM
Sbjct: 601  TRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLM 660

Query: 661  TENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLA 720
            TENQELARSKSELVVNVEKEKSSRLLAEER            QENEELNKRGLVLENNLA
Sbjct: 661  TENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLA 720

Query: 721  KQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXX 780
            KQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNE   
Sbjct: 721  KQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTI 780

Query: 781  XXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR 840
                     KERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR
Sbjct: 781  LVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR 840

Query: 841  WYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDV 900
            WYQEKIDALNECLKSTTSDLNSKTQMIQE          KLRDAETKSQSYSVLNQTDDV
Sbjct: 841  WYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDV 900

Query: 901  LTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETL 960
            LTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETL
Sbjct: 901  LTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETL 960

Query: 961  KKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQY 1020
            KKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQY
Sbjct: 961  KKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQY 1020

Query: 1021 QLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASI 1080
            QLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASI
Sbjct: 1021 QLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASI 1080

Query: 1081 TELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDEL 1140
            TELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDEL
Sbjct: 1081 TELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDEL 1140

Query: 1141 KSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTR 1200
            KSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTR
Sbjct: 1141 KSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTR 1200

Query: 1201 SIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDIL 1260
            SIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDIL
Sbjct: 1201 SIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDIL 1260

Query: 1261 TLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXX 1320
            TLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKK                
Sbjct: 1261 TLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANA 1320

Query: 1321 XXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQ 1380
                 LEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQ
Sbjct: 1321 QQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQ 1380

Query: 1381 ESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSXXXXXXXXXXXXXXXHV 1440
            ESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPS               HV
Sbjct: 1381 ESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHV 1440

Query: 1441 KQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNXXXXXXXXXXXXXXXXQ 1500
            KQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSN                Q
Sbjct: 1441 KQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQ 1500

Query: 1501 RLEDXXXXXXXXXXXXXXXXXDIXXXXXXXXXXXXQRTIKRIEEANEILRKRIRLPTEEK 1560
            RLED                 DI            QRTIKRIEEANEILRKRIRLPTEEK
Sbjct: 1501 RLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEK 1560

Query: 1561 INKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMD 1620
            INKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMD
Sbjct: 1561 INKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMD 1620

Query: 1621 EEVAQAKKKAFDEGKQQASMKSMFLXXXXXXXXXXXXXXXXXPDDTTVNSPDRKQLDKPS 1680
            EEVAQAKKKAFDEGKQQASMKSMFL                 PDDTTVNSPDRKQLDKPS
Sbjct: 1621 EEVAQAKKKAFDEGKQQASMKSMFLEKKIAKLEAQAKAAAEKPDDTTVNSPDRKQLDKPS 1680

Query: 1681 PIAEISHQEDKTHIAEELAEGPRXXXXXXXXXXXXGELIDNSSVEPSNDANDSVSTKRPS 1740
            PIAEISHQEDKTHIAEELAEGPR            GELIDNSSVEPSNDANDSVSTKRPS
Sbjct: 1681 PIAEISHQEDKTHIAEELAEGPRPITTSPIPPSSSGELIDNSSVEPSNDANDSVSTKRPS 1740

Query: 1741 EVSLEESPDSKKHKSDDEQS 1760
            EVSLEESPDSKKHKSDDEQS
Sbjct: 1741 EVSLEESPDSKKHKSDDEQS 1760

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 1581 bits (4093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 901/1703 (52%), Positives = 1197/1703 (70%), Gaps = 24/1703 (1%)

Query: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60
            MA+T+ L  P     E  +  ASFL ++   L+ V G V   IAAK REFQQLQAENL+ 
Sbjct: 1    MANTDEL--PRLESAEAAETAASFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRT 58

Query: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120
            SVT+DELRSSS  KLGACKDQ+H LLQE+E++R E+ Q E+ + +  +E+QR++NDS+TL
Sbjct: 59   SVTVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETL 118

Query: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180
            R R EALEQQKQ LE++KNDVA+LLNEKI ++++ +QE + L+QE R LRQQ L+LE ++
Sbjct: 119  RVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESES 178

Query: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240
            RV KSE+L+ KA+ H+LSQ++SL  +N+EWLESQL QKN+EFNAYR  TQS+LA+++Q+L
Sbjct: 179  RVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKL 238

Query: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300
            ET E +LQA+T+T K+LRE N +  ++LE Q + VKKLTD L S KQEFTREMSLK+RLV
Sbjct: 239  ETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLV 298

Query: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360
            +LLEGQV +LKS+LE +++     D + +   + + +EL  KTQQLEESE K+QKLEQTV
Sbjct: 299  DLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTV 358

Query: 361  EQLLSADEKT--ISGSQSLP----DLYADIGILKKQVIHERRQKEFLQNQVEAFVVELEN 414
            + L+S D+++   S +   P    DLY DI +LK+QVIHE+RQKE LQNQVEAFVVELE+
Sbjct: 359  QDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELES 418

Query: 415  KVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQ 474
            KVPMLSSFKDRND+LE++LAETAYML+SISKDK+  A DL+RTK+QI D E QIS LT+Q
Sbjct: 419  KVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQ 478

Query: 475  RSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFK 534
            RSDLARQVQYLLIQ +VR DS GPL+ EE AFV++++   +   + D Q +ISERLVEF+
Sbjct: 479  RSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFR 538

Query: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594
            +IVELQ+KN+DLL T+RNLA++LE+EE + K +++ +END I EAKEAI+TLQ+H QELE
Sbjct: 539  DIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELE 598

Query: 595  TRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIR--ELEELLSAAKREA 652
            +RI+V+T+ERDAYKAIQ  T+    NG     +A A+    +  R  +LE  L   + EA
Sbjct: 599  SRIEVLTKERDAYKAIQPSTN----NGNKITEHALANSKGKMSARVDDLERSLVTEREEA 654

Query: 653  EANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRG 712
            E N+K+L +E QEL R K++L + +EKE++S+ LAEER            QENEELNKR 
Sbjct: 655  EKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRY 714

Query: 713  LVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLT 772
             ++++NL KQDT+TQET+S LI+C+S+LATL +ELK+S+AK   L++  +K  E+ EQLT
Sbjct: 715  HIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLT 774

Query: 773  KERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFM 832
             ERN              ERD LL +++ ++K K+D+LE E SQLRT LS+K  E +DF+
Sbjct: 775  AERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFI 834

Query: 833  STSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYS 892
             T+DSRS+WYQEKID+LNE LK  TS L S+ Q  ++          +L++ ETK+QSY 
Sbjct: 835  QTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYD 894

Query: 893  VLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQD 952
            VLNQTDDVL QT+ALR ELEK++I L+DA+SQ++E++  Y S +E L+A+T A E  K +
Sbjct: 895  VLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNE 954

Query: 953  HTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTA 1012
            H+ +   +KK+ D L      LK Q++NLN+EL +QK   ++ K+E       ++S +  
Sbjct: 955  HSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQET 1014

Query: 1013 LASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNK 1072
            + SMK+ Y+ +L KLT+DLNQQA +ANKAQENYEQELQRHADVSKTISQLREE+QK+KN+
Sbjct: 1015 MNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQ 1074

Query: 1073 VHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL--KD 1130
               L++SI +L+K+L+E++  W  QK+EYE Q    +QRIEDL+ QN LL DQ+ L  KD
Sbjct: 1075 ASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKD 1134

Query: 1131 TDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEI 1190
             +S     E + + RELI++L+RE DILQTKLE++KR E+   +KLE  EQELS AK E+
Sbjct: 1135 PNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEEL 1194

Query: 1191 RKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQE 1250
               Q  S   SIM +E++K+LEQLNQ+NLLRESNITLR+E+Q+K+QR Q+LE  ++ LQ+
Sbjct: 1195 SSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQ 1254

Query: 1251 ALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXX 1310
            +L+PLE+++ +L+RSV AKD QISLI+EE NRWKQRSQDIL K+ER+DPEEHKK      
Sbjct: 1255 SLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELS 1314

Query: 1311 XXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALD 1370
                           LEDRFQRLKKQARERLD A+  QN L+ EL +ARE+Q  +E  L 
Sbjct: 1315 QAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLR 1374

Query: 1371 KEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSXXXXXXX 1430
            KE++  ++LQES++   E+E +  S T+ +L+ ALQKL  A+ +  ++ +  +       
Sbjct: 1375 KEQDVNKALQESLQRV-ESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQ 1433

Query: 1431 XXXXXXXXHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNXXXXXXX 1490
                    H ++LE  L + + EV  LEE K       +E+ ++K +L +HSN       
Sbjct: 1434 SELEKVKSHAEELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKE 1493

Query: 1491 XXXXXXXXXQRLEDXXXXXXXXXXXXXXXXXDIXXXXXXXXXXXXQRTIKRIEEANEILR 1550
                      RL++                 DI            Q+TIKRIEE+NEILR
Sbjct: 1494 AEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILR 1553

Query: 1551 KRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEK 1610
            KRIRLPTEEKINKI+E RK EL++EFEAKLQ+R SELA EKP PA+FTEVMKRHKQE+EK
Sbjct: 1554 KRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEK 1613

Query: 1611 LKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLXXXXXX--XXXXXXXXXXXPD-DTT 1667
            LKAD+ REMDEE+AQ +KKAFDEGKQQASMKSMFL                   P   T+
Sbjct: 1614 LKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTS 1673

Query: 1668 VNSPDRKQLDKPSPIAEISHQED 1690
             NSP     +KP  I E S  ED
Sbjct: 1674 KNSPT----EKPVRILEASPLED 1692

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1476 (42%), Positives = 963/1476 (65%), Gaps = 33/1476 (2%)

Query: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60
            MA  N  + P          ++SFLELD   +  +   V  Q++ K  +F QL+A+NLK 
Sbjct: 1    MAEQNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKY 60

Query: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120
            SVT+DEL+SSS  +  A K Q+  + +  E++R E    E  + +   E+  +  + + L
Sbjct: 61   SVTLDELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLL 120

Query: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180
            +++   L+QQ ++  ++K DV QLLNEKIGD+   Q E ++LLQ  +TLR+Q LELE + 
Sbjct: 121  KSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEV 180

Query: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240
            + +KS +L+ KA+  +L+Q+++LL +NN+WLE +L  K+ EF +YRQR  SEL +    L
Sbjct: 181  QTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSEL 240

Query: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300
             +   +L+    + +TL+ +      +L+ +   +K L D  +  KQEFTREM+LKQRL+
Sbjct: 241  NSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLI 300

Query: 301  ELLEGQVSALKSELE-FKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQT 359
            +LLE Q+ + K+ELE  +N   +++D    E +  IE EL+   ++LE SE K  KLE+T
Sbjct: 301  DLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIE-ELIETKKKLEISESKAVKLEET 359

Query: 360  VEQLLSADEKTISGSQS----------LPDLYADIGILKKQVIHERRQKEFLQNQVEAFV 409
            V++LLS D +  +G+ S          +P L+ DIG+LKK++I ERRQKE LQ QVEAFV
Sbjct: 360  VDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFV 419

Query: 410  VELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQIS 469
            +ELE+KVP+L+SFK+R ++LEKEL++ A ML++ SKDK+E   +L   KS+I D E+QI 
Sbjct: 420  LELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIH 479

Query: 470  ALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISER 529
            +L +QRSDLA QVQ+LLIQV+VR DS+GPL+ EET F+KK++N   +  + DAQ IISER
Sbjct: 480  SLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISER 539

Query: 530  LVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDH 589
            LV F+++VELQ KN +LL+++RNLA++LE EE++ KSK++ +E++T+ EAKEAI+TLQ++
Sbjct: 540  LVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEY 599

Query: 590  IQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDL-----KIRELEEL 644
             + LE+++++I +ERDA+K +    S +G++ G  +VN+  SEN  L     KI+ELE  
Sbjct: 600  NKSLESQLEIIAKERDAFKIL---ASDKGTSNGPSNVNS--SENRHLVLAEEKIKELENH 654

Query: 645  LSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQE 704
            LS+   E+  N+KLL  E   L R++++  VN+EKE+SSR+LAE+R             E
Sbjct: 655  LSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKME 714

Query: 705  NEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKL 764
            N+EL KR   L+ N+ KQD++TQ+TI  LI CKSQL+ L ++L NS ++ +LL +  + L
Sbjct: 715  NDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENL 774

Query: 765  KETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQK 824
            K+ NE L++ERN              ER++LL+++  NF+GK + LE E+S     L  K
Sbjct: 775  KKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAK 834

Query: 825  ATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDA 884
            + E+SD++ST DS+ +WYQEK D LNE L ++   L+SK   IQ           KL ++
Sbjct: 835  SKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEES 894

Query: 885  ETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTT 944
            E + Q+++ LN ++ V +QT+ LR ELEKTRI L DA+SQV++YK +  S++E+ TA+  
Sbjct: 895  EARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKD 954

Query: 945  ALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE 1004
            ALE SK ++T ++ETL KERD   +   +LKDQ++NLN+EL++QK+  E+   ++ +  E
Sbjct: 955  ALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLE 1014

Query: 1005 EVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLRE 1064
            ++K+ ++ L +MK +Y+ ++SK+ EDLNQQ  YAN AQ+NYEQELQ+HADVSK IS LR 
Sbjct: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRA 1074

Query: 1065 EAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFD 1124
            EAQK+K++  +L  +    KK+LE++E  W  Q  +YE +  L+ QRIEDL+ Q+++L+D
Sbjct: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134

Query: 1125 QISL----KDTDS---IPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLE 1177
            QI      K T S   +PI+    +E R L+++L+RE DIL+TKLE++ R+E  L+QKL+
Sbjct: 1135 QIDFLSKGKPTSSEDLMPIS----TETRNLLTSLRREKDILETKLEVSTREEKVLRQKLK 1190

Query: 1178 FTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQR 1237
              E +L  ++ E+ K Q  +   S  +++  +I+ QLNQ+NLLRESNITLRNE Q+  +R
Sbjct: 1191 LIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGER 1250

Query: 1238 NQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297
            +++L+  ++ L   ++PLE+ +  LQ SV  KD QISL  EE  RWKQRSQDIL KYER+
Sbjct: 1251 SRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERI 1310

Query: 1298 DPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTE 1357
            DPEEH+K                     L+ RF+RLK+QA E+L+ A+T Q+TL ++L +
Sbjct: 1311 DPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLND 1370

Query: 1358 ARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINE 1417
             + +++ LE+ L  ++E+ ++L+  I   E+N+    +  ++QL+++  KL + + ++ +
Sbjct: 1371 LKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQ 1430

Query: 1418 MSTAPSXXXXXXXXXXXXXXXHVKQLEEHLAKTQNE 1453
            ++++ +                +K LEE L K + E
Sbjct: 1431 VTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTE 1466

 Score =  119 bits (299), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 88/111 (79%), Gaps = 1/111 (0%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSEL-AGEKPLP 1594
            Q+T +RI E+NE L+KRIRLPTEEKINKI+E ++ EL+ EFEA +Q++  E+   +    
Sbjct: 1554 QKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASN 1613

Query: 1595 ATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
            +  TEV+++HKQ++E LK +M+++ DE++AQ KK+AF+EGKQQASMKS FL
Sbjct: 1614 SNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFL 1664

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/1356 (39%), Positives = 862/1356 (63%), Gaps = 30/1356 (2%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            VA+FLE+D   +  +  ++      K  EF +++A+N++ S++ID L+ +   K+   K+
Sbjct: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77

Query: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKND 140
            Q+  LL ++ + + E  Q E  + +   E+ +   +   LR++ E  +Q  +++ + K D
Sbjct: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137

Query: 141  VAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQK 200
            V +LL EKI D+A  ++E++RLL   + LR+ +++LE   + YKS+EL+ K++  +L Q+
Sbjct: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197

Query: 201  VSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260
            ++L+ +N +WL  +L  KN + N++R++T SEL +  +++ + +  L+ A     TL+ +
Sbjct: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257

Query: 261  NGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKNSP 320
              +  ++L+ +    KKL D L + K+EFTREMSLKQRL++LLE QVS++KS+LE  N+ 
Sbjct: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE--NAY 315

Query: 321  Q-ASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTI-------- 371
            Q A+ +  +T  + Q+ DEL+   + LE ++ +  KLE TV +LLS + K          
Sbjct: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375

Query: 372  ------SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDR 425
                  S   ++P L  DIGILKKQ++ ERRQKE LQNQVE+FVVELE+K+P+L+SFK+R
Sbjct: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435

Query: 426  NDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYL 485
             D+LE+EL +   +L+S +K +D+   +L + K++I + ESQ+ +L  QRSDLA QVQYL
Sbjct: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495

Query: 486  LIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNAD 545
            L+Q++VR D+HGPL+ +E  FVK++++ E+  P  D QGIISERLV+FK+++ELQ+KNA+
Sbjct: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAE 555

Query: 546  LLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERD 605
            LL+T+R LA++LE EE+K + + +++E  T+ EAKEAI++LQ+H+Q LE ++ ++++ERD
Sbjct: 556  LLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERD 615

Query: 606  AYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQE 665
            A+K   S        G     +   S+  D  I ELE+ L     +++ N+KLL  E + 
Sbjct: 616  AFKLANSANKQ----GDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671

Query: 666  LARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTR 725
            L ++KSE+ V +E+E+SS++LAEER            +EN EL+KR   L+  L KQD +
Sbjct: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731

Query: 726  TQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXX 785
            TQ TI E+I  KSQL+ L+++L    ++ + L     +LK  NE LTKE           
Sbjct: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791

Query: 786  XXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845
                +ERD LL+++  N++  I+ LE+++ + R  L ++  E  +   +  S+ +W+Q K
Sbjct: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAK 851

Query: 846  IDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTD 905
            +D+LNE L +    L  KT  I+           KL +AE ++QSYSVL   DD+  + +
Sbjct: 852  VDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIE 911

Query: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965
             LR  LEK  INL DA+SQ+++YK +   ++++   ++ ALE S+ ++   +  L++ER 
Sbjct: 912  TLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK 971

Query: 966  ALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELS 1025
            +L++  A+L DQ+ +LNSELD+QK+  ++ K E  K    ++ ++ +L  +K +Y+ ++S
Sbjct: 972  SLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKIS 1031

Query: 1026 KLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKK 1085
            KL EDL QQA YAN+AQ+NYEQELQ+HADV+KTIS LREE+QK+K+++   + S +E K 
Sbjct: 1032 KLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKS 1091

Query: 1086 SLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL------KDTDSIPINDE 1139
            +LE NE  W  Q  + E+Q SL+ QR E+L+TQNRLL+DQ+ L       D+++      
Sbjct: 1092 ALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAAA---S 1148

Query: 1140 LKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDT 1199
            + +E+RELI TL+RE DIL+TKL+++ R+E  L+Q+L   + EL   + E  K+Q T+  
Sbjct: 1149 MSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPD 1208

Query: 1200 RSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDI 1259
                 E   +I+E+LNQ+NLLRESN+TLRNE ++  +++Q  +  + +LQE L+PLE+ +
Sbjct: 1209 SIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQL 1268

Query: 1260 LTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXX 1319
             +L  ++  +D+QISL+ EE +RWKQRSQDIL KYER+DP EH+K               
Sbjct: 1269 KSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKK 1328

Query: 1320 XXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAEL 1355
                   ++RF++L+KQA ERLD  +  +  + +E 
Sbjct: 1329 SLENLESQERFRKLRKQANERLDEFKAAKAKVESEF 1364

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 79/112 (70%), Gaps = 6/112 (5%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKP--L 1593
            ++T++RI EA E L+KRIRLP+EE+IN++IE R+R LD+EFE +++ R  EL  E P   
Sbjct: 1549 KKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESF 1608

Query: 1594 PATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
                 +++K H++E++KL+A    + DE++A  +KKAF+EGKQQ  MK   L
Sbjct: 1609 VGDTAKLIKEHQEEMDKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLL 1656

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1404 (36%), Positives = 856/1404 (60%), Gaps = 24/1404 (1%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            +++F  +  + LV + G +   +  K+ +F +L+++NL+ +VTIDE+++ SS +    K+
Sbjct: 26   LSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKN 85

Query: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKND 140
            +I +L+++ +++R E  Q ++   Q   ++Q+  N+ ++L+ +   L+Q+++ L+ +K +
Sbjct: 86   EIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKRE 145

Query: 141  VAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQK 200
            V  +L EKI ++ + + E+ + L +++ LRQQ LELE   +  KS+EL+ +++   ++Q+
Sbjct: 146  VVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQR 205

Query: 201  VSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260
            +++L  N++WLE ++  K  +  + R++   EL  ++    +C+ +LQ      + +  +
Sbjct: 206  LTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTK 265

Query: 261  NGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFK--- 317
            N +    L+ +   +K L+D L   KQEF  EMS+KQ+L++LLE QV +L+ EL      
Sbjct: 266  NEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDK 325

Query: 318  -NSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT--ISGS 374
             N    ++    TE++  I+ EL+   +  EESE +  +LE  V++L+  D+    I+ +
Sbjct: 326  DNVELLASGERNTENEKLIQ-ELITLKENFEESERERLRLEALVQELIPGDDSQDDINNT 384

Query: 375  QSLPDL------YADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDV 428
             S   L        D+GILKK++I ER QKE LQ QVE+F+VELE K+P+++SFK+R  +
Sbjct: 385  SSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSM 444

Query: 429  LEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQ 488
            LEKEL + A +LD  S +K++   + +    +++D ES I  LT+QR+DLA QVQ+LL+ 
Sbjct: 445  LEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMN 504

Query: 489  VTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLH 548
            ++V+ DS G LSAEE +F+K++VN ++   + D+Q +ISERLVEF NI  LQ KN +LL 
Sbjct: 505  ISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLK 564

Query: 549  TVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYK 608
            TVR LA +LE+EE+ V  K +  ENDTI EAKEAIV+LQD+   LE++++++T+E DA+K
Sbjct: 565  TVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFK 624

Query: 609  AIQSQTSHEGS--NGGLRDVNAKASENS---DLKIRELEELLSAAKREAEANVKLLMTEN 663
            AI    S  GS  NG L     + + N    + K+R LE  L++   E+  N K+L  E 
Sbjct: 625  AI---CSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEI 681

Query: 664  QELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQD 723
             EL RSK+++ + +EKE+SS+ L EER             EN++L KR   L++   +QD
Sbjct: 682  HELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQD 741

Query: 724  TRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXX 783
            +RT ET++ELI C S+LA L  ++ N   ++ LL +S +  +E   +L++ERN       
Sbjct: 742  SRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVS 801

Query: 784  XXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQ 843
                   ER+  LK+    +K  +DSLE E +  R  L  K  E  D  ++  ++ +WYQ
Sbjct: 802  QLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQ 861

Query: 844  EKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQ 903
            +K+D++    +    +L +KT ++ +          ++ ++E + QSY VL+ ++   + 
Sbjct: 862  DKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSP 921

Query: 904  TDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKE 963
              +LR ELEKT+INL D ++++D+YK L ++T+E+L+ +T      KQ+  ++VETL+ E
Sbjct: 922  ESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNE 981

Query: 964  RDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLE 1023
            +  L +  A L + +  L   L       E  K+   K    +++       +K++Y  +
Sbjct: 982  KSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQ 1041

Query: 1024 LSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITEL 1083
            + KL  DL QQA +AN+AQ NYE+ELQ+ ++VSKTIS+LRE++QK +  +  L+ S  ++
Sbjct: 1042 ILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQV 1101

Query: 1084 KKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTD-SIPINDELKS 1142
            ++ LE+NE  W+AQK+EYE Q   S Q +EDLSTQN LL+DQI L   D S  +N E  +
Sbjct: 1102 RQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGE-TA 1160

Query: 1143 EARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSI 1202
            E RE+++ L+RE DIL TKL +++R+E  L+  L   E EL   K ++ + Q    T S 
Sbjct: 1161 EVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSE 1220

Query: 1203 MIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTL 1262
            +I ++ KI+EQLNQ+NLLRESNITLRN  + ++++N++L+  + +L+E + PLE+++ TL
Sbjct: 1221 LIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTL 1280

Query: 1263 QRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXX 1322
              SV  KD+Q++L  EE NRWK+RSQ+IL K++R+DPE+HK+                  
Sbjct: 1281 HTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKE 1340

Query: 1323 XXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQES 1382
               L+DRF RLKKQA E+L++++  Q TL+ +L E RE++  LE   + E  K   LQE 
Sbjct: 1341 NKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQER 1400

Query: 1383 IKATEENEIENSSATRDQLQDALQ 1406
            + A   N+ E   + + +L DAL+
Sbjct: 1401 LNA-HGNDTETVESVQKELSDALE 1423

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 80/148 (54%), Gaps = 10/148 (6%)

Query: 1539 IKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFT 1598
            +KRI EA E L+KRIRLPTEE+I +++E +K  L+E ++ KL++  S L       +   
Sbjct: 1542 LKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDL- 1600

Query: 1599 EVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLXXXXXXXXXXXXX 1658
                  K+++EK   D++ + + EV   KKKAF+EGKQQA+MKS  L             
Sbjct: 1601 ------KKQLEK---DLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHG 1651

Query: 1659 XXXXPDDTTVNSPDRKQLDKPSPIAEIS 1686
                PD ++  +    + + PS I E S
Sbjct: 1652 KVDSPDKSSSETSSVPKPNLPSKIDEKS 1679

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1404 (35%), Positives = 821/1404 (58%), Gaps = 9/1404 (0%)

Query: 21   VASFLELDREAL--VNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78
            +A FL +  + L  V     ++  +  K++EF  LQ+ NL+   T+DEL++  + K+ + 
Sbjct: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79

Query: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANK 138
            K +   L++E +  +    +LE++ +Q   E+  ++   + ++   +   +QK VL++NK
Sbjct: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNK 139

Query: 139  NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLS 198
             +V +LL EKI ++   + E++ L+ + + LRQQ +E + + +  K   L  K++   + 
Sbjct: 140  QEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVK 199

Query: 199  QKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLR 258
            Q+V +L  +NEWLE ++  K  +   YRQ   +EL    Q +   + D Q    + + L 
Sbjct: 200  QQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLL 259

Query: 259  EQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKN 318
            ++N +   +L+ +   +KKL+DEL + KQEF+REMSLKQ+L++L + Q+ + K EL    
Sbjct: 260  KKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTE 319

Query: 319  SPQASTDAATTES--QSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT---ISG 373
                ST+A   +S  Q++  D+L    QQLEES  +  +L+  V +++   E+     + 
Sbjct: 320  EKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTA 379

Query: 374  SQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKEL 433
            + S+P LY DIG+LKKQ+I ER QKE LQ Q+E+FVVELE KVP+++S K+R+  LEKEL
Sbjct: 380  NVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKEL 439

Query: 434  AETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRG 493
            ++ A +L+  S +K+    +L+    +I+ LE     L +QRSDLARQVQ+LL   T++ 
Sbjct: 440  SDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQN 499

Query: 494  DSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNL 553
            DS GPL+A+E AF+KK++  EN   + D+Q II+ERLVEFK+I  LQ +N +LL T R L
Sbjct: 500  DSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTL 559

Query: 554  ANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQ 613
            A++LE EE+    + +++E  TI EAKEAI+TLQ+   E+E+++  I +ERDAYKAI SQ
Sbjct: 560  ADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQ 619

Query: 614  TSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSEL 673
            TS    N G  D    + EN +L I+ LE+ LS    E   N +LL  E + L +SK++L
Sbjct: 620  TSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQL 678

Query: 674  VVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQETISEL 733
             ++ EKE+SSR LAE+R             EN EL +R   L++ L+KQ+ R  ET+++ 
Sbjct: 679  TISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKY 738

Query: 734  IDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXXXXXXKERD 793
            I C+S+L+ L A   N  A+++LL +S   L+   ++++ ERN              ER+
Sbjct: 739  ISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERE 798

Query: 794  TLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECL 853
             LLK+S  + K  I  LE + S+L+T +S K  E+        ++++W+QEKID ++   
Sbjct: 799  NLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDA 858

Query: 854  KSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEK 913
                 +L +KT  + +          K+ +++++  SY  LN   +  T    LR +LEK
Sbjct: 859  GKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEK 918

Query: 914  TRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAV 973
            T I LK A+SQ +E+K + ++ +ETL  ++   E   +      E    E+  L    + 
Sbjct: 919  TMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSN 978

Query: 974  LKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQ 1033
            LK  +  LN+E   QKN  E  K+E  K    ++S++ +L  +K +Y  +L +L +DL Q
Sbjct: 979  LKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQ 1038

Query: 1034 QAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESC 1093
            Q  YAN AQ+NYE+ELQ+HA+VSK ISQLR E Q  ++++  L+AS  + K+ LE  E  
Sbjct: 1039 QTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKS 1098

Query: 1094 WAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARELISTLKR 1153
            W  QK E +       ++++++S+QN+LLF Q+ L         ++L   + EL+ +L+R
Sbjct: 1099 WYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRR 1158

Query: 1154 ECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQ 1213
            E DIL+TKL ++KR+E  L QK    E EL+ A+ ++ K Q      S + +++  I+EQ
Sbjct: 1159 ERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQ 1218

Query: 1214 LNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQI 1273
            LNQ+NLLRESN+TLRN +    ++N DL+  +  LQ  + PL +++   ++S+  KD++I
Sbjct: 1219 LNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRI 1278

Query: 1274 SLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRL 1333
             L+ +E +RWK+RS DIL ++E++DPEE++K                     L DRF RL
Sbjct: 1279 ILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRL 1338

Query: 1334 KKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIEN 1393
            KKQA E+L+ ++  Q  L+AE+ E + ++  +E+ L + + K  +L E +    ++E  N
Sbjct: 1339 KKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNL-EKLLTERDSESAN 1397

Query: 1394 SSATRDQLQDALQKLEDAQARINE 1417
            +   R +L DAL++ ++ + ++ E
Sbjct: 1398 NEDLRHELDDALERCKEIEVKLGE 1421

 Score = 76.3 bits (186), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (66%), Gaps = 11/106 (10%)

Query: 1541 RIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEV 1600
            RI+EA E L+KRIR+PTEE+I K+++ RK EL+EEF+ +L++   +  G           
Sbjct: 1533 RIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDA-------- 1584

Query: 1601 MKRHKQEVEK-LKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
              + ++E++K L+++ + +  E +A  KKKAF+EGKQQA+MKS  L
Sbjct: 1585 --KEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLL 1628

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1396 (35%), Positives = 815/1396 (58%), Gaps = 45/1396 (3%)

Query: 50   FQQLQAENLKCSVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDA- 108
            F+QL+AEN +  V+I    S+  H + A +++   L  E  A         Q+R Q +A 
Sbjct: 50   FRQLEAENTRLKVSIGAAESACEHGVEALRERQQQLAAEAGA---------QQRGQGEAG 100

Query: 109  ERQRSINDSDTLRARNEALEQQKQVLEAN--KNDVAQLLNEKIGDIATLQQETERLLQEA 166
               R+   S   R + +  E +++V   +  + D+A+LL EKI D+   QQE ER+L   
Sbjct: 101  SAGRAGGPSVPERVQQQLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVN 160

Query: 167  RTLRQQNLELEGQARVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYR 226
            + LR+  +ELE   +  +S+ L+ +A+  +L Q+++L+ +N EW   QLN+KN + N+YR
Sbjct: 161  KELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYR 220

Query: 227  QRTQSELASVSQRLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAK 286
            ++T  E+ S    L   + +L+     +  LR +NG+   +L+      K+LTD L S K
Sbjct: 221  EKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEK 280

Query: 287  QEFTREMSLKQRLVELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQL 346
            QEF REM+LKQRL+ELL GQV+ +K +LE K    A     +   + ++ ++L    ++L
Sbjct: 281  QEFAREMALKQRLIELLNGQVATMKQDLE-KAYDVAKNGGMSDSERERLLNDLFDTKKKL 339

Query: 347  EESELKIQKLEQTVEQLLSADE--------------KTISGSQSLPDLYADIGILKKQVI 392
            E S+  + +LE T+++LL  D                + SG  ++  +Y D+  L+KQ++
Sbjct: 340  ELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLV 399

Query: 393  HERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAA 452
             ERR KE LQ QVE+FVVELE+K+P+L+SFK R + LEK+L     +L++ ++++DE   
Sbjct: 400  QERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVV 459

Query: 453  DLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVN 512
             +K+ K+++ D E+Q+  L QQRSDLARQVQ LLI ++VR DS GPL+AEE  FVKK+ +
Sbjct: 460  QIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQS 519

Query: 513  MENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIE 572
              ++    D Q IIS RLVEFK++VELQ KNA+LL+ +R LA +LE EE K +SK +++E
Sbjct: 520  CRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLE 579

Query: 573  NDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRD-VNAKAS 631
             +T+ EAKEAI++LQ+H+Q LE +++ +T ERD++K + S    EG N  L + V A A 
Sbjct: 580  QNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVS----EGKNNSLPNPVGAAAL 635

Query: 632  ENSDL--KIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEE 689
            +  ++   I  LE  L A   E+E + K+L  E + L +S S+L + +E+E+SSR LA+E
Sbjct: 636  QPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADE 695

Query: 690  RXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKN 749
            +             EN +L  R   L+  L +QDTR Q TI E +  KS+L ++S++L  
Sbjct: 696  KLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTI 755

Query: 750  SIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDS 809
              ++ + L      LK+ NE L K+ N+            KERD+L++++   ++ +I+ 
Sbjct: 756  LQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEE 815

Query: 810  LEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQE 869
            L+ E+S  +  L +K  E  +  S+S ++ +W+Q K+D+L E L S+   L +KT  +  
Sbjct: 816  LDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDA 875

Query: 870  XXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYK 929
                      KL  A    Q  S++ ++D   ++  +L  +L++    L  A+S+++ YK
Sbjct: 876  LKARLNSSTSKLEPASMDHQQSSLVLESDHA-SRVQSLSKDLDEANRKLSSAYSEIERYK 934

Query: 930  GLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQK 989
                +T E  +    A++ +K        +L+ E   L++D A+  D++  L  EL+ ++
Sbjct: 935  AASNAT-ERPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRRE 993

Query: 990  NLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQEL 1049
                T + E  +    + ++K  +   K  YQ ++++L  DL +Q    N+A+  Y+  L
Sbjct: 994  ATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTAL 1053

Query: 1050 QRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSS 1109
            Q+ A++S+ I  LR+ ++ +K+++   +++  E +K LE NE  W  QK + E    L+ 
Sbjct: 1054 QKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAH 1113

Query: 1110 QRIEDLSTQNRLLFDQI---SLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAK 1166
            QRIE+LSTQNRLL+DQI   S   + S+  + ++ S+ARELI TL+RE DIL+TK++++K
Sbjct: 1114 QRIEELSTQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSK 1173

Query: 1167 RDESNLKQKLEFTEQELSVAKSEIRKSQ--VTSDTRSIMIEENSKILEQLNQVNLLRESN 1224
            R+E  L+Q+LE T+ EL   ++++ +S+  VT  T S   +E  ++ E+LNQ+NLLRE N
Sbjct: 1174 REEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQE--ELFEKLNQLNLLREHN 1231

Query: 1225 ITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWK 1284
            ++LRNE ++ S+ N+ L+  +  LQE ++P+E  I +L  ++  K+++++L+ EE +RWK
Sbjct: 1232 MSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWK 1291

Query: 1285 QRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNA 1344
            QRSQDIL KYER+DPEE++K                      ++RF++L+KQA ERLD  
Sbjct: 1292 QRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEF 1351

Query: 1345 RTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDA 1404
            +  +  + +EL  A   +  LE  L + REK  SL+  +  TE    E+ +    +L++ 
Sbjct: 1352 KAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQL--TERPASEDDNPVSHELEET 1409

Query: 1405 LQKLEDAQARINEMST 1420
              KL+DA+  IN + +
Sbjct: 1410 KTKLQDAENTINMLKS 1425

 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 76/112 (67%), Gaps = 2/112 (1%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKP--L 1593
            Q+T++RI EA E L+KRIRLP+EE+IN++IE +++ L++EF  K+      L  E P  +
Sbjct: 1545 QQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSI 1604

Query: 1594 PATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
             +   +++K H++E+ +LK D+  + + ++ Q KKKAF+EG+QQ  MK   L
Sbjct: 1605 ASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLL 1656

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1406 (34%), Positives = 839/1406 (59%), Gaps = 69/1406 (4%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            VA FL++D++ + +++  V  +I  K+ + ++ ++ENL+ + T+D+L+S S +KL + K 
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQ-------QKQV 133
             I  L + +E  + E L  E+       E++R I  +  +  R   LEQ       QK++
Sbjct: 70   HISQLAKALEDGKDERLHFEE-------EKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122

Query: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEA----RTLRQQNLELEGQARVYKSEELK 189
             +A+K D+A+ LNEKI ++++    T+  L EA    + LRQ+ +  E + +  ++ EL+
Sbjct: 123  ADASKQDIAESLNEKIEELSS----TKAKLNEAQGANKELRQKVVNTETELQTQQALELR 178

Query: 190  HKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQA 249
             K++  ++ Q+++LL  NN+WL +QLN K  + N +R+ T SEL     ++   E +L+ 
Sbjct: 179  SKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEI 238

Query: 250  ATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSA 309
            A  + + L++       +LE +    K++ DE   +KQE T+EMSLKQR+++ LE  + +
Sbjct: 239  ARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMES 298

Query: 310  LKSELEF-KNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLS--- 365
            LK E++  KN+  +S    T + + ++ +EL     +L+ SE    KL++T+++L S   
Sbjct: 299  LKKEMDATKNNMDSS--YFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIK 356

Query: 366  -----------ADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELEN 414
                       + EK++S    +P LY D+G+LKKQ++ E+RQK+ L+ QVEAFVVELE+
Sbjct: 357  LEDSEVGNTTASSEKSVS---VIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413

Query: 415  KVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQ 474
            K+P+L+SFK+R+++LE+EL E   +L+S  KD+D+ ++ L   K+ ++  E+QI++L++Q
Sbjct: 414  KIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQ 473

Query: 475  RSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFK 534
            R DLA Q+QYLL+  +++ +  GPLSAEE  FVK + N +      D QGII++RLVEF+
Sbjct: 474  RVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFR 533

Query: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594
            ++VELQ KN++LL T+RNLA++LE  E + KS+ + +E++T+ EAKE I+TL DH Q LE
Sbjct: 534  SVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLE 593

Query: 595  TRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEA 654
             ++ ++++ERDAYKA+ S  +  G+N   + +   + +N D K+++LE  L+A  +EAE 
Sbjct: 594  NQLVILSKERDAYKAL-SVNASSGTNTP-KAITYPSPDNDD-KVKDLETRLTAVIQEAEN 650

Query: 655  NVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLV 714
            N K   +EN  L +   E+ +N E EK+SR LAE+R            ++ EEL KR   
Sbjct: 651  NAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSD 710

Query: 715  LENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKE 774
            L++ L KQD RTQET+  LI  KS L+++ +EL    +++  +    ++LK  NE+ +KE
Sbjct: 711  LQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKE 770

Query: 775  RNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMST 834
              E            +ER+ LLK++ +++K K+  LE E+S     L +     +   S 
Sbjct: 771  SVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASN 830

Query: 835  SDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVL 894
             + +  W+QEKID L        + L  K   +Q+          KL++AE ++QSY++L
Sbjct: 831  KEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTML 890

Query: 895  NQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHT 954
            +  DD     + LR ELEK  + L D++SQ++ +K L   + +++  ++ A E ++++  
Sbjct: 891  SNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQ 950

Query: 955  IEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEV---KSNKT 1011
              + TL+ ER+ L +   +L DQ+ +LN+E+ +QK+  +T   E N   EE+   +  K 
Sbjct: 951  KTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT---ERNATMEEISKLQMVKE 1007

Query: 1012 ALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKN 1071
            ++   K  Y+ +++ + +DL  Q  YAN++Q +YE ELQ+HADVSKTI+ LR EAQ +K+
Sbjct: 1008 SVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS 1067

Query: 1072 KVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL--- 1128
             + +L+       ++L+ +E  W  QK EYE + S+  QR+++LSTQN+LL+DQI L   
Sbjct: 1068 DLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNK 1127

Query: 1129 -KDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAK 1187
             +D D+         ++ +L+ +L+RE D+L+TKLE+A  +++ LKQ+L+  + E+    
Sbjct: 1128 TEDRDN-------SHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLN 1180

Query: 1188 SEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEE 1247
            +++ + + +S   + ++E+   I+++L+Q++LLRESN+TLR+E     +   +L+  ++E
Sbjct: 1181 TQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQE 1240

Query: 1248 LQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXX 1307
              + L PL++ I +LQ  +  K++++    EE  RWK RSQDIL KYER+DPEEH K   
Sbjct: 1241 CNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKE 1300

Query: 1308 XXXXXXXXXXXXXXXXXXL-------EDRFQRLKKQARERLDNARTTQNTLNAELTEARE 1360
                              +       E +FQR++ QAR+RL+ ++  + +L++E+ +  E
Sbjct: 1301 EINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINE 1360

Query: 1361 SQKALEDALDKEREKTRSLQESIKAT 1386
            ++  +E  L K +   + L+E ++  
Sbjct: 1361 AKSQVEADLGKCKTACKELEERLQVV 1386

 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPA 1595
            ++T+++I+ A E L+KRIRLPT++KI+KI+E RK  L+E FE K+ ++  +LAGE    A
Sbjct: 1562 KQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDA 1621

Query: 1596 TFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
                 +++H+ E+  LK  M+++ + ++A+ K+K+F+EGKQQ S+K  FL
Sbjct: 1622 I---TLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFL 1668

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1367 (34%), Positives = 827/1367 (60%), Gaps = 11/1367 (0%)

Query: 8    SQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDEL 67
            +Q E   +E  + +ASF +   E + ++   +  ++  K+ +F +L++ENL+ +V+ DEL
Sbjct: 11   TQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDEL 70

Query: 68   RSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEAL 127
            +++S  K+   K ++ ++L++ + +R E      +      E+ +  N+ ++++ +   L
Sbjct: 71   KTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDL 130

Query: 128  EQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEE 187
             ++K+ +++N+    ++L+E++ ++   + E  R   E R LR   +ELE + + Y + +
Sbjct: 131  TEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITND 190

Query: 188  LKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDL 247
            L  +++  + +Q+++LL +N +WLE +L+ K+ ++ +YRQRT + ++ +   L   + D 
Sbjct: 191  LNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDF 250

Query: 248  QAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQV 307
            Q        L+++N +  + L+ +   +K L+D L + KQEF+ E++LKQRL++LLE Q+
Sbjct: 251  QLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQL 310

Query: 308  SALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSAD 367
            +A+K EL  K+  ++ +   T++   ++  E     + L  ++ K+ + E    +L S  
Sbjct: 311  NAVKEEL--KSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSIT 368

Query: 368  EKTISGSQSLPDLYA-DIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRN 426
            E+T   S +L    + D  +LKKQ I E+R KE LQNQ+E+F+VELE+KVP+++SFK+R 
Sbjct: 369  EETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERT 428

Query: 427  DVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLL 486
            D+LE EL  +A +L+  S +K+    +L     +I   E+ I  LT+QR DL RQVQYLL
Sbjct: 429  DMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLL 488

Query: 487  IQVTVRGDSHGPLSAEETAFVKKVVNMENTQP-DGDAQGIISERLVEFKNIVELQAKNAD 545
            I  +V  DS GPL  EE  F++ ++  +N+   + D+Q I++ RLVEF+N++ELQ KN +
Sbjct: 489  ITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTE 548

Query: 546  LLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERD 605
            LL   RNLA++LE+ E K K     IEN TI EAKEAI++LQ     LE++++ + RER+
Sbjct: 549  LLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERERE 608

Query: 606  AYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQE 665
              K+  S+ +   +N  ++ +  K     + ++++L+  +S   RE+  N+ LL  E Q+
Sbjct: 609  TLKSSISKQASSFNNSVIQQL-TKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQD 667

Query: 666  LARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTR 725
            +  SKS++ + + KEKSSR+LAEER             EN++L KR   L+++++KQD++
Sbjct: 668  IYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSK 727

Query: 726  TQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXX 785
            T ET++E I CKS+L+     L N   ++ L   S + LK+  ++L+ E+          
Sbjct: 728  THETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQL 787

Query: 786  XXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845
                KER+ LL ++  + + KI+ +E   ++L+   S K   +      + S+  WYQ K
Sbjct: 788  QTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNK 847

Query: 846  IDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTD 905
            I+ L +   S  + +N K   I++          ++ + + +  +Y+V+++T       D
Sbjct: 848  IETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDET----INDD 903

Query: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965
            +LR ELE ++INL +A+SQ+ EYK LY ST ++L  M + L+ S +  + ++++L  E+ 
Sbjct: 904  SLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKI 963

Query: 966  ALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELS 1025
             L +  ++LK+Q  NLN+ELD QKN +E  K E  K    +++N   + ++K +Y+ +LS
Sbjct: 964  NLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLS 1023

Query: 1026 KLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKK 1085
            K+ +DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   ++ +V +L  S +EL+ 
Sbjct: 1024 KIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELEN 1083

Query: 1086 SLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEA- 1144
             L+ENE  W +QKQ    Q  LS+ RIEDLS+QN+LL++QI L       + D       
Sbjct: 1084 ILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTL 1143

Query: 1145 -RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIM 1203
              +++ TL+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S+V +D RS +
Sbjct: 1144 NNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSI 1203

Query: 1204 IEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQ 1263
            ++++  I+E+LNQ+NLLRESNITLRNEL+  S++N++L+  + +L+E + P+E+++  L+
Sbjct: 1204 VQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALK 1263

Query: 1264 RSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXX 1323
             S+  K+++I L  EEV+RWK+RSQDIL K++++   +++K                   
Sbjct: 1264 YSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQG 1323

Query: 1324 XXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALD 1370
               E+RF RL++QA+E+L  ++ TQ TL  +L E ++++ ALE +L+
Sbjct: 1324 TEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLN 1370

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 34/131 (25%)

Query: 1549 LRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEV 1608
            L+KRIRLPTEEKI+KIIE +K +L++EF  KL+++   ++G + + A   + ++   QE 
Sbjct: 1529 LKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEK 1588

Query: 1609 EK----------------------------------LKADMKREMDEEVAQAKKKAFDEG 1634
            +K                                  ++A ++ E+++E+   KKK+F+EG
Sbjct: 1589 QKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEG 1648

Query: 1635 KQQASMKSMFL 1645
            KQQA+MK+  L
Sbjct: 1649 KQQATMKTTLL 1659

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1414 (34%), Positives = 843/1414 (59%), Gaps = 29/1414 (2%)

Query: 19   DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78
            +A+ASF     E + +  G V   +  K+ +F +L++ENLK +V+ DEL++SS  K+   
Sbjct: 22   NAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGL 81

Query: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANK 138
            K ++ ++++E + +R E      +    + E+ +  ++ + ++ + + L ++K+  ++N+
Sbjct: 82   KTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQ 141

Query: 139  NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLS 198
                ++L+E++ +I  ++ E  R   E + LR   ++LE + + Y + +L  + +  + +
Sbjct: 142  QRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKT 201

Query: 199  QKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLR 258
            Q+++LL +NN+WLE +L  KN ++ +YRQ+T   +  +   L     D Q        L+
Sbjct: 202  QELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLK 261

Query: 259  EQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELE-FK 317
            ++N +    L+ +   +K L+D L S KQEF+ EMSLKQRLV+LLE Q++A+K EL   +
Sbjct: 262  QKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIR 321

Query: 318  NSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISGSQSL 377
                A   A  ++ Q+   ++L      L+E +L  +KL Q  ++ L     T    +  
Sbjct: 322  ELNTAKVIADDSKKQTPENEDL------LKELQLTKEKLAQCEKECLRLSSITDEADEDN 375

Query: 378  PDLYA----DIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKEL 433
             +L A    D   LKKQ+I ERR KE LQNQ+E F+VELE+KVP+++SFK+R D+LE EL
Sbjct: 376  ENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENEL 435

Query: 434  AETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRG 493
               A +L+  S +K+    +L     ++ + E+ +  LT+QR DL RQ+QYLLI  +V  
Sbjct: 436  NNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSN 495

Query: 494  DSHGPLSAEETAFVKKVVNMEN-TQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRN 552
            DS GPL  EE  F++ ++  ++ T  + D+Q +++ERLVEFKNI++LQ KNA+LL  VRN
Sbjct: 496  DSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRN 555

Query: 553  LANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQS 612
            LA++LE++E+K K   + IE++T+ EAKEAI+TL+    +LE+RI     E    +  + 
Sbjct: 556  LADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI-----EELQKELEEL 610

Query: 613  QTSHEGSNGGLRDVNAK--ASENSDL--KIRELEELLSAAKREAEANVKLLMTENQELAR 668
            +TS    +    +V  K       DL  ++++L+  +S   RE+  N+ LL  E Q+L  
Sbjct: 611  KTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYD 670

Query: 669  SKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQE 728
            SKS++ + + KEKSSR+LAEER             EN++L KR   L+N + KQD++T E
Sbjct: 671  SKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHE 730

Query: 729  TISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXXXXX 788
            T++E + CKS+L+ +  EL N   ++ L     + LK+   +L+ E++            
Sbjct: 731  TLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTL 790

Query: 789  XKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDA 848
             KER+ LL+++  + + KID LE  +S+L+   SQK   +      ++S   WYQ KI+A
Sbjct: 791  QKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEA 850

Query: 849  LNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTDALR 908
            L +  +S  + ++SK   I++          ++ + + +  +Y+V+++T       D+LR
Sbjct: 851  LKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET----INDDSLR 906

Query: 909  SELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALS 968
             ELEK++INL DA+SQ+ EYK LY +T ++L    + L+ S +D T +++ L  E+ +L 
Sbjct: 907  KELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLE 966

Query: 969  NDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLT 1028
            +  ++LK+Q+ NLN+ELD QK  +E  K +  K    +++N   + ++K +Y+ +LSK+ 
Sbjct: 967  DKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQ 1026

Query: 1029 EDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLE 1088
             DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   +K +V +L  S  +L+ +L+
Sbjct: 1027 NDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALK 1086

Query: 1089 ENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEA-REL 1147
            ENE  W++QK+    Q  LS+ RIEDLS+QN+LL+DQI +       +N+         +
Sbjct: 1087 ENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNI 1146

Query: 1148 ISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEEN 1207
            + TL+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S+V  +  S +I+++
Sbjct: 1147 LITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQH 1206

Query: 1208 SKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVG 1267
              I+E+LNQ+NLLRESNITLRNEL+  + + ++L+  +++L++ + P+E+++  L+ S+ 
Sbjct: 1207 DDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQ 1266

Query: 1268 AKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLE 1327
             K++++ L  EEV+RWK+RSQDIL K+E++   +++K                      E
Sbjct: 1267 EKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAE 1326

Query: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATE 1387
            ++F RL++QA+ERL  ++ +Q++L  ++   R+++  LE++L +   +   LQ +  A  
Sbjct: 1327 EKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQG 1386

Query: 1388 ENEIENSSATRDQLQDALQKLEDAQARINEMSTA 1421
             N++E   A R   +DA +   + QA++ E +T+
Sbjct: 1387 NNQLE---AIRKLQEDAEKASRELQAKLEESTTS 1417

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 76/146 (52%), Gaps = 38/146 (26%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKR---------------------ELD- 1573
            Q   ++I EA E L+KRIRLPTEEKINKIIE +K                      E+D 
Sbjct: 1515 QEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDV 1574

Query: 1574 ---EEFEAKLQQRTSELAGE--KPLPATFTEVMKRHKQEV-----EKLKAD----MKREM 1619
               ++ EAK+Q++  EL  E  K L     +V   H   +     +KL+A+    ++ E 
Sbjct: 1575 VLRKQLEAKVQEKQKELENEYNKKLQEELKDV--PHSSHISDDERDKLRAEIESRLREEF 1632

Query: 1620 DEEVAQAKKKAFDEGKQQASMKSMFL 1645
            + E+   KKK+FDEGKQQA MK+  L
Sbjct: 1633 NNELQAIKKKSFDEGKQQAMMKTTLL 1658

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1424 (33%), Positives = 833/1424 (58%), Gaps = 64/1424 (4%)

Query: 20   AVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACK 79
            A+ASF     E + +++  +   +  K+ +F +L++ENL+ +V+ DEL+++SS K+   K
Sbjct: 23   AIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLK 82

Query: 80   DQIHSLLQEIEAVRAENLQLEQRRAQCDA------ERQRSINDSDTLRARNEALEQQKQV 133
             ++ +L+++ + +R E      R   CD       E+ +  N+ ++++ R + L ++K+ 
Sbjct: 83   KEMENLIKQNDGIRKE------RDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKE 136

Query: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKAD 193
            L+ N+    ++L+E++ ++   + +  R   E + LR   ++LE + +   + +L  +A+
Sbjct: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196

Query: 194  FHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKT 253
              + +Q++++L + N+WLE +L  KN ++ +YR++T   +  +   L     D Q     
Sbjct: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256

Query: 254  IKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSE 313
               L ++N +    L+ +   +K L+D L+S KQEF+ E++LKQRLV+LLE Q++A+K E
Sbjct: 257  NDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316

Query: 314  LEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISG 373
            L+     + S D+                 + + E E  +++L+ T E+L     + I  
Sbjct: 317  LDSTRGLETSNDSK----------------KHMSEKEDLVKELQLTKEELAQCKSECIRL 360

Query: 374  SQSLPDL-----------YADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSF 422
            S  + +             +D  +LKKQ+I E+R KE LQNQ+E+F++ELE+KVP+++SF
Sbjct: 361  SSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF 420

Query: 423  KDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQV 482
            K+R D LE EL   A +L+  S +K+    +L     +++  E+ I  L +QR DL RQV
Sbjct: 421  KERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV 480

Query: 483  QYLLIQVTVRGDSHGPLSAEETAFVKKVV-NMENTQPDGDAQGIISERLVEFKNIVELQA 541
            QYLLI  +V  DS GPL  EE  F++ ++ N  +T  + D+Q I++ERLVEF++I+ELQ 
Sbjct: 481  QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE 540

Query: 542  KNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVIT 601
            KN +LL  VRNLA++LE+ E + K   + IE++TI EAKEAI+TL+   ++LE++++ + 
Sbjct: 541  KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELE 600

Query: 602  RERDAYKAIQS--QTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLL 659
            +E +  KA+ S  +TSH   N  ++ +N +   N + +I++L+  +S   RE+  N+ LL
Sbjct: 601  KECENSKALLSNEETSH--LNSTIQQLN-ETKRNLECQIQDLQSNISQITRESTENMSLL 657

Query: 660  MTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNL 719
              E Q+L  SKS++ + + KEKSSR+LAEER             EN++L KR   L++ +
Sbjct: 658  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTI 717

Query: 720  AKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXX 779
             KQD++TQET++E I CKS+L     EL N   ++ L   S Q LK+  ++L+ E+    
Sbjct: 718  LKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLR 777

Query: 780  XXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRS 839
                      KER+ LL ++  +++ KID LE   ++L+   S K   +      ++S  
Sbjct: 778  IMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSI 837

Query: 840  RWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDD 899
             WYQ KI+ L +  +S    +N K   I++          ++ + + +  +Y+V++ T  
Sbjct: 838  EWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGT-- 895

Query: 900  VLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVET 959
                 D+LR ELEK++I+L DA+SQ+ EYK LY +  ++L  M +  E S +D +  ++ 
Sbjct: 896  --INDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKN 953

Query: 960  LKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQ 1019
            L  E+ +L    ++LK+Q+ NLN+ELD Q   ++  K E  K    +++N   + ++K +
Sbjct: 954  LTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSE 1013

Query: 1020 YQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEAS 1079
            Y+ +LSK+ +DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   ++ +V++L  S
Sbjct: 1014 YESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLS 1073

Query: 1080 ITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPIND- 1138
              +L+ +L+ENE  W +Q++    Q   S+ RIEDL++QN+LL+DQI L  T    + D 
Sbjct: 1074 RNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDT 1133

Query: 1139 ELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSD 1198
              K     ++ +L+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S++  +
Sbjct: 1134 NDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEE 1193

Query: 1199 TRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLEND 1258
             R  +I+++  I+E+LNQ+NLLRESNITLRNEL+  ++  + L+  +++L++ + P+E++
Sbjct: 1194 KRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESE 1253

Query: 1259 ILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXX 1318
            +  L+ S+  K++++ L  EEV+RWK+RSQDIL K+ ++   +++K              
Sbjct: 1254 LAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDE 1313

Query: 1319 XXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRS 1378
                    E+RF RL++QA+ERL  ++ + +TL  ++ + + ++  LE +LD    K   
Sbjct: 1314 KTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIE- 1372

Query: 1379 LQESIKATEENEIENSSATRDQLQ-DALQKL-EDAQARINEMST 1420
                       E+EN+ A +D  Q DA+++L +DA+    E  T
Sbjct: 1373 -----------ELENAKAEQDNNQLDAIKRLQQDAENSSKEFKT 1405

 Score = 80.1 bits (196), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 79/138 (57%), Gaps = 30/138 (21%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATF 1597
             + RI EA E L+KRIRLPTEEKI+KIIE ++ +L++EF+ K+++R   L+    +  TF
Sbjct: 1513 VVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTF 1572

Query: 1598 ---TEVMKRHKQ-----------------------EVEKLKAD----MKREMDEEVAQAK 1627
                E+  + KQ                       E ++L+A+    M++E+D E+   K
Sbjct: 1573 QKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIK 1632

Query: 1628 KKAFDEGKQQASMKSMFL 1645
            KK+F+EGKQQA MK+  L
Sbjct: 1633 KKSFEEGKQQAMMKTTLL 1650

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1391 (32%), Positives = 791/1391 (56%), Gaps = 26/1391 (1%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            + SFL +  E L  +  ++ + +  K+ +F +LQ+++LK  V+++EL+ +S  ++   + 
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDS---DTLRARNEALEQQKQVLEAN 137
            Q+  L   IE   + + + ++   +   E++ S   S   D LRA  + ++++   L+  
Sbjct: 76   QLEDL---IEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQ 132

Query: 138  KNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQL 197
              D  +LL+ KI      ++ T +L  + R    +  +LE + +  K  +   +   ++L
Sbjct: 133  NQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKL 192

Query: 198  SQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTL 257
            SQ +  ++   E LE++L  K+ + + Y    Q+E+ ++ +++ T E +          L
Sbjct: 193  SQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDAL 252

Query: 258  REQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFK 317
            +++N    S L  +   V++LT+   + K+E  +E+SLKQ ++++L+ QV  L+ +    
Sbjct: 253  KKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDY--- 309

Query: 318  NSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQK-LEQTVEQLLSADEKTISGSQS 376
             +   +T     ++  +   E+    Q+L E+E ++ K LE+     +  +  T+S  Q 
Sbjct: 310  -TRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTESSTLSNQQQ 368

Query: 377  LPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAET 436
                  D+  +KK++I ER QKE LQNQVE F+VELE KVP ++SFK R D+LEKEL + 
Sbjct: 369  -----EDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDA 423

Query: 437  AYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSH 496
              +L+++ ++K++   +L   +   + ++ +  +LT+QR+DLA Q+QY+LI  +V+ DS+
Sbjct: 424  TLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSN 483

Query: 497  GPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQ 556
            GPLSAEE  F++ +++ E+ +   D+Q +ISERLV F+NIVELQ KN DLL +VR LA +
Sbjct: 484  GPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARK 543

Query: 557  LETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAI-QSQTS 615
            LE +E   +S ++ +E   I EAKEAI++LQ +  +LE +I  +  E D YK++ +  T 
Sbjct: 544  LELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTK 603

Query: 616  HEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVV 675
             E  +  L +      EN+DL I+ELE  L+ ++ E+      L  E  ++ R+ S+ V 
Sbjct: 604  VETEHLRLNE------ENTDL-IKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVK 656

Query: 676  NVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQETISELID 735
              + E++SR LAE+R             ENE+L KR  +L++   KQD RTQET+ E + 
Sbjct: 657  ECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVS 716

Query: 736  CKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXXXXXXKERDTL 795
            CK  L+    EL    ++ N+  T+ + LK+    ++KERNE             ER+ +
Sbjct: 717  CKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQI 776

Query: 796  LKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKS 855
               +  + + ++D++E E+  +   L  K  E+ +  S   S   WYQ KIDA+ E   +
Sbjct: 777  FNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDA 836

Query: 856  TTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTR 915
               +L  KT  I E           L+ +E++  +Y VLN +D+V T+ + L++ELEK++
Sbjct: 837  YQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSK 896

Query: 916  INLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLK 975
            INL +A++++D+YK   +  +E L      +E +K++   ++ETL+K+RD L +  ++L 
Sbjct: 897  INLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILS 956

Query: 976  DQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQA 1035
            +Q+ +LN+ELD+Q       K E +K   E+ +    +  + +QY+L+LS L  DL QQA
Sbjct: 957  EQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQA 1016

Query: 1036 MYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWA 1095
             YAN AQ NYEQELQ+HA+++KTISQLRE+A  ++ K+ S++A+ T  ++ L +NE  W 
Sbjct: 1017 SYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWE 1076

Query: 1096 AQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARE-LISTLKRE 1154
             Q++ YE Q     +RIEDLS+QN+LLFDQ+ L        N +  +   E L+ +L+ +
Sbjct: 1077 EQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSD 1136

Query: 1155 CDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQL 1214
             DILQT+L + + +   L+ KL     EL+  ++++ + +   +   I +EE+  I+ QL
Sbjct: 1137 RDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQL 1196

Query: 1215 NQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQIS 1274
            NQ+NLLRESNITLRNE     ++ + L+ ++E L+E + PLE +   L+  +   ++Q++
Sbjct: 1197 NQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLN 1256

Query: 1275 LITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLK 1334
               EE NRWKQRSQDIL K++++DP EH+K                     L DRF R+K
Sbjct: 1257 AYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIK 1316

Query: 1335 KQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENS 1394
            KQA ERL++++ TQ TL  ++ +  +    ++  L+ ER   ++ +E  +   + + E+ 
Sbjct: 1317 KQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNK-QSEDV 1375

Query: 1395 SATRDQLQDAL 1405
            +A R QL++AL
Sbjct: 1376 TALRSQLEEAL 1386

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 74/108 (68%), Gaps = 7/108 (6%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATF 1597
             +KRIE+A E L++RIRLPTEEKIN +I+ +K EL++E++ K+ QR  EL   +    TF
Sbjct: 1510 VLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEE-NKTF 1568

Query: 1598 TEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
             E +K        +K +++R +D+E+  AK KAF+EGKQQA MK+ FL
Sbjct: 1569 IEDLKND------IKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFL 1610

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  564 bits (1454), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 428/1379 (31%), Positives = 756/1379 (54%), Gaps = 44/1379 (3%)

Query: 15   TETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHK 74
            T TE  +A+FL ++R  + +++  +   I +K  EF QLQ++NL+ +V ++E +++ S K
Sbjct: 3    TNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSK 62

Query: 75   LGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVL 134
                K+++  ++++   VRAEN  L ++    +      + + + L+  NE L  Q  + 
Sbjct: 63   YEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGL--QNNID 120

Query: 135  EANK--NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKA 192
             AN+   ++    +EK+ ++  ++ E + L  + +TL  + LELE + + Y+S EL  K+
Sbjct: 121  RANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKS 180

Query: 193  DFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATK 252
            +  + +Q++ LL  N EWLE +L  KN  F  YR++T   +      +E  + DL+    
Sbjct: 181  ELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKS 240

Query: 253  TIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKS 312
            + + L ++  +   +L+      K L D L   KQEF +E+S+K +L++L E Q+ +L+S
Sbjct: 241  SKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLES 300

Query: 313  ELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVE----------- 361
             L+ K     + +  ++E    +++EL    ++L++ E K  +LE  ++           
Sbjct: 301  TLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTK 360

Query: 362  ----------------QLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQV 405
                            +L S D+ +IS    L  +  DI ILK+Q++ E+RQKE LQNQV
Sbjct: 361  GRKRTYSNDSNSNSSDELGSFDDSSIS----LSRMQGDIKILKRQLVQEKRQKEKLQNQV 416

Query: 406  EAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLE 465
            E+FV+ELE+K+P+++SF++R  VLEKEL +TA +L+  +K+ +    +L+  K +I D  
Sbjct: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476

Query: 466  SQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGI 525
            SQ+  L +QR+DLA Q+QYLLI +++  D+   L+ +E  F+K +V+ +N     D+Q +
Sbjct: 477  SQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKV 536

Query: 526  ISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAI---ENDTITEAKEA 582
            ISE L++FK+I +LQ KN +L+ TVR LA QLE  E K KS +      +N+   EAKEA
Sbjct: 537  ISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEA 596

Query: 583  IVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEG--SNGGLRDVNAKASENSDLKIRE 640
            I+TL+   + LE  + ++T+ERDA+K + S+       S+  +   +   S N  + +++
Sbjct: 597  ILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETV-VKD 655

Query: 641  LEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXX 700
            LE  L+    ++ A+ K L  E   L +  S+L V +EK +S++ LAEER          
Sbjct: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715

Query: 701  XXQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTS 760
              +ENE+L  R   LE++L +QD  TQ+T S  ++  S+ ++L   ++N   +  LL   
Sbjct: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775

Query: 761  HQKLKETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTL 820
               LK      T+E+ +             ER+TLL+    +FK +I  +     +L   
Sbjct: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835

Query: 821  LSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXK 880
            LS++  E+       +++  WYQ+KID  ++  +     L +K   ++           +
Sbjct: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKE 895

Query: 881  LRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLT 940
            L  A+ +  +Y  +NQ +    + + +  ELEKT+I L DA+SQ++E+K L  ++++ L 
Sbjct: 896  LEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955

Query: 941  AMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHN 1000
             +  +     +D+   ++TL +E+  +     +LK QL N+ +EL  Q    E+ +    
Sbjct: 956  ELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015

Query: 1001 KCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTIS 1060
            +   E++     +  +K  ++ +L KL  DL +Q +YAN AQ+NYEQELQRHADVSKTIS
Sbjct: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075

Query: 1061 QLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNR 1120
            +LRE+ Q+ KN   SL A +  L+  + +NE    +++ EY  Q  L+ QRI+D++ QN+
Sbjct: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135

Query: 1121 LLFDQISLKD-TDSIPIN--DELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLE 1177
            LL++QI L +  +S+  N  D+  + +  L+ +L+RE DIL TK+ + + ++++L+QKL+
Sbjct: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD 1195

Query: 1178 FTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQR 1237
              + EL   K      +      S +I     I   L Q+NLLRESN+TLRNEL++    
Sbjct: 1196 DIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDE 1255

Query: 1238 NQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297
               + ++++  +  L PL++++ +    +  KD +I+   +E  RWK R ++++ K+++V
Sbjct: 1256 KDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKV 1315

Query: 1298 DPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELT 1356
            + +++ K                     L DRF RLKKQA E+L+ ++  Q++L  +++
Sbjct: 1316 NVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQIS 1374

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 17/111 (15%)

Query: 1540 KRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTE 1599
            KRI EA + L+KRIRLP+EEKINKIIE R+ EL+ EF+ K++ +  +L            
Sbjct: 1547 KRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDL------------ 1594

Query: 1600 VMKRHKQEV-----EKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
            +M  H  E      E L+ ++K   ++E+  A+KKAF+EGKQQA+MK+  L
Sbjct: 1595 LMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLL 1645

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  513 bits (1320), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 437/1493 (29%), Positives = 783/1493 (52%), Gaps = 68/1493 (4%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            VASFL+   + +  +  T+   +  +  EF  ++ E +K S  ++  + +++  +   K+
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRAR---NEALEQQKQVLEAN 137
            ++  L+   E+V  E    E    +   E ++ I++ D L ++     +LE+    L++ 
Sbjct: 84   ELTELIDSYESVCKEK---EDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSK 140

Query: 138  KNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQL 197
            K ++ + L+++I ++   +   E L  E    R + L+LE + +  K  +L  +    +L
Sbjct: 141  KQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERL 200

Query: 198  SQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTL 257
            SQ++  +N    WLE +L +K  +F++YR+++ +E   +  +L T + +L     T   L
Sbjct: 201  SQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVL 260

Query: 258  REQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALK----SE 313
            +E+  +  ++L      +K +     + K    +E++LKQ+L+ +L+ Q++ L+    +E
Sbjct: 261  QERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNE 320

Query: 314  LEFKNSPQAST---DAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT 370
            L    S  AS+   D+  T   + ++++L H  ++  E E K++K         S D   
Sbjct: 321  LSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRK---------SEDYTA 371

Query: 371  ISGSQSLPDL-------YADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423
            +S S S  DL       Y DI +LKK++  E+ Q+E  +  +E F+ +LE ++P L +++
Sbjct: 372  VSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYR 431

Query: 424  DRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQ 483
             R    E+EL E   +L+  +K+K   +++L + +S+I+ +E +I  + +QRSDLA Q+Q
Sbjct: 432  HRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQ 491

Query: 484  YLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPD--GDAQGIISERLVEFKNIVELQA 541
            + L+  +V  DS GPL+ EE  F++ ++  ++   D   D Q +ISERL +FK+I+ELQ 
Sbjct: 492  FFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQ 551

Query: 542  KNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVIT 601
            KN +LL T R LA +LE E++  +++   IE +TI EAKEAI+TLQ++   L  +I  +T
Sbjct: 552  KNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALT 611

Query: 602  RERDAYKAIQSQTSHEGSNGGL-RDVNAKASENSDLKIRELEELLSAAKREAEANVKLLM 660
            +E + YK + S T    +     +    +  E++ L ++ELE  +++  +E++ N  +L 
Sbjct: 612  KELETYKVL-SNTEDSSTPADFDKQREQREIEHTQL-VKELETRIASIIQESKENANILN 669

Query: 661  TENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLA 720
             +   L    + + + + +EKS++ LAEER             ENE L KR   L N + 
Sbjct: 670  DKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVV 729

Query: 721  KQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXX 780
            +QD RT ETI+ LI  +S+LAT+  +   S  +  LL++S + LK    +L +E+N    
Sbjct: 730  EQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKL 789

Query: 781  XXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR 840
                      ER+ LL  + D F  +++ LE   + LR  L +        M  +     
Sbjct: 790  LVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKD 849

Query: 841  WYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDV 900
             +++K  +L E + +     +   +  +E          +L++     + Y   +  +  
Sbjct: 850  DFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGK 909

Query: 901  LTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTAL---EHSKQDHTIEV 957
            L +  +L+ EL+  +  L +++SQ + Y+       +++  +   +   E + ++   EV
Sbjct: 910  LEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEV 969

Query: 958  ETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMK 1017
            E  K   + +++   VLK Q+ +LN+EL+ QK L E  K    +   E++     L   K
Sbjct: 970  ELAK---NNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSK 1026

Query: 1018 DQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLE 1077
              Y+ +L  L +DL +Q  YANKAQ NYEQELQ HA+VSKTISQLRE+ Q ++ ++  L 
Sbjct: 1027 RDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELT 1086

Query: 1078 ASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPIN 1137
             S T+ K+ L EN+  W  Q+ EYE Q     +RIE+ S QN++LF+Q  L    +   N
Sbjct: 1087 ISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKL----TTQAN 1142

Query: 1138 DELKSEA---------RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKS 1188
            DE  +E+          +L+ +L+ E D+LQ +L + + +E  L+++L   E++      
Sbjct: 1143 DEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDL 1202

Query: 1189 EIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEEL 1248
            E++K +  +     ++E++  ++ QL Q++LLRESNITLRNE      +NQ L+  VE L
Sbjct: 1203 ELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENL 1262

Query: 1249 QEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXX 1308
             + L PLE ++ TL   +  KDKQ+S+  EE  RWKQRSQDIL KY+R+DP EH+     
Sbjct: 1263 HDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEE 1322

Query: 1309 XXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDA 1368
                             L +RF++LKKQA E+L+ ++ +QN+L  ++ +    +K L   
Sbjct: 1323 RNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQ 1382

Query: 1369 LDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQAR-INEMSTAPSXXXX 1427
            L+ E+E   SL++ ++ T +N   +  + + QL++AL K +D + + IN + ++      
Sbjct: 1383 LETEKEGKLSLEKRLEVTMKNS-HDIVSIQSQLEEALMKSKDFETKFINSVESSK----- 1436

Query: 1428 XXXXXXXXXXXHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELID 1480
                        +K+L+E  +K Q E+     A  +++ +  EI  V  + +D
Sbjct: 1437 ---QIEENLNSEIKKLQEESSKLQEEL-----AHEKLTTSTTEIGNVDQDTVD 1481

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 76/111 (68%), Gaps = 9/111 (8%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSE-LAGEKPLP 1594
            Q T +RI+EA E L++RIRLPTEEKINK+I+ R+ +L+ EF+ K++ R  E L G++   
Sbjct: 1551 QATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEK-- 1608

Query: 1595 ATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
                E   R K+E+++   ++ R+ +EE+   KKKAFDEG+QQ  MK+ FL
Sbjct: 1609 ---NEFFDRMKKEIQE---ELARKYEEELQVVKKKAFDEGRQQVLMKTSFL 1653

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  431 bits (1109), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 372/1234 (30%), Positives = 642/1234 (52%), Gaps = 76/1234 (6%)

Query: 192  ADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAAT 251
            ++  +L Q+V+ LN N   L  Q  ++  EFN  +   +  L + + +LE     L++  
Sbjct: 168  SEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKSME 227

Query: 252  KTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALK 311
              +  L ++N     + E     +K L D L   K +  +E+++K +L++LL+GQ+S+ +
Sbjct: 228  AKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQ 287

Query: 312  SEL--------EFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQL 363
             EL        +F   P   +   T +S  Q   +L  K ++L+     +  +   +   
Sbjct: 288  EELRQNVELNSKFTKFPDLESQNETLKSDIQ---DLTLKIEELQNENFNLNSMINQMSNE 344

Query: 364  LSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423
             +    + S   +LP LY+ I +LKKQV  E+ +K+ LQ Q+E+F++ELENK+P++SSF+
Sbjct: 345  QNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQ 404

Query: 424  DRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQ 483
            ++N  LE EL     +L+  S +K+     L    S++   +S I  L +QR DLA QV+
Sbjct: 405  EKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVK 464

Query: 484  YLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQP-DGD---AQGIISERLVEFKNIVEL 539
            +LL+ V V+ DS GPL+ EE  F+ K+ N  N++  +G    +Q +ISERLV F NI EL
Sbjct: 465  HLLLFVAVKNDSGGPLTREEIEFINKISN--NSEDLNGSELTSQHVISERLVTFSNIEEL 522

Query: 540  QAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDV 599
            QAKN +LL+++R+L+  LE  E     K    +N TI +AKEAI+TLQ H   LE+++ V
Sbjct: 523  QAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQYHNDILESKVKV 580

Query: 600  ITRERDAYKAIQSQTSHEGSNGGLRDVNAKAS-ENSDLKIRELEELLSAAKREAEANVKL 658
            +  ERD++K + +      S+    D+++  S E ++  I +L+ L+   K E + N   
Sbjct: 581  LEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDA 640

Query: 659  LMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENN 718
            L ++       KS L +++EKEKSS  L  E+             EN+ELNKR   L+N 
Sbjct: 641  LESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNI 700

Query: 719  LAKQDTRTQETISELIDCKSQLATLSAELKNSIAK--ENLLNTSHQKLKETNEQLTKERN 776
            + KQ+++  + I++ I  +++++ L  +L  SIAK  ++ L  S   L     + ++E+N
Sbjct: 701  IIKQESKLGDIINKYITGETEISNLKTQL--SIAKSEKDFLVKSQDSLNSELIKTSEEKN 758

Query: 777  EXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSD 836
            +             ER TLL D+   F  KI  LE     L   L  K TE+     +++
Sbjct: 759  KLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNE 818

Query: 837  SRSRWYQEKIDAL---NECLK-------STTSDLNSKTQMIQEXXXXXXXXXXKLRDAET 886
            S+  WYQ  ID L   N  +K       S  SDLN+K ++++                  
Sbjct: 819  SQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLE------------------ 860

Query: 887  KSQSYSVLNQTDDVLTQTDA--LRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTT 944
             SQSY++   T    +  D   +  +L+ T+++L +A++QV+EYK LY ST+E+L  + +
Sbjct: 861  -SQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLES 919

Query: 945  ALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE 1004
              E  K     ++  L  E + L         +++ L+++          LK+E NK  E
Sbjct: 920  NFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTD----------LKNEKNKYSE 969

Query: 1005 EVKSNKTAL----------ASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHAD 1054
            E+      +          A    +Y+ ++SKL   L  +A +A+ AQE YE  L +   
Sbjct: 970  EIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNA 1029

Query: 1055 VSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIED 1114
              ++I + +E+ +K   ++  +E+ + +    L ENES W  ++  + +    S ++I++
Sbjct: 1030 NLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDN 1089

Query: 1115 LSTQNRLLFDQISLKDTD-SIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLK 1173
            L+ QN+L  DQ+ L + D S   + +L SE + + + L+ + D+L+TKL +A+RD  N  
Sbjct: 1090 LTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNA 1149

Query: 1174 QKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQR 1233
             KLE    EL+  + ++  S+      S +IE + KI+ +LNQ+ L +ESN TLRN++  
Sbjct: 1150 SKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSE 1209

Query: 1234 KSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLK 1293
             +++N+ L+  + E    L  L  ++ +++ S+G K+  I LI EE N+W+ R++++ ++
Sbjct: 1210 LNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQ 1269

Query: 1294 YERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNA 1353
             ++VD +   K                     LE+RF  LKKQA ERL+ ++  Q++LN 
Sbjct: 1270 IDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNK 1329

Query: 1354 ELTEARESQKALEDALDKEREKTRSLQESIKATE 1387
            ++ E + S   +E AL  E++K+  LQ ++   E
Sbjct: 1330 QINELKASNTNIELALSSEQKKSMDLQNTLSDNE 1363

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 11/113 (9%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAG-----EKP 1592
            T++RIEEA E L+KRIRLP+E KIN++IE RK EL+ E+E KLQ++ +E+       E  
Sbjct: 1505 TLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETI 1564

Query: 1593 LPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
             P    E +K      E++K DM  + + ++ +AKKK+F+EGKQQ+SMK+  L
Sbjct: 1565 DPGKLREEIK------EEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLL 1611

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  370 bits (951), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 384/1418 (27%), Positives = 719/1418 (50%), Gaps = 100/1418 (7%)

Query: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77
            ED ++ FL +  E+L  ++ +V  ++  KI  F+  + E  + +V +DE++S    ++  
Sbjct: 2    EDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS- 60

Query: 78   CKDQIHSLLQE------IEAVRAENLQ--LEQRRAQCDAERQRSINDSDTLRARNEALEQ 129
               ++  LL E      I +    +LQ  L Q R +C              R + +AL +
Sbjct: 61   ---KLSKLLNESSEQKNIASKELSHLQDQLMQDRERC--------------RRKIDALNK 103

Query: 130  QKQVLEANKNDVAQLLNEKIGDIATLQQETER---------LLQEARTLRQQNLELEGQA 180
            Q   L+++++ + +L +EK     ++ ++++          L +E + LR++ +E+E   
Sbjct: 104  Q---LDSSRDAIKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENIL 160

Query: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240
            ++ KS  +  +  +  + Q+  L+  N +W E +L+  N++  A      S + ++ ++L
Sbjct: 161  QICKSNSVSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKL 220

Query: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300
               + D ++A    + L +QN Q    +E +   +K L D     K EF++EM+L++ + 
Sbjct: 221  YQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMN 280

Query: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360
            +LL  Q+++ + +       +   +       + + DEL++   Q ++S+ + Q+L+  +
Sbjct: 281  DLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNII 340

Query: 361  EQLLSADEKTI---SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVP 417
               +  D+ T+     S ++  L++DI +L+KQ+I ER QK  LQNQ+E F++ELE+K P
Sbjct: 341  SDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTP 400

Query: 418  MLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSD 477
             L SFK+R   LE EL  +  +L++IS  K +   +L   + +I   E+ I  L +QR D
Sbjct: 401  ELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLD 460

Query: 478  LARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIV 537
            LARQV+ LL+  +    +  PLS ++   ++K++   +   + DAQ IISERLVEF NI 
Sbjct: 461  LARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNIN 520

Query: 538  ELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRI 597
            ELQ KN +LL+ +R LA++LE  E K  +    +E  TI EAK+AI+ L++   ++E+RI
Sbjct: 521  ELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRI 580

Query: 598  DVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDL----KIRELEELLSAAKREAE 653
            +++ RERD+YK + S   +        +VN  A   +++    KI+ELE  LS+ K E+ 
Sbjct: 581  NILLRERDSYKLLASSKEN--------NVNVNAKNFTEISHEKKIKELEAELSSTKVESS 632

Query: 654  ANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGL 713
            A ++ L  E     +   +  +  +  ++ ++LA+E+                +L K+ L
Sbjct: 633  AVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKT---DLEKQKL 689

Query: 714  VLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTK 773
             + + +  QD + +++ +EL+  +++   L  E+ +S+ KE     +   LKE+   LT+
Sbjct: 690  SVPSFV--QDNKVRDS-TELLQSRTKTEILMHEI-SSLKKE---TANSMVLKES---LTR 739

Query: 774  ERNEXXXXXXXXXXXXKERDTLLKDSDDNF--KG-----KIDSLEAEISQLRTLLSQKAT 826
            +               KE +  L +   NF  KG     +I  LE  + +LR  L  KA 
Sbjct: 740  DLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQ 799

Query: 827  ELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAET 886
            E+    S+ DS+ +W Q  ID   E LKS  ++L+ K + +            +LR+ + 
Sbjct: 800  EIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKL 859

Query: 887  KSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTAL 946
            K   Y  LN T D  T   ALR ELE+T++ LKDA SQV  Y+ + ++ ++ L  + + L
Sbjct: 860  K---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQL 916

Query: 947  EHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKC---- 1002
               K+D+   +E   KE+  L+N+     ++L+ L  ELD  ++L   LK E   C    
Sbjct: 917  ASMKEDYDARIELECKEK--LANE-----EELSLLRRELDEIRSLQPKLK-EGTVCLVKQ 968

Query: 1003 EEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQL 1062
             E++++    +  MK +    + K+  ++    +Y  +    ++  ++ + ++S+ +++L
Sbjct: 969  SEKLRNQAEKIQEMKAK----IDKMNWNV---QVYKKEKTSQFQSIMKANKELSELVTRL 1021

Query: 1063 REEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLL 1122
             +EA   + ++  L++S+ + +  L+ +E  W  +K +YE +   + ++ E L  +N +L
Sbjct: 1022 EKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVL 1081

Query: 1123 FDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQE 1182
             ++I      S    D LK  +    S L+ E + L+TKL   KRD + +KQK    E+ 
Sbjct: 1082 IEKIGSVTEGSDGNEDYLKLVS--FFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKN 1139

Query: 1183 LSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLE 1242
            ++  + +   SQ      +++I+E + I +++ QVNLL+E+N  L+  L+  +++N+++ 
Sbjct: 1140 INDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIY 1199

Query: 1243 RNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEH 1302
              +   QE +  L++D++  +  V     +I +   E+++ KQR  D+  +   V  +  
Sbjct: 1200 EELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTI 1259

Query: 1303 KKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQ 1362
            +K                     LE++F RLKKQA E+LD ++  Q  L  EL E +  +
Sbjct: 1260 EKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVR 1319

Query: 1363 KALEDALDKEREKTRSLQESIKATEENEIENSSATRDQ 1400
              LE  L+ +  KT  L    K   E+ +++    RDQ
Sbjct: 1320 DKLEQDLNSKNFKTVDLDTEPK---EHTVQSGDLLRDQ 1354

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 33/125 (26%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELA--------- 1588
            TI+RI EA E L+KRIRLP+EE+I KII  RK EL+EEF+ KL++  S L          
Sbjct: 1447 TIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETN 1506

Query: 1589 -------------GEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGK 1635
                         G    P+  T+ MK+   +V+           E++ +AK   F    
Sbjct: 1507 DDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQ-----------EQLKKAKNGVFFGDS 1555

Query: 1636 QQASM 1640
            + +SM
Sbjct: 1556 RSSSM 1560

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  351 bits (900), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 376/1421 (26%), Positives = 709/1421 (49%), Gaps = 91/1421 (6%)

Query: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77
            ED ++ FL +  E+L  V+  V  ++  KI +F++ + E  K +V +DE++S    ++  
Sbjct: 2    EDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISK 61

Query: 78   CKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLR----ARNEALEQ---Q 130
             K  +    ++    + E   L   + Q + ER R   + D L+      +EA+ +   +
Sbjct: 62   LKQLLDESSEQKNTAKEE---LNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDE 118

Query: 131  KQVLEANKNDVAQLL---NEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEE 187
            K+V E  + D+ Q     N+ + D          L +E + LR++ +E+E   +  KS  
Sbjct: 119  KRVKE--EYDIWQSRDQGNDSLND---------DLNKENKLLRRKLMEMENILQRCKSNA 167

Query: 188  LKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDL 247
            +  +  +    Q+  L+  + + +E +L+       ++ ++T +E  + S  +E  E  L
Sbjct: 168  ISLQLKYDTSVQEKELMLQSKKLIEEKLS-------SFSKKTLTEEVTKSSHVENLEEKL 220

Query: 248  ---QAATKTI----KTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300
               Q+  +++    K L  QN Q    +E +   +K L D  +  K EF++EM+L++ + 
Sbjct: 221  YQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMN 280

Query: 301  ELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTV 360
            +LL  Q+++L+ +   +   +   ++      + + DEL+    +LE+S+ + Q+L+  V
Sbjct: 281  DLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIV 340

Query: 361  EQLLSADEKTISGSQSLP---DLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVP 417
                  +E T++ S   P    L++DI +LK+Q+I ER QK  LQNQ+E F++ELE+K P
Sbjct: 341  MDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTP 400

Query: 418  MLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSD 477
             L SFK+R   LE EL  +  +L+++S  K +   ++   + +I   E+ I +L +QR D
Sbjct: 401  ELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLD 460

Query: 478  LARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIV 537
            LARQV+ LL+  +   ++  PLS +E   ++K++   N   + D+Q II+ERLVEF N+ 
Sbjct: 461  LARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVN 520

Query: 538  ELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRI 597
            ELQ KN +LL+ +R LA++LE  E K     + +EN TI EAK+AI+ L++   ++ETRI
Sbjct: 521  ELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRI 580

Query: 598  DVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVK 657
            +++ RERD+YK + S   ++ +   +  + A A E    KIRELE  LS+ K E  A ++
Sbjct: 581  NILLRERDSYKLLASTEENKANTNSVTSMEA-AREK---KIRELEAELSSTKVENSAIIQ 636

Query: 658  LLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLEN 717
             L  E     +S+ +    +E  ++ + LA+E+                EL K+   + +
Sbjct: 637  NLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKA---ELEKQKSWVPS 693

Query: 718  NLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNE 777
             +  +  R     +EL   + ++ +L  E+     +      + + L    EQ  KE+ E
Sbjct: 694  YIHVEKERAS---TELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKE 750

Query: 778  XXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDS 837
                         E        +  +K KI  LE  + +LR+ L  K  E+    S  DS
Sbjct: 751  LQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDS 810

Query: 838  RSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQT 897
            + +W Q  ID     +KS  ++L++K   I++          +LR  +TK Q Y  L+Q 
Sbjct: 811  QLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELR--KTKFQ-YKFLDQN 867

Query: 898  DDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEV 957
             D  T    LR ELE+ ++ LKDA SQ+  Y+ + +S +  L  +   L  +K+++  ++
Sbjct: 868  SDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKI 927

Query: 958  ETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMK 1017
            E  KKE+ A   D + L+ +L  + +    Q  L E   H   + E+           ++
Sbjct: 928  ELEKKEKWAREEDLSRLRGELGEIRA---LQPKLKEGALHFVQQSEK-----------LR 973

Query: 1018 DQYQLELSKLTEDLNQQA----MYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKV 1073
            ++ +  + K+ E + + +    +   K    Y+  ++ + D+S+ + +L ++A   + ++
Sbjct: 974  NEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAEL 1032

Query: 1074 HSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDS 1133
               ++S+   +  L+++E  W  +K +YE +   + ++ E L  +N +L +++     D 
Sbjct: 1033 TKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKV-----DD 1087

Query: 1134 IPINDELKSEAR--ELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIR 1191
               N+  K   +   L S L+ E + L+TKL   KR+ + +KQK +  E+ +    ++++
Sbjct: 1088 TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI----NDLQ 1143

Query: 1192 KSQVTSD----TRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEE 1247
            ++Q  S+      +++I+E   I +++ QVN+L+E+N  L+  L+  +++N+++ + + +
Sbjct: 1144 RTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLND 1203

Query: 1248 LQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXX 1307
             QE +  L+ D++  +  V     +I +   E+ + KQR QD+  + +    ++ +K   
Sbjct: 1204 RQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTN 1263

Query: 1308 XXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALED 1367
                              LE++F RLKKQA E+LD ++  Q  L  EL E +  +  LE 
Sbjct: 1264 EISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQ 1323

Query: 1368 ALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKL 1408
             L  E  K   L   +KA   +E+++   +RD  +D  + L
Sbjct: 1324 DLHFENAKVIDLDTKLKA---HELQSEDVSRDHEKDTYRTL 1361

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELA 1588
            T++RI+EA E L+KRIRLP+EE+I KII  RK EL+EEF  KL++    L 
Sbjct: 1444 TLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLT 1494

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  347 bits (891), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 371/1388 (26%), Positives = 686/1388 (49%), Gaps = 116/1388 (8%)

Query: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77
            ED ++ +L +  ++L  V+ ++   +  +I +F++ + E  + +V IDE++S    ++  
Sbjct: 2    EDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS- 60

Query: 78   CKDQIHSLLQEI---------EAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALE 128
               +++ LL E          E  R  NL L+  R++C     R I          +AL 
Sbjct: 61   ---KLNELLGESSEEKNVSKKELSRLHNL-LKNERSKC----ARKI----------DALN 102

Query: 129  QQKQVLEANKNDVAQLLNEK-IGDIATL------QQETER--LLQEARTLRQQNLELEGQ 179
            +Q   L A+KN + +L +E+ + + A +        + ER  L  E + LR++ LE+E  
Sbjct: 103  KQ---LNASKNTITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENI 159

Query: 180  ARVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQR 239
             +  KS  L  K  +  + Q+  L+  N +W+E QL+ ++ +         S + ++ ++
Sbjct: 160  LQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQ 219

Query: 240  LETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRL 299
            L   + D ++ +   + L  QN Q    +E +   +K L D +   K +F++EM+L++ +
Sbjct: 220  LNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNM 279

Query: 300  VELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQT 359
             +LL  Q+++ +         + + D       + + D+L+    QLE+S+ + Q+L+  
Sbjct: 280  NDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNI 339

Query: 360  VEQLLSADEKTISGSQ----SLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENK 415
            V   +  DE     +     S+  +++DI  LK+Q+I ER QK  LQNQ+E+F+ ELE K
Sbjct: 340  VADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERK 399

Query: 416  VPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQR 475
             P L SFK+R + LE+EL  +  +L++IS  K +   +L   + +I + E+ I +L +QR
Sbjct: 400  TPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQR 459

Query: 476  SDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKN 535
             DLARQV+ LL+ ++       PLS +E   +KK++   +   + D+Q II+ERLVEF N
Sbjct: 460  LDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNN 519

Query: 536  IVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELET 595
              ELQ KN +LL+ VR LA++LE  E K       +EN TI EAK+AI+ L+     LE+
Sbjct: 520  TNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLES 579

Query: 596  RIDVITRERDAYKAIQSQTSHEGSNGG-LRDVNAKASENSDL-KIRELEELLSAAKREAE 653
            RID+++RERD+YK + S      +NG  +    A  +E ++L KI+ELE  LS  K E  
Sbjct: 580  RIDILSRERDSYKLLAS------ANGNKIYADAANKTEAANLKKIKELESELSLTKVENS 633

Query: 654  ANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGL 713
            A V+ L  E     +S+S   + +++  + ++LA E+                 L  R  
Sbjct: 634  AVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENL--------------LQTRID 679

Query: 714  VLENNLAKQDTRTQETI--------SELIDCKSQLATLSAELKNSIAKENLLNTSHQKLK 765
             L+  L KQ +    +I        +EL   K++  +L  E+ N   K   L    + L 
Sbjct: 680  DLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLT 739

Query: 766  ETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKA 825
               E+  KE+ +             E+          +  KI +LE    +L   L  K 
Sbjct: 740  RDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKV 799

Query: 826  TELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAE 885
             E+    ++ +S+ +W Q  ID   + +KS ++DL+ K   I++          +L+  +
Sbjct: 800  QEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQ--K 857

Query: 886  TKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTA 945
            TK Q Y +LN + D  T   AL+ ELE+++I+LKDA SQ++ Y+ + ++ + TL  +   
Sbjct: 858  TKLQ-YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQ 916

Query: 946  LEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEE 1005
            L  +K++  ++ ++L +E +A   + + L+        ELD  + L   LK    +  ++
Sbjct: 917  LTKTKEELKVKSQSLDEENNAKEEEISFLR-------RELDEIRGLQPKLKEGALRLVQQ 969

Query: 1006 VKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQE----NYEQELQRHADVSKTISQ 1061
             +        + +Q Q  +  + E +++        QE     Y+ +L+ + D+S  + +
Sbjct: 970  SE-------KLGNQTQ-RIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVLR 1021

Query: 1062 LREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRL 1121
            L  E   ++ ++   ++S+   ++ L+++E  W  +K +YE +   + ++ E L  +N  
Sbjct: 1022 LENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSA 1081

Query: 1122 LFDQISLKDTDSIPINDELKSEAR--ELISTLKRECDILQTKLELAKRD-------ESNL 1172
            L ++I     D    N+  K   +   L S+L+ E + L+TKL   KRD        +NL
Sbjct: 1082 LVEKID----DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANL 1137

Query: 1173 KQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQ 1232
            ++ +   +Q   V++ ++   Q ++D    +I+E   I++++ QVN+L+E+N  L+  L+
Sbjct: 1138 EKSVNDMQQTHLVSRKDV---QCSTD----IIDEFEDIMKEIAQVNILKENNTILQKSLK 1190

Query: 1233 RKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILL 1292
            + +++N+ + +    LQ  +  L+ D+   +  V     ++ +   E+ +WKQR  ++  
Sbjct: 1191 KVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQ 1250

Query: 1293 KYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLN 1352
            + +    +E +K                     L D+F RLKKQA E+LD ++  Q  L 
Sbjct: 1251 QQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALT 1310

Query: 1353 AELTEARE 1360
             E+ E ++
Sbjct: 1311 NEVDELKD 1318

 Score = 55.8 bits (133), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQ 1581
            T++RI+EA E L+KRIRLP+EE+I KII  RK EL++EF+ KL+
Sbjct: 1446 TMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  347 bits (889), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 369/1385 (26%), Positives = 686/1385 (49%), Gaps = 63/1385 (4%)

Query: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77
            ED ++ FL +  E+L  +  +   ++  KI EF++ + E  K +V +DE++S    ++  
Sbjct: 2    EDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS- 60

Query: 78   CKDQIHSLLQEIEAVRAENLQLEQR-RAQCDAERQRSINDSDTLRARNEALEQQKQVLE- 135
               ++  LL E    +  N ++  R + Q   ER R     D L  +  A  +  + LE 
Sbjct: 61   ---KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLED 117

Query: 136  --ANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKAD 193
                K + +   +    D +T       L +E + L+++ LE+E   +V KS  +  +  
Sbjct: 118  EEGAKEEASSWQDGLRNDDST----KHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFK 173

Query: 194  FHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKT 253
            +   SQ+  L   N +W E +L+  N +         S L ++ ++L   + + ++ +  
Sbjct: 174  YDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTY 233

Query: 254  IKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSE 313
             K L +QN +    +E +   +K L D   + K EF++EM+L++++ +LL  Q+++ +  
Sbjct: 234  NKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERG 293

Query: 314  LEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISG 373
               +   +             + +EL+    +LE+S+ + Q L+  V   +  +  T++ 
Sbjct: 294  HSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTVNT 353

Query: 374  SQSLP---DLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLE 430
            + + P    L+++I  LK+Q++ ER QK  +QNQ++ FV+ELE+K P L SFK+R ++LE
Sbjct: 354  NTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLE 413

Query: 431  KELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVT 490
             EL  +  +L+++S  K +    L   + +I   E+ I +L +QR DLARQV+ LL  ++
Sbjct: 414  HELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNIS 473

Query: 491  VRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTV 550
                +  PLS +E   ++K++  ENT  + D+Q II+E+LVEFKNI ELQ KN +LL  +
Sbjct: 474  AIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCI 533

Query: 551  RNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAI 610
            R LA++LET E +       IEN TI EAKEAI+ ++    +L  R++++TRERD+YK +
Sbjct: 534  RILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLL 593

Query: 611  QSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSK 670
             S       N    D         + KIREL+  LS+ + E+ A ++ L  +     +S+
Sbjct: 594  ASA----NDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQ 649

Query: 671  SELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQE-- 728
            ++  + +++ ++ ++L  E+               E +N     LE          Q+  
Sbjct: 650  TDGKIALQEFENFKVLVAEKEAMLQ----------ERINHLKTQLEKQRLSAAPPVQDYK 699

Query: 729  --TISELIDCKSQLATLSAELKNSIAKENL-LNTSHQKLKETNEQLTKERNEXXXXXXXX 785
               +++L   ++++ +L  E+ N + KEN  L    + L    E+  KE+ +        
Sbjct: 700  YSNLTDLSHSENKIGSLKYEISN-LKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSES 758

Query: 786  XXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845
                 E++ +    +  +  +I  LE  + +L   L  K  E+    S+ +S+ +W Q  
Sbjct: 759  ETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNT 818

Query: 846  IDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTD 905
            ID   + LKS +++L++K   I            +LR   TK Q Y  L+ T D  T   
Sbjct: 819  IDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELR--MTKLQ-YKFLSNTSDTNTLEP 875

Query: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965
             LR EL++T+I LKDA SQ+  Y+ + ++ +  L  +   L+ +K+D   +++   KE+ 
Sbjct: 876  TLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKG 935

Query: 966  ALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKC---EEEVKSNKTALASMKDQYQL 1022
            A        +++L++L  ELD  + L   L+   +      E+V      +  MK++   
Sbjct: 936  A-------KEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQRIQEMKNKID- 987

Query: 1023 ELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITE 1082
            +++ + E       Y  +    Y+ EL+ + D+S+ + +L +EA  ++ ++   + S+  
Sbjct: 988  KMAAIIE------AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYS 1041

Query: 1083 LKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKS 1142
             ++ L+ +E  W  +K +YE +   + ++ E L  +N +L ++I      S   ++E   
Sbjct: 1042 TQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGS--NSNEKYL 1099

Query: 1143 EARELISTLKRECDILQTKLELAKRDESNLKQK---LEFTEQELSVAKSEIRKSQVTSDT 1199
            E   L S L+ E   L+TKL   KRD + L+QK   LE +  +L  A + + +++V    
Sbjct: 1100 ELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANT-VPRNKVQCP- 1157

Query: 1200 RSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDI 1259
             +++I+E  KI++++ QVN+LRE+N  L   L+  +++N+ + + +  +QE +  L+  +
Sbjct: 1158 -AVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHL 1216

Query: 1260 LTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXX 1319
            +  +  V     ++     E+ + KQR QD+  + +     E +K               
Sbjct: 1217 IQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNV 1276

Query: 1320 XXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSL 1379
                  LE++F RLKKQA E+LD ++  Q  L  EL E +E++  LE+ L  E  K   L
Sbjct: 1277 QNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDL 1336

Query: 1380 QESIK 1384
            +  +K
Sbjct: 1337 ELKLK 1341

 Score = 59.3 bits (142), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELA 1588
            T+KRI+EA E L+KRIRLP+EE+I KII  RK EL++EFE KL++    L 
Sbjct: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLV 1497

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  325 bits (833), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 383/1430 (26%), Positives = 706/1430 (49%), Gaps = 156/1430 (10%)

Query: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80
            +A+ LE+    L  +  TV  +I AK+   +Q   E  + + TID  +S  S +    K+
Sbjct: 7    LATSLEVTATDLETIEPTVLEKINAKLLSSEQ---EKDRLNATIDNFKSKMSSQFDTVKN 63

Query: 81   QIHSL-------LQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQV 133
             +  L       +Q+ + + ++ +Q EQ+ AQ     +  +   D ++  NE  ++  Q+
Sbjct: 64   DLELLQKEKELLIQDKKQLESKCIQWEQQYAQHQDISKTDLASDDVIK-ENETFKRDHQL 122

Query: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEE--LKHK 191
            L ++  ++++ L+    D A  ++ T  L      L+  N+++  Q   +KSE   LK K
Sbjct: 123  LTSDLMNLSKKLSS--CDAALEKKSTAYL-----ELQNDNIDIRTQLNNFKSETKGLKSK 175

Query: 192  A-----DFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGD 246
                  DF +L    S + T  E    +L++ +++F   +  + +EL +    L + E  
Sbjct: 176  YERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQ 235

Query: 247  LQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQ 306
             +   +  K  +E+N +  + +  +    K L ++L   K+ FTREM+L Q   +LL+  
Sbjct: 236  YELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEH 295

Query: 307  VSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSA 366
            +  LK      N+ + +T   +T  + ++  ELV   + LE+SEL+   L   +EQ L+ 
Sbjct: 296  IEYLK------NTTKETTGGTSTLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTE 349

Query: 367  DEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRN 426
            +E++ S ++        + +LK+Q+I E+RQK++LQ QVE FV+ELEN++P ++S KDRN
Sbjct: 350  NEESTSDNE--------LVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRN 401

Query: 427  DVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLL 486
              LE+EL +   +L+   ++ D    +L     ++++    I+ L  QR DLA QVQ+LL
Sbjct: 402  QTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLL 461

Query: 487  IQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADL 546
            + + ++      L+ +E  F++K++   N+Q D D+Q IISERLV+F +I  LQ +N +L
Sbjct: 462  LNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMEL 521

Query: 547  LHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDA 606
            L T RNLA QLE+      S T++++  T  E+KE I  LQ+ I  L ++++ + +E+DA
Sbjct: 522  LTTTRNLAEQLES------SDTKSVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDA 575

Query: 607  YKAIQSQ-TSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQE 665
            YK +  Q T  +     LR    K  E    ++ +LE + S     AE   K+L     +
Sbjct: 576  YKLLSLQNTGEQTPTEELRSQLQKKEE----QLTKLERMSSLDSHLAEEKAKVLNQSIIK 631

Query: 666  LARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKR-----GLVLENNL- 719
            L + K +L   + KE S R +AE++            ++ +   K+      L+ ++N  
Sbjct: 632  LKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAE 691

Query: 720  ----AKQDTRTQETIS----ELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQL 771
                ++++  TQ  IS    E+   K  L   S + +N+++K   L  + Q+ +    +L
Sbjct: 692  NIKHSRENETTQAKISILQKEIESYKQNLLQYSKDNENTLSK---LAAATQEKETLGSRL 748

Query: 772  TKERNEXXXXXXXXXXXXKERDTLLKDSDDNF-----KGKIDSLEAEISQLRTLLSQKAT 826
            +  +NE            +ER+T  K+ D        K KI  LE +I +++   ++K +
Sbjct: 749  STVKNE----LEQKINLMQERETYYKEHDSISERLLKKSKI-QLEDKIKEVKDFEAKKNS 803

Query: 827  ELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQM-IQEXXXXXXXXXXKLRDAE 885
            +++           WYQ+++D+L     +TT+D   K Q+ + +          K+ D E
Sbjct: 804  QIN-----------WYQKRLDSL-----TTTND---KLQVELNKELTKINIQRLKISDLE 844

Query: 886  TKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTA 945
                    L+Q  +  +    +  + EK +  LK+   ++++Y+ L    +ET   +   
Sbjct: 845  ------KTLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKD 898

Query: 946  LEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE- 1004
            L  +KQ   ++        DA+      L  QLA L  E     +LL+  K    KCE+ 
Sbjct: 899  L--NKQRQIVD--------DAMEGKEQ-LDQQLAELTQECSSMNSLLQKQKA---KCEDD 944

Query: 1005 ---------EVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADV 1055
                     E ++ K +L+S++++    ++ L  ++ ++     + +  Y+++L + ++ 
Sbjct: 945  QKIIQDKATETENLKNSLSSLENK----ITTLENEMVEKTKSFEEKENTYKEQLHKLSES 1000

Query: 1056 SKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDL 1115
            S  I ++  E + +K  +  L+A+I   + ++         +K  +E Q     + I++L
Sbjct: 1001 STLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNL 1060

Query: 1116 STQNRLLFDQISL---------KDTDSIPINDELKSEARELISTLKRECDILQTKLELAK 1166
            + Q  +   + S           DTD   +ND   S+  ELI  L+RE D L  KL++++
Sbjct: 1061 NFQIHIQKGKRSFITSEGSTTSNDTDETVVND--TSDKNELILALRRERDGLDIKLDISQ 1118

Query: 1167 RDES-------NLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNL 1219
            R+         NLK  L+ T Q     +SE+     T+       E++ + ++QLN++N 
Sbjct: 1119 REVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTT-------EQHKEAVKQLNELNT 1171

Query: 1220 LRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEE 1279
            L+E+N  L+ +L+   + N  +   +E L+  + PL++ +  L+ S+  KD+Q++L++EE
Sbjct: 1172 LKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEE 1231

Query: 1280 VNRWKQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARE 1339
              RWK RS++IL+K ++VD EEH K                     L DRF RLKKQA E
Sbjct: 1232 NERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHE 1291

Query: 1340 RLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEEN 1389
            +LD A+    +L AE+T+  +++  LE  LD+ER++ + ++  +K   +N
Sbjct: 1292 KLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDN 1341

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 16/109 (14%)

Query: 1539 IKRIEEANEILRKRIRLPTEEKINKII--ENRKRELDEEFEAKLQQRTSELAGEKPLPAT 1596
            ++RI +A E L+KRIRLP+EEKIN++I    ++ E + E + K Q  T+E A E+ L   
Sbjct: 1485 MQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIEEEL--- 1541

Query: 1597 FTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
                    ++EVE+   +++ + D E+A+ KKKAF EGKQQ+ MK+  L
Sbjct: 1542 --------RKEVER---ELRVKFDNELAEVKKKAFLEGKQQSQMKTTLL 1579

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  267 bits (683), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 336/1341 (25%), Positives = 636/1341 (47%), Gaps = 138/1341 (10%)

Query: 119  TLRARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEG 178
            T+  R E + ++ ++L+++  D+++++ E+  +I  L+ E   +  +   LR +   L+ 
Sbjct: 45   TVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAELENLQN 104

Query: 179  QARVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQR-TQSELASVS 237
               + K ++L  +++       +  L   N  L +++ Q   E  + RQ   +++L S +
Sbjct: 105  DLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQA-KELASIRQHDYEADLDSKT 163

Query: 238  QRLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQ 297
              L + E +L+ A     +L  Q  +   EL  +   +++L D     + E+T E++L++
Sbjct: 164  GALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQK 223

Query: 298  RLVELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLE 357
                LL+ QV++L+ E        A      TE + +I           EE  L+ +   
Sbjct: 224  HRARLLQEQVASLEKE--------AKLVGHETEPEYEI-------PPPGEEVALQQRSHS 268

Query: 358  QTVEQLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVP 417
             +++ LL+ +++T   S S+ +L  +I IL  ++  E   K+ L+ QV  FV ELE   P
Sbjct: 269  ISMDSLLTGNDET---SHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAP 325

Query: 418  MLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSD 477
            ++ SFK +++  + ++ +    L+ ++KDK+    ++++ K Q+  +  Q   L ++R D
Sbjct: 326  IIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFD 385

Query: 478  LARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNM---ENTQPDGDAQGIISERLVEFK 534
            LARQ+QYLL+   V+ DS  PL++ E +++K+++N    E      D+Q IIS+R+++FK
Sbjct: 386  LARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFK 444

Query: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594
            +IVELQ +N +LL  VR L+++ ET ERK++S  ++IE   I EAK+ ++ LQ +   LE
Sbjct: 445  SIVELQQQNINLLSAVRTLSDRAETLERKLES-GDSIE--AINEAKQTLLDLQQYNSSLE 501

Query: 595  TRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEA 654
             +++ +T +  A +   S    E  N  L D N          I+ L+    +   E+  
Sbjct: 502  AKVESLTNKLKANEHFTSIGDGEFGNSDLSDGN---------NIQALKNKYDSLMAESSE 552

Query: 655  NVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLV 714
             +  L ++   L +SKS+L    E   +S+ L E+R             EN  L  R   
Sbjct: 553  TIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKN 612

Query: 715  LENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKE 774
                L +++  T +TI + +DC ++L  +  +L+N++ ++++L  +   ++    Q  KE
Sbjct: 613  TSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKE 672

Query: 775  RNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMST 834
            RN             K +D  LKD   + + KID LE E ++LR  +  K T  S  ++ 
Sbjct: 673  RNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTN 732

Query: 835  SDSRSRWYQEKIDALN-----------ECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRD 883
              +   WYQ K D+L+           EC  ST   L  KTQ +             L++
Sbjct: 733  PKAELEWYQTKFDSLSGSNDALNEKMIEC-ASTIETLTVKTQTLD----------ILLQE 781

Query: 884  AETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMT 943
            A +K++        DDV   T AL +EL  +R  L D             +++E   +  
Sbjct: 782  ANSKNKLLEARETVDDVNKLTGALETELATSRTRLTD-------------TSRELEISSN 828

Query: 944  TALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCE 1003
            T  ++       E++ L + +  L N+   L+D++A L  EL +     E  K    K  
Sbjct: 829  TIRQYQS-----EIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKL 883

Query: 1004 EEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLR 1063
              ++  +  L  +++ Y  E+ KL  DL++QAM   + +  +++E++             
Sbjct: 884  SNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVR------------- 930

Query: 1064 EEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYET-------QASLSSQRIEDLS 1116
             E Q    + +  E  + E++++       +  +++E E+       Q  L  +R++  S
Sbjct: 931  -EVQNRNTETYRNELELVEIRQT-----KVFVEKEKELESRIKILNEQIELDKERMKQFS 984

Query: 1117 TQNRLLFDQISL----KDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNL 1172
             +  LL +Q+ L    K +D +     +  E  +L+  L  E   L++KL  ++ +++ L
Sbjct: 985  DEESLLREQVKLLADEKASDLVDAG--VSPEYTDLVRKLSDEKKNLESKLFASQSEKNRL 1042

Query: 1173 KQKLEFTEQELSV--AKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNE 1230
            +++L  TE E++V     E  K +V ++  +    E+ +  E + Q+  L+ESN++L NE
Sbjct: 1043 REQLTKTESEIAVLNMNYEQAKKEVAAEVNN----ESGRAEEHIAQLESLKESNMSLTNE 1098

Query: 1231 LQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDI 1290
            ++    RN ++   + EL+   K +E+ +   +  + +KD ++  +  E +R K  S D+
Sbjct: 1099 VKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDM 1158

Query: 1291 LLKYERVDPEEHKKXXXXXXXXXXXXXXXX---------XXXXXLEDRFQRLKKQARERL 1341
                    P+   K                              LEDRF RLK+QARERL
Sbjct: 1159 --------PQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERL 1210

Query: 1342 DNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRD-- 1399
            D ++ T N+L   +    + + AL+D +++ +++   L+  I    +  IE S+  ++  
Sbjct: 1211 DASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKI----QEHIETSAVMKELK 1266

Query: 1400 -QLQDALQKLEDAQARINEMS 1419
             +L   + K +D +A +NE S
Sbjct: 1267 TELAAVMSKNKDIEAELNETS 1287

 Score = 33.9 bits (76), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 17/96 (17%)

Query: 1550 RKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVE 1609
            ++R+ L  +EK ++++  +  EL+E+F+ +++ +      EK L A         K E+E
Sbjct: 1412 KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNK------EKELNAL--------KDEIE 1457

Query: 1610 KLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
            +     K   ++ +   KK+AF+EGKQQA+MK   L
Sbjct: 1458 E---KCKTGHEDTLIAVKKRAFEEGKQQATMKMSIL 1490

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  237 bits (605), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 315/1235 (25%), Positives = 586/1235 (47%), Gaps = 127/1235 (10%)

Query: 184  KSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETC 243
            KSE L  +++  +  ++  L+  +N+WLE  L +   E    +Q    ++    Q ++  
Sbjct: 114  KSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSI-LKMEEKDQEIDNL 172

Query: 244  EGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELL 303
              ++    K    L  +N +    ++ +   +K+ +D+ ++ +QEF  E+ LK R+   L
Sbjct: 173  RHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSL 232

Query: 304  EGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQL 363
            E Q+  ++ E     S Q   + +  ESQ +I ++L+   +QL++S  +  +L+  V + 
Sbjct: 233  ETQLKEIQQE----KSIQNEDNTSRAESQ-KIMEQLIDTRKQLKDSRNECTRLKSYVNEF 287

Query: 364  LSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423
            ++     ++G     +  +   +LKK+++  + QK++L+ QVE F+ ELE KVP++ S +
Sbjct: 288  IN----DVNG-----EYSSSSSLLKKELLKVKEQKDYLETQVENFITELEIKVPVIDSLE 338

Query: 424  DRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQ 483
             +N  LEKEL++   ++D IS +++    + +  K +    +  I  LT QRSDLA Q+Q
Sbjct: 339  KKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQ 398

Query: 484  YLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKN 543
            +LL+ +  +  ++  LS +ET F++++   +    + D+Q IISERL++F +I ELQ +N
Sbjct: 399  FLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQN 458

Query: 544  ADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRE 603
             D+L TVR+LA QLE +E+  ++    IE  T+ EAK+A++ LQ++   LE +++   +E
Sbjct: 459  MDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKE 518

Query: 604  RDAYKAIQSQTSHEGSNGGLRDVNAKASENSDL---KIRELEELLSAAKREAEANVKLLM 660
            RD YK + S+     SN        K SE +D+      +L+  L   +      ++ L 
Sbjct: 519  RDVYKLL-SKGKSPSSN--------KPSECNDIDKHTTGKLQNELQQTREYLTKEIEKLT 569

Query: 661  TENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENN-- 718
              N+++   K EL  +++K +S++  AE +            QEN     R  VLE N  
Sbjct: 570  RTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLML-QEN-----RKSVLEQNDH 623

Query: 719  ----LAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQ------------ 762
                L++++ +  E   +L +  SQ   L     ++ ++ N L T HQ            
Sbjct: 624  LQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEE 683

Query: 763  --KLKETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTL 820
               LK    +L   RNE             ER T  +  + +    +  +E +  Q+R +
Sbjct: 684  KNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQDL---LKIIEKQEDQIRDM 740

Query: 821  LSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXK 880
              ++A EL+           WYQ+           T +++     M +E           
Sbjct: 741  EVKRAEELN-----------WYQKNFPT------QTETEIGLPVDMKKEGETGRQSNRDT 783

Query: 881  LRDAETKSQSYSVLNQTDDVLTQTDAL------RSELEKTRINLKDAFSQVDEYKGLYAS 934
            L   ++ S  ++ L  TD  + ++ +L      R+E E       DA +   +  GL   
Sbjct: 784  LESQKSGSPGFTDLG-TDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGL--- 839

Query: 935  TKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLET 994
              E +T         ++D   ++E L  ++  L      ++ +  +L+ +L  +KN  +T
Sbjct: 840  -PENVTK-------KEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDT 891

Query: 995  LKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHAD 1054
             K   N   +++  N +     K         L +DL+   M         E+E Q+H +
Sbjct: 892  EKASLNNELDKIMENNSLTEVAK-------KSLEDDLHDVEM-------KLEEERQKHEE 937

Query: 1055 VSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIED 1114
             + T+S+     +K    +  +     EL KS E          +E E    L+++RI+D
Sbjct: 938  TNATLSEKELLCEKM---IEEISGYREELSKSAEMQVDI--QHTRELEDLLDLANKRIDD 992

Query: 1115 LSTQNRLLFDQIS----LKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDES 1170
            L TQN LL +Q++    L+DT +       K + +++I  +KRE D LQ KL + +R+  
Sbjct: 993  LCTQNNLLHEQLNATLDLEDTQN-------KDDIKDIIVCMKRERDTLQKKLAIVEREGE 1045

Query: 1171 NLKQKLEFTEQEL-SVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRN 1229
             L+++    + EL +V+K +    Q  +   S ++  + KIL++L +V+LLRE+N++L  
Sbjct: 1046 VLRERCAGLKSELDAVSKGQ----QWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLT 1101

Query: 1230 ELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQD 1289
            E+ +    N  L   + ++++   PL++     +R    KD++ISL  +E+ RWK+R Q 
Sbjct: 1102 EVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQ 1161

Query: 1290 ILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDNARTTQN 1349
            ++ + +     E                        L ++FQ LKKQA E+LD  +    
Sbjct: 1162 MVHRQDDTLGLE-ANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQ 1220

Query: 1350 TLNAELTEARESQKALEDALDKEREKTRSLQESIK 1384
            TLN +L+E + S   LE+ + ++ +K R ++ ++K
Sbjct: 1221 TLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLK 1255

 Score = 67.4 bits (163), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 75/110 (68%), Gaps = 3/110 (2%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPA 1595
            ++T++RIEEA E L++ IRLP+EEKI +IIE R+ EL+ +F+ +++++ + +A       
Sbjct: 1382 EQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADM 1441

Query: 1596 TFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
            +  E+ ++ ++E+E     +++++  ++   + KAF+EGK+QA MK+  L
Sbjct: 1442 SPDELKQKVRRELEHA---IEQDLQAKLETIRTKAFEEGKRQAEMKTTLL 1488

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  221 bits (562), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 185/606 (30%), Positives = 317/606 (52%), Gaps = 34/606 (5%)

Query: 19  DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78
           D ++SF +L      ++      +I  K  +   L  EN   S  ID+++     K+   
Sbjct: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTI 71

Query: 79  KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARN-------EALEQQK 131
             +  +L  E + ++ +       R +  +E+Q+  + +D L +         EA+++  
Sbjct: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 131

Query: 132 QVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHK 191
             LEA +     +L +        + E +  L E   L++Q    EG+      E     
Sbjct: 132 TTLEARERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLAN 184

Query: 192 ADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQ-RLETCEGDLQAA 250
            +  +L   + LL  NN +LE +  + +     Y   + +E AS  Q +L+    ++ + 
Sbjct: 185 TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLY---SSAEDASRLQDQLQIVSSEILSL 241

Query: 251 TKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSAL 310
              I TL+  N    ++L+ +   +K L D L S+KQEF +E++LKQR+ ELL  ++++ 
Sbjct: 242 KSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY 301

Query: 311 KSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT 370
           K ++E   S    T       + +I  ELV   ++L  SE +  +L+ TV++ ++ DEK 
Sbjct: 302 KKQIERLTSKNLET------PEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK 355

Query: 371 ISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLE 430
           +      P     I IL++Q++ E+R K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE
Sbjct: 356 LISKFGNPKKL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLE 413

Query: 431 KELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVT 490
           +EL      L+  +K++D    +L   + +I + E     L +QRSDLA QVQYLL+ + 
Sbjct: 414 RELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI- 472

Query: 491 VRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTV 550
              D+  P + +E   VKK+V+ ENT+ D D+  IIS+RL+ F+N+ ELQ KN +LL T 
Sbjct: 473 ---DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTT 529

Query: 551 RNLANQLETEERKVKSKTEAIENDTITE-AKEAIVTLQDHIQELETRIDVITRERDAYKA 609
           R L   LE +E++ +      +N+ I E AK   V L+ HI+ LE++I++I++ERD+YK 
Sbjct: 530 RQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKL 589

Query: 610 IQSQTS 615
           + + ++
Sbjct: 590 LVTNST 595

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 71/107 (66%), Gaps = 11/107 (10%)

Query: 1539 IKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFT 1598
            +KRI EA E L+KR+RLP+EEKIN +IE R++ L++EFE KL+        E  L A   
Sbjct: 1363 LKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR--------ELGLNADGN 1414

Query: 1599 EVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
             V+   + ++EK   +++ + + E+A+ KKKAF+EGKQQ+ MKS  L
Sbjct: 1415 GVVTDTRAQIEK---ELREKFNLELAEIKKKAFEEGKQQSMMKSTLL 1458

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  214 bits (544), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 246/991 (24%), Positives = 483/991 (48%), Gaps = 42/991 (4%)

Query: 126  ALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKS 185
             L+++K   +  KN++ +LL E+I  I TL+ +  ++++E + L + + +L  +    K 
Sbjct: 62   TLQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKD 121

Query: 186  EELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEG 245
            E+L  +    +++  +SL     +  ES+   K   F +Y+ R + E  +V + L   + 
Sbjct: 122  EKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDN 181

Query: 246  DLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEG 305
            +L+        L ++N +   +L G+   +K L + L ++  +F  E  L+ +L+  L+ 
Sbjct: 182  ELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQN 241

Query: 306  QVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLS 365
            Q+  L+ +LE  +  +          + ++  ++ +  ++LE SE +   L  ++E+  +
Sbjct: 242  QIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQN 301

Query: 366  ADEKT-------ISG-SQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVP 417
              E+         SG + S   L  D+ IL+K  + ER+QK  L+ Q+   + ELE  +P
Sbjct: 302  IPEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMP 361

Query: 418  MLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSD 477
             LSS+K+R+  LEKEL  +  +L+ I K+  + +A+L++ +S+  +L S I++L  QR+ 
Sbjct: 362  SLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTV 421

Query: 478  LARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIV 537
            LARQV+YLL+ +         L  ++   + + +     +   D++ I+ ERL +FKN+ 
Sbjct: 422  LARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVK 481

Query: 538  ELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRI 597
            ELQ +N  LL   R LA++ E  E+    +  + E++TI +AKEAI+ LQ++ Q+LE++I
Sbjct: 482  ELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQI 541

Query: 598  DVITRERDAYKAIQSQTSHEG-SNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANV 656
              ++ E     A+Q +   E  S   +  +   AS ++     +L + LSA  + ++  +
Sbjct: 542  KELSDEL----AVQKKEKTEKESISAMSKIEDDASSHT----IDLGKQLSANLKHSKDII 593

Query: 657  KLLMTENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLE 716
              L +E + L ++ +++ ++++KEKS+R LAE+R             E EEL +    L+
Sbjct: 594  DALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQ 653

Query: 717  NNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQ-KLKETNEQLTKER 775
             N+  ++ +   +  + I CKS+L+T  AE+  S+  EN L+   Q  L+   E L  ER
Sbjct: 654  QNILDKEKQFSYSSRDYISCKSKLSTAEAEI-TSLRAENELSIETQTTLRTKKEALLNER 712

Query: 776  NEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTS 835
            N              E  TLLK++   +  K+     + +Q    L      +S+  S +
Sbjct: 713  NNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQN 772

Query: 836  DSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLN 895
            DS  +WY+  ID L   +     +L  K + I+E          +L  A +K        
Sbjct: 773  DSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELTLANSK-------- 824

Query: 896  QTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTI 955
               DV  +  AL  EL + +  L+ +  +V EY+ + +++K +    +   E   +    
Sbjct: 825  ---DVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALAS 881

Query: 956  EVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALAS 1015
            ++++  +ER  L  + + L+ ++     EL    N L  L+  ++    E K+ K   A 
Sbjct: 882  KLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAE 941

Query: 1016 MKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHS 1075
            ++    ++               +   ++YE+ +Q ++++SK +  LREE  K++     
Sbjct: 942  LRSVIAVKTGNY-----------DSLSKSYERIMQENSELSKVVELLREEV-KNRTSNGE 989

Query: 1076 LEASITELKKSLEENESCWAAQKQEYETQAS 1106
             E  + + +  +++ +  W  +K+ +E Q +
Sbjct: 990  KEGDLEDTESIIKKGQDVWDEEKKVFEVQIT 1020

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 4/106 (3%)

Query: 1540 KRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTE 1599
            K++ +A E L+KRIRLPTEEKIN IIE RK EL+  FE K+++    L     L +   +
Sbjct: 1230 KKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLL----LHSDDDK 1285

Query: 1600 VMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
            + K +K+  E  +  +++E DE++   +KKAF+EGKQ   MKS FL
Sbjct: 1286 IKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFL 1331

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 147/483 (30%), Positives = 254/483 (52%), Gaps = 35/483 (7%)

Query: 396 RQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLK 455
           +Q   L++ ++ ++ ELE ++P++ +FK   + L+  L +   +++S+  DK E    + 
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268

Query: 456 RTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMEN 515
             K  I +  S I AL  QR+DLA Q+QYLLI  +++ D++GPLS  E  F++ ++N + 
Sbjct: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328

Query: 516 TQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDT 575
            +   D Q +IS+RL++FK+IV LQ KN +L  ++RNLA  LE++E ++K+  E  +NDT
Sbjct: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388

Query: 576 ITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASE--- 632
           I EAKE I++LQ++   L+  I            +QS+ S   S+      N+K SE   
Sbjct: 389 INEAKETILSLQEYNNVLKLEIG----------TLQSKISELQSSIP----NSKESEKQH 434

Query: 633 ---NSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEE 689
              +S+L +++LE  LS     +++ ++ L  + Q L   ++++++N+EKEKSS +LA E
Sbjct: 435 FNYHSNL-VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANE 493

Query: 690 RXXXXXXXXXXXXQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKN 749
           +             ENEEL+ +  +LE  L +++      +++ I CK+ L   +  L  
Sbjct: 494 KLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRL-- 551

Query: 750 SIAKENLLNTSHQKLKETNEQLTKERNEXXXXXXXXXXXXKERDTLLKDSDDNFKGKIDS 809
                 LLN +   L+E N  L +E               K  +  L++    +  K+  
Sbjct: 552 -----TLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKE 606

Query: 810 LEAEISQLR-------TLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNS 862
           LE  IS+L          L  K  E+ D  S++  +  WYQ+K+D   + +K+  S L +
Sbjct: 607 LELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPA 666

Query: 863 KTQ 865
            TQ
Sbjct: 667 DTQ 669

 Score = 75.9 bits (185), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 68/106 (64%), Gaps = 22/106 (20%)

Query: 1540 KRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTE 1599
            KR+ EA E L+++IRLP+EEKIN IIE++  +L+E+++ KL+  ++E             
Sbjct: 1105 KRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE------------- 1151

Query: 1600 VMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
                   ++EK    +K+E ++ +  AKKKAF+EGKQQASMK+ FL
Sbjct: 1152 -----STDIEK----IKQEFEDNLVNAKKKAFEEGKQQASMKTKFL 1188

 Score = 75.1 bits (183), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 151/304 (49%), Gaps = 29/304 (9%)

Query: 1111 RIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDES 1170
            R+++L+TQNRLL ++  L+ + ++ ++D        +  +L+ E D L  ++   ++D  
Sbjct: 734  RVQNLATQNRLLLEK--LERSANLEVDD--------IFVSLRYERDTLSDQVVNYEKDMQ 783

Query: 1171 NLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSK-------ILEQLNQVNLLRES 1223
             +   LE  + EL+ A S+I    +  + +  M++++ K       ++E+L +++ L+E 
Sbjct: 784  VILADLESVQSELNAANSQI----LNFENQRAMVQDHKKGNVNEETLIEKLTELDELKER 839

Query: 1224 NITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRW 1283
            N+ L  E+   ++ N  L+  +EE  E LKPLE  I  L   +  KD  I++  E+   W
Sbjct: 840  NMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENW 899

Query: 1284 KQRSQDILLKYERVDPEEHKKXXXXXXXXXXXXXXXXXXXXXLEDRFQRLKKQARERLDN 1343
            K R  ++ L  +  D E+                        L DRF RLKKQA ERL  
Sbjct: 900  KTRFNELTLSAKNNDNED-------LINLQKQVEEKSKENEELSDRFNRLKKQANERLHA 952

Query: 1344 ARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQD 1403
            ++  QN L  +  E +     LE  L ++ E+ + L+ SI + ++ E+ +    ++QL +
Sbjct: 953  SKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSI-SLKDQELGSIGDLKEQLAN 1011

Query: 1404 ALQK 1407
            AL K
Sbjct: 1012 ALDK 1015

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  134 bits (337), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 187/740 (25%), Positives = 345/740 (46%), Gaps = 56/740 (7%)

Query: 143 QLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQKVS 202
           Q L+E++ +I TL+    R+  E   L  +  ELE +    K   L  K +  ++S   +
Sbjct: 57  QTLHEQLNNI-TLKYN--RVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYN 113

Query: 203 LLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGD-LQAATKTIKTLREQN 261
            L + N  LES L+  N   N      Q +   +++ +   + D L   TK  K L+  N
Sbjct: 114 SLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYN 173

Query: 262 GQKES---------ELEGQFQAVKKLTDELTSAKQ----EFTREM-SLKQRLVELLEGQV 307
             K++          L+  F++  KL DE+   K       T E+ SLK R       ++
Sbjct: 174 DTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNR-------EI 226

Query: 308 SALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSAD 367
           +   S++  +    +S      E Q  + + L++  ++++E +LK+ +L  TV +  S  
Sbjct: 227 NEHSSDINIEYGKNSSIIVDKQEYQRLLNEALIN-NEKIDEYDLKVARLTATVNEFQS-- 283

Query: 368 EKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRND 427
            KT     S  D + D  ILKK++     Q++ LQ ++E  + ELEN  P L++  D+ +
Sbjct: 284 -KTGINFVSTDD-FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIN 341

Query: 428 VLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLI 487
            LE  L++     +       E   + K   S+++  + +I  L ++ +DL  Q+Q++LI
Sbjct: 342 ELELLLSKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLI 401

Query: 488 QVTVRGDSHGPLSAEETAFVKKVVNMENTQPDG----DAQGIISERLVEFKNIVELQAKN 543
             +++ D +G L+  E  F+ K +  + T+       ++Q IIS+RL+ F++++ LQ KN
Sbjct: 402 SNSIQNDKYGELTENEIKFI-KALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKN 460

Query: 544 ADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRE 603
            +L+ T+R +  +L+ +E ++++K EA  +D + EAKE I+ +     +L+ +I  + ++
Sbjct: 461 MELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ 520

Query: 604 RDAYKAIQSQTSHE--GSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMT 661
            +A + +    SHE  G    L + N   +E   L + EL+  +    ++A   + +   
Sbjct: 521 LNANRPV----SHEKNGHESVLAE-NKLYTEGDRLILDELKNNIPEFTKQASNIISMNFD 575

Query: 662 ENQELARSKSELVVNVEKEKSSRLLAEERXXXXXXXXXXXXQENEELNKRGLVLENNLAK 721
           +   L     EL  +  K   SR + +++              NE+L +   V+++ + +
Sbjct: 576 QLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRR 635

Query: 722 QDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNEXXXX 781
           +D     TI+  +DCK+ L +++ ++       N L T + +LK   +Q ++  NE    
Sbjct: 636 KDETLNSTIANHVDCKASLLSVTNDM-------NSLMTKYDELKYLKDQQSRITNELKME 688

Query: 782 XXXXXXXXKERDTLLKDSD-------DNFKGKIDSLEAEISQLRTLLSQKATELSDFMST 834
                       T+   SD        +   KI+ LE   S L   L  K  EL DF+ST
Sbjct: 689 REQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFIST 748

Query: 835 SDSRSRWYQEKIDALNECLK 854
            +    WYQ+K D  +  LK
Sbjct: 749 KNRELDWYQKKFDIFSTMLK 768

 Score = 38.5 bits (88), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%)

Query: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATE 1387
            DRF RLKKQA  RL +++  QN LN +++  ++    ++  L+ + +  + L+  IK+TE
Sbjct: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQIKSTE 1048

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 116/210 (55%), Gaps = 9/210 (4%)

Query: 383 DIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLD- 441
           +I  +K ++I E+ +K  L+ +   F+ ++E+K+P L     +N+ +E E      + + 
Sbjct: 282 NIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIEEQ 336

Query: 442 SISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLI-QVTVRGDSHGPLS 500
            I  + D    + +  K ++ D ES +  L QQRSDL  Q+ YLLI Q  +  D++  L+
Sbjct: 337 KIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILT 396

Query: 501 AEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETE 560
             E  F++ +V         + Q IISERL++F N+ +L AKN  L+  VR L N++E+ 
Sbjct: 397 ENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESI 456

Query: 561 ERKVKSKTEAIEND--TITEAKEAIVTLQD 588
           E++   K   +E D  +I EAK+ ++ L++
Sbjct: 457 EKQNSQKFGDLEMDFKSIDEAKQRMIVLKE 486

 Score = 37.4 bits (85), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 6/86 (6%)

Query: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIK--- 1384
            DRF RLKKQA+++L+  + T+N L  +  +  +S+  LE  L       +SLQE I    
Sbjct: 772  DRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKMK 831

Query: 1385 ---ATEENEIENSSATRDQLQDALQK 1407
                T  NE++N+  ++++L++  +K
Sbjct: 832  DELMTSNNELDNNQRSQEELRNEYEK 857

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 75/111 (67%), Gaps = 9/111 (8%)

Query: 1536 QRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPA 1595
            ++T++RIEEA E L+K IRLPTEEKI ++I  RK +L+E+F+ K+ ++ + L        
Sbjct: 1341 RKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLK------- 1393

Query: 1596 TFTEVMKRHKQEVEK-LKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFL 1645
              +E+  +   E+EK ++ ++K  ++E+    KKKAF+EG+QQASMK+  L
Sbjct: 1394 -LSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLL 1443

 Score = 75.9 bits (185), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 143/594 (24%), Positives = 265/594 (44%), Gaps = 74/594 (12%)

Query: 797  KDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKST 856
            K S++    KI  L  E   L   L+ K  E+  F+  S+ + +WYQ+ ID L+E  K+ 
Sbjct: 677  KRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNK 736

Query: 857  TS---DLNSKTQMIQEXXXXXXXXXXKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEK 913
            ++   +LN K +++ E                      S+ N+   V T+   L++EL  
Sbjct: 737  SNKIIELNDKLRLLSEK---------------------SLSNKPYPVGTELKELQNELNG 775

Query: 914  TRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAV 973
             +  L+ + SQ   YK      +      T + +++  +   + E L K+ + L N    
Sbjct: 776  MKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITE 835

Query: 974  LKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKS---NKTALASMKDQYQLELSKLTED 1030
             ++Q   +  +L++Q  +++ L  E    EE++ S   ++  +A MK +Y  ++ K+  +
Sbjct: 836  TENQSKGI--QLEHQ-TIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESN 892

Query: 1031 LNQQA---MYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSL 1087
            L  Q+   +    A  + E+EL  +A     I QL  E  K  + + +L       K  +
Sbjct: 893  LKIQSDTRLNFESALTSKEKELTSYA---VQIEQLNTEIAKLNSDIAALTEPAEARKTLI 949

Query: 1088 EENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLK---DTDSIPINDELKSEA 1144
            +E +S     K        L++QRIE L+ QN +L+D  S     D D+ P N++L    
Sbjct: 950  KERDSLGQELK--------LANQRIESLAAQNSILYDTFSGMRHVDADAEP-NEDL---- 996

Query: 1145 RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMI 1204
            R L+  L+ E D+ Q++   A+RD   LK+ L+   ++L++   EI +   T      + 
Sbjct: 997  RNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLT 1056

Query: 1205 EENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQR 1264
              + KI+ +L  +   +E N+ L              + +++ L E  + L+ ++  L+ 
Sbjct: 1057 VTHEKIMRELEGLTNTKEENLYL--------------DESIKSLNEDKRTLQEEVSRLRE 1102

Query: 1265 SVGAKDKQISLITEE-----VNRWKQRSQDILLKYERVD---PEEHKKXXXXXXXXXXXX 1316
            S     K  S I+E+     +  ++Q S+   L  +++      E +             
Sbjct: 1103 SEELAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSENTATEIQNLQQQLETFKADI 1162

Query: 1317 XXXXXXXXXLEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALD 1370
                     L DRF RLKKQA E+L+ ++ T ++L  EL+E +    AL++ L+
Sbjct: 1163 QLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLN 1216

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 73.2 bits (178), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 85/177 (48%), Gaps = 39/177 (22%)

Query: 1540 KRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTE 1599
            K+I EA E L+KRIRLPTEEKI+KIIE +K +L++EF+ K+++R   ++    +   F +
Sbjct: 1526 KKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQK 1585

Query: 1600 VMKRHKQEV------------------------------EKLKAD----MKREMDEEVAQ 1625
             ++   QE                               +KL+AD    ++ E + E+  
Sbjct: 1586 QLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQT 1645

Query: 1626 AKKKAFDEGKQQASMKSMFLXXXXXXXXXXXXXXXXXPDDTTVNSPDRKQLDKPSPI 1682
             KKK+F+EGKQQA MK+  L                     +V+SP +     P+P+
Sbjct: 1646 IKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQ-----SVDSPPKHLSKMPNPL 1697

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 101/468 (21%), Positives = 201/468 (42%), Gaps = 69/468 (14%)

Query: 191 KADFHQLSQKVSLLNTNNEWLESQL--NQKNSEFNA----YRQRTQSELASVSQRLETCE 244
           K +  +LS K +LL  N +WL  +L  +QKN   +     Y  +  ++L +   +L   +
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80

Query: 245 GDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQE--FTREMSL-KQRLVE 301
            +   +    + L ++  +   E   +F +V  + D L + K    F ++++L  +R   
Sbjct: 81  KEFLISHN--EKLSDRLNENSIEFNDKFNSV--VIDNLNNEKNLILFEKKLNLLNERYSI 136

Query: 302 LLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVE 361
           +++ Q   + +++          ++   E +S + ++++ +   ++  E KI+KL   + 
Sbjct: 137 IIKDQKDVIDNDI---------NNSKYLEFKS-LNEKIIKQNSNMKSMESKIEKLNAIIH 186

Query: 362 QLLSADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSS 421
             +  +E     +        D  +LKK ++HE+     LQ ++ + ++EL  K+P L+S
Sbjct: 187 NFIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTS 246

Query: 422 FKDRN----DVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSD 477
            K++N     V E  ++    +L     + D+ A+      ++I D E  +  L  QR++
Sbjct: 247 LKEKNHELQSVFENIISSNEELLQQFHSNTDKIAS----MNNKIVDYEQSLKQLLSQRTN 302

Query: 478 LARQVQYLLIQVTVRGDS--HGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKN 535
           L   + Y+L  + V   +  +  LS  E   ++ + N E  Q           R ++ KN
Sbjct: 303 L---ISYILNLLNVINLNSKYLNLSESEGCLIQNLFNNERIQ-----------RFLQEKN 348

Query: 536 IVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELET 595
           +   +    D L+TV    N     + KV   TE+   + I   K  I+ L+++      
Sbjct: 349 LTLTEI--FDNLNTVDITFNNFNRSDIKVLPPTESASKEEIINYKNEIILLENNC----- 401

Query: 596 RIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEE 643
                    DAYK I        +NG   D++ K    S  ++ EL E
Sbjct: 402 ---------DAYKMIL------YNNGITEDLDEKLKIESSSRMTELNE 434

 Score = 33.5 bits (75), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 7/40 (17%)

Query: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALED 1367
            D+F RLK+QA ERL+ ++TTQ        E  ++ K+LED
Sbjct: 669  DKFSRLKRQANERLNASKTTQ-------KELSDNVKSLED 701

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309c IMH1
          Length = 867

 Score = 38.5 bits (88), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 129/285 (45%), Gaps = 46/285 (16%)

Query: 897  TDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIE 956
            T ++ T+  AL  EL K R +LK    +++E + +       L      ++++  +   E
Sbjct: 331  TVEIETKNSALEEELVKVRDSLKQKNIEIEEVRDMLREVGNDLVDARDQIKNANSNAGKE 390

Query: 957  VETLKKERDALSNDAAV-----------LKDQLANLNSELDYQK-NLLETLKHEHNKCEE 1004
            VE +KKE D L +  A            LK ++A+LN E+   K N    LK +    ++
Sbjct: 391  VEEVKKELDNLRSKNATMIETYEKTQLELKAKIASLNGEISEMKLNQTTILKEKEIASKD 450

Query: 1005 EVKS----NKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTIS 1060
             ++     NKT  A +KD   ++L+ LT                     QR     KTI 
Sbjct: 451  AIEKLSDENKTLKAQLKDINAIKLT-LT---------------------QRE----KTIG 484

Query: 1061 QLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYET---QASLSSQRIEDLST 1117
             L E+ +++  K   ++A+I +L+K L+  ES     + E E+   +A  +   +E+   
Sbjct: 485  YLEEQVKQYNEKNAVVQATIEKLEKELKSKESQLTTIQNENESLKKEAKTNVVSLENYLK 544

Query: 1118 QNRLLFDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKL 1162
            +N  L +++S+   +       LKS + E + ++KR+C+ L  KL
Sbjct: 545  ENGKLSERLSILQ-EKYDTAQNLKSNSNEQVDSIKRQCNELNVKL 588

>Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 36.6 bits (83), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 101/430 (23%), Positives = 186/430 (43%), Gaps = 80/430 (18%)

Query: 882  RDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTA 941
            R+ E   Q Y +    + ++++ +++  + EK   N          ++ L  S+ E +  
Sbjct: 320  RNEELTDQIYQLNQNLNSLISKNESISFQYEKLSKN----------HQHLIDSSTEKIER 369

Query: 942  MTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNK 1001
            ++T  E+      I+VE  KK    L+ +  VL      L  + D     L+ LK+EH K
Sbjct: 370  LSTERENG----VIKVEKFKKRIKELNTEIKVLNSNQKILQEKFDDSITDLDQLKNEHEK 425

Query: 1002 CEEEVKSNK-------TALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHAD 1054
                 + N+         L +MK++  + L KL+E    Q                +  D
Sbjct: 426  TVNNFQRNEKLLNEKNVELENMKEELSINLEKLSE---SQV---------------KIND 467

Query: 1055 VSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIED 1114
            ++  ++QL ++     N +   E  +  LK SL+E      +  ++++  A L +Q  E 
Sbjct: 468  LNSCVAQLNDKIGDIHNTLDCKEDELNNLKLSLKE----TLSMSKDFD-DADLITQLNEL 522

Query: 1115 LSTQNRL---LFDQISLKDTDSIPINDELKSEAREL------ISTLKRECDILQTKLELA 1165
            +ST+N L   + D  SL D +   +NDELK     L      I++L  E + L+ +++L 
Sbjct: 523  ISTKNSLQQKINDLGSLNDDNLKSLNDELKENKNTLSLKDSEINSLNDEINELKKQIDLK 582

Query: 1166 KRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSI-------------MIEENSKILE 1212
              +        E  E E     ++IR ++VT   + I             + E  +K+L+
Sbjct: 583  DEEFKTWHNNYENVEDE-----AKIRSAEVTELNKDIEDLKESKLQLVETISELENKVLK 637

Query: 1213 QLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLEN---DILTLQRSVGAK 1269
              N+ NL +E       EL+    +N +++       E +K LEN   ++++LQ  +G  
Sbjct: 638  VENEYNLEKEKFEKTSLELESLQLKNSNIQ------AEHIKELENLHENLVSLQNELGIS 691

Query: 1270 DKQISLITEE 1279
              +ISL+T+E
Sbjct: 692  SDRISLLTKE 701

>Skud_15.258 Chr15 complement(453837..458780) [4944 bp, 1648 aa] {ON}
            YOR093C (REAL)
          Length = 1648

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 22/153 (14%)

Query: 930  GLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQK 989
            G+Y      L ++T  L   K+   I ++ L  +   L         +L N  S LD   
Sbjct: 1232 GIYTGASTCLFSLTDVLTDPKE-FLIGLQNLNVKDLYL---------RLENFYSLLDRAS 1281

Query: 990  NLLETLKHEHNKCEEEVKS--NKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQ 1047
            NL+E  KH+    +E + S  N T+ +  +D ++   + +   LN+  +Y        E 
Sbjct: 1282 NLIEGSKHK----KENISSGKNNTSSSVREDIFKGVRNIMIPFLNRPRVYT------IEN 1331

Query: 1048 ELQRHADVSKTISQLREEAQKHKNKVHSLEASI 1080
             L+R+  +S T +Q+    Q H N V SL + +
Sbjct: 1332 ILKRYPTISLTPTQINYVYQHHFNPVISLRSYL 1364

>Ecym_8258 Chr8 complement(525029..525631) [603 bp, 200 aa] {ON}
           similar to Ashbya gossypii ACR043W
          Length = 200

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 15/123 (12%)

Query: 414 NKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQ 473
           NK+ ++   KD  DV+E+   +  ++ DS S+++ E   DL+ T+ QIR L  QI+A   
Sbjct: 76  NKLVLVMVDKDEGDVVERWEFDVQHITDSGSEEQSEHNNDLEETQKQIRALMRQITASVT 135

Query: 474 QRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEF 533
              +L  +               G  +    A+     N+     D D + I    +V+F
Sbjct: 136 FLPELKNE---------------GNYTFNVLAYTDANANVPMEWADSDGKEIADGEVVQF 180

Query: 534 KNI 536
           +N 
Sbjct: 181 RNF 183

>YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON}
           COY1Golgi membrane protein with similarity to mammalian
           CASP; genetic interactions with GOS1 (encoding a Golgi
           snare protein) suggest a role in Golgi function
          Length = 679

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 161/357 (45%), Gaps = 52/357 (14%)

Query: 42  QIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQ 101
           ++ AK  +  QL++EN   S + ++ R S+SH +   K+Q++S++ E E+ ++E   LE 
Sbjct: 275 ELHAKELKLNQLESENALLSASYEQERKSTSHAINELKEQLNSVVAESESYKSE---LET 331

Query: 102 RRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETER 161
            R + +       N SD  + + E    +K     N++D    +  +  +  T +     
Sbjct: 332 VRRKLN-------NYSDYNKIKEELSALKKIEFGVNEDDSDNDIRSEDKNDNTFESS--- 381

Query: 162 LLQEARTLRQQNLELEGQARVYKSE--ELKHKADFHQLSQKVSLLNTNNEWLESQLNQKN 219
           LL   + L+    E   ++   + E  ELK   D  QL Q+++ L   NE LE+ L +K 
Sbjct: 382 LLSANKKLQATLAEYRSKSTAQEEERNELKKSVD--QLKQQIATLKEANEKLETDL-EKV 438

Query: 220 SEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLT 279
              + +   T S ++ V++++        + T +I  + E     + EL G    +  + 
Sbjct: 439 ENVSPHFNETASMMSGVTRQMNNRTSHKMSPTSSIIGIPE-----DGELSGNQSTILPI- 492

Query: 280 DELTSAKQEF-TREMSLKQRL-------------VELLEGQVSALKSELEF------KNS 319
             +T  +  F +R M L+++L             +  L+G  + L   + +       N+
Sbjct: 493 --VTKQRDRFRSRNMDLEKQLRQGNSEKGKLKLEISKLKGDNTKLYERIRYLQSYNNNNA 550

Query: 320 P-QASTDAATTESQ-SQIEDELVHKTQQLEESEL---KIQKLEQTVEQLLSADEKTI 371
           P   ST+    ESQ S++ DE +H      ++EL   K +KL   +E+L S+  K I
Sbjct: 551 PVNQSTERIDVESQYSRVYDESLHPMANFRQNELNHYKNKKL-SALEKLFSSFAKVI 606

>Kpol_1056.2 s1056 complement(3670..4020) [351 bp, 116 aa] {ON}
           complement(3670..4020) [351 nt, 117 aa]
          Length = 116

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 9/68 (13%)

Query: 233 LASVSQRLETCE-GDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTR 291
           LA +S + E  E G+L+A     + L+E + +   +LEG+ +  +KL DELT    EFT 
Sbjct: 45  LAEISGKYELKESGELEA----FRLLKEDHVKMLDQLEGKIEYYEKLLDELT----EFTS 96

Query: 292 EMSLKQRL 299
           E+ +K+++
Sbjct: 97  EIEIKRKI 104

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
            Anc_8.604 YOR195W
          Length = 756

 Score = 33.5 bits (75), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 162/343 (47%), Gaps = 60/343 (17%)

Query: 967  LSNDAAVLKDQLANLNSELDY---QKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLE 1023
            L ND   LK ++  L S++D    +KN L T      K  +E +S KT++  +K     E
Sbjct: 275  LHNDK--LKMEVKQLISKVDSLVKEKNKLSTDAEGATKLRDENESLKTSIGELK----TE 328

Query: 1024 LSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITEL 1083
            LS L  D NQ  +     QE Y+Q              +  E +K ++    ++  I  L
Sbjct: 329  LSML--DSNQTLL-----QEKYDQ--------------IYSEYEKSQSTTDFMKKEIESL 367

Query: 1084 KKSLEENESCW---AAQKQEYETQASLSSQRIEDLSTQ-------NRLLFDQISLKDTDS 1133
            +KSLE++ +     +   +E E++ S   Q  +++  +       N+ + +Q+S KD + 
Sbjct: 368  QKSLEDSANILEELSEHSKELESKLSTVEQEKKNMEEEKLKLLKENKHVMNQLSGKDNEI 427

Query: 1134 IPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKS 1193
            +     L+ + ++L+++ +     L  ++ +   ++ +L+++++ +E +    +SEI + 
Sbjct: 428  V----SLEGKIKDLVNSERNHSKSLIDQIAVLTNEKMSLEEQVKKSENQF---QSEISEL 480

Query: 1194 QVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEA-- 1251
            Q T      + E+ S++L+    +N  +E N  L NE+  +++  Q L++  EE  +   
Sbjct: 481  QDT------LKEKESELLDTTRALNDAKEDNTKLINEMMDRTKEVQSLKKTYEEANDHAS 534

Query: 1252 -----LKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQD 1289
                 +  L N I TL+ S    +  I L+ E++  WK + +D
Sbjct: 535  VRTAEVTELNNQIETLKESQRHLETTIDLLQEKIGTWKSKYED 577

>TBLA0B00270 Chr2 (49747..50409) [663 bp, 220 aa] {ON} Anc_2.33
            YNL214W
          Length = 220

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 10/83 (12%)

Query: 1075 SLEASITELKKSLEE--------NESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQI 1126
            S+  +IT + K L +        N S W ++  + +  +++ + +IE  + Q RLL DQ+
Sbjct: 129  SMYGAITRINKHLTDCNKRLIRFNNSEWRSRDTDNDEDSAIMNSQIELFNFQARLLVDQL 188

Query: 1127 SLKDTDS--IPINDELKSEAREL 1147
             L D  S    I++E+ +  REL
Sbjct: 189  ELSDNSSELAKISNEITTNIREL 211

>KAFR0A06150 Chr1 complement(1246051..1248003) [1953 bp, 650 aa]
           {ON} Anc_4.217 YLR369W
          Length = 650

 Score = 33.5 bits (75), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 892 SVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQ 951
           ++L Q  D++T+ D + S+ E++  +L+ + S+ +EYK L     E + AM    +    
Sbjct: 555 NILRQRMDLITKADIMISDTERSFKSLEKSMSEDEEYKELKQEI-EAIRAMINTFKKEIN 613

Query: 952 DHTIEVETLKKERDALSNDA 971
           D  ++V  +KK  DAL N+ 
Sbjct: 614 DTKLDVNVIKKTTDALQNNV 633

>KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {ON}
            weakly similar to uniprot|P39723 Saccharomyces cerevisiae
            YAL047C SPC72 Component of the cytoplasmic Tub4p
            (gamma-tubulin) complex binds spindle pole bodies and
            links them to microtubules has roles in astral
            microtubule formation and stabilization
          Length = 776

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 18/141 (12%)

Query: 988  QKNLLETLKH-EHNKCEEEV------KSNKTALASMKD---QYQLELSKLTEDLNQQAMY 1037
            QK LLE++ + EH +  +++      +S     +S+ D   +  +ELSK  +D       
Sbjct: 418  QKLLLESMSNIEHERTSQQIPPLYLQRSQSDLFSSIDDLSKRASIELSKSYQD---HVDA 474

Query: 1038 ANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEAS--ITELKKSLEENESCWA 1095
             N   +NY++EL+   D  K + +LR + +   N    L+ +  I E   +LEEN + W 
Sbjct: 475  LNSMLQNYKRELE---DKEKQLGELRSQLRNSYNTNTELDLANKIKEQSLTLEENSARWH 531

Query: 1096 AQKQEYETQASLSSQRIEDLS 1116
             Q+ EYE++  +     +DLS
Sbjct: 532  TQRIEYESRIEVLQDEKKDLS 552

>CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [2463 bp,
            820 aa] {ON} similar to uniprot|P31111 Saccharomyces
            cerevisiae YDR285w ZIP1
          Length = 820

 Score = 33.5 bits (75), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 29/109 (26%)

Query: 924  QVDEYKGLYASTKETLTAMT-------TAL---------EHSKQDHT-IEVETLKKERDA 966
            +++EYK L+ S  E L+ ++        +L         + SK D + IE+E+LK + + 
Sbjct: 186  KINEYKSLFESLNEKLSVLSHQKIQNEKSLKEFVTFQEEQKSKLDKSQIEIESLKSKLNE 245

Query: 967  LSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKC-----EEEVKSNK 1010
              N   V+K+ L   +SE+D+       LK E ++C     EE++KSNK
Sbjct: 246  GKNILDVMKNDLMQKSSEIDF-------LKKELDECSGLLSEEKIKSNK 287

>Kpol_1028.22 s1028 complement(59190..59789) [600 bp, 199 aa] {ON}
            complement(59190..59789) [600 nt, 200 aa]
          Length = 199

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 1326 LEDRFQRLKKQARERLDNAR------TTQNTLNAELTEAR-ESQKALEDALDKEREKTRS 1378
            + D F + KK  +ERLDNA         +NTL ++  ++R E    +++ LDK + K  S
Sbjct: 1    MSDSFIQYKKSIKERLDNADLLVSKVIHENTLLSQQLDSRNEEISYMKEKLDKHKTKVDS 60

Query: 1379 LQESIKATEEN 1389
            L + I    EN
Sbjct: 61   LNDKITKQNEN 71

>KNAG0C01530 Chr3 (303316..306102) [2787 bp, 928 aa] {ON} Anc_1.268
            YKR028W
          Length = 928

 Score = 33.1 bits (74), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 957  VETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASM 1016
            + T+ K   +LSN   ++ + +   NS+ D+ + L  TL+  H  C+ +   + T L  +
Sbjct: 352  ITTMLKGGTSLSNGVGIIIELIRKNNSDYDFIQVLYTTLE-THPPCDRD-PIHLTYLIKI 409

Query: 1017 KDQYQLELSKLTEDLNQQAM 1036
              QY  + +KL E L +  M
Sbjct: 410  FAQYMPQFAKLLESLKRTGM 429

>NCAS0B08240 Chr2 complement(1570244..1571257) [1014 bp, 337 aa]
           {ON} 
          Length = 337

 Score = 32.7 bits (73), Expect = 8.7,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 14/137 (10%)

Query: 234 ASVSQRLETCEGDLQAATKTIKTLREQ--NGQKESEL--------EGQFQAVKKLTDELT 283
           A+VSQ     +G +QA TKT K    Q  +GQ ++          +GQ QA  K T    
Sbjct: 80  AAVSQ---IADGQIQATTKTTKAAVSQINDGQIQAATKAAVSQIGDGQIQAATKTTKAAV 136

Query: 284 SAKQEFTREMSLKQRLVELLEGQV-SALKSELEFKNSPQASTDAATTESQSQIEDELVHK 342
           S   +   + + K  + ++ +GQ+ +A K+             A T  + SQI D  V  
Sbjct: 137 SQINDGQIQAATKAAVSQIGDGQIQAATKTAAAVSQIADGQVQATTKAAASQIGDGQVQA 196

Query: 343 TQQLEESELKIQKLEQT 359
           T +   S++   +++ T
Sbjct: 197 TTKAAASQITDGQVQAT 213

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 26/180 (14%)

Query: 507 VKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKS 566
           +K+ +N E T+      G IS    E K ++EL+  N DL H    L ++++ ++R  + 
Sbjct: 296 IKETINAELTR-----DGTISTS--ELKGVLELRVNNPDLAHAKIALDSKVDAKDRSYQY 348

Query: 567 KTEA-IENDTITEAKEAIVTLQDHIQELETR---IDVITRERDAYKA---------IQSQ 613
           KT   I+ +  T +K  ++ L+D  +   +    + V+ R R    A         + + 
Sbjct: 349 KTHPNIDKNLFTSSK--VIGLRDSTKAFPSNDQSLGVL-RWRKVGTADDNSLIPLEVSTW 405

Query: 614 TSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSEL 673
            S   SN G+ DV  +   N D + +EL++L  A     E NV  +  EN E   S  E+
Sbjct: 406 VSPSSSNEGMFDVTVEFEVNPDYE-QELKDLRFAVPVFTE-NV-YINDENNESGASIKEI 462

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.121    0.306 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,301,529
Number of extensions: 6321750
Number of successful extensions: 54648
Number of sequences better than 10.0: 2453
Number of HSP's gapped: 46876
Number of HSP's successfully gapped: 6037
Length of query: 1760
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1636
Effective length of database: 39,262,815
Effective search space: 64233965340
Effective search space used: 64233965340
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 73 (32.7 bits)