Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196915.703ON46646624060.0
KLTH0E01034g5.703ON58344517410.0
SAKL0E14938g5.703ON57446813151e-177
Kpol_1043.715.703ON58547810611e-139
Suva_9.385.703ON56947210361e-135
TDEL0B021705.703ON56747110361e-135
Smik_9.195.703ON57247210331e-135
Skud_9.185.703ON57147310161e-132
YIL150C (MCM10)5.703ON57147810091e-131
AFR287W5.703ON61147410111e-131
ZYRO0G06578g5.703ON5694739931e-129
NDAI0F002805.703ON6104889941e-128
NCAS0G002205.703ON5924689771e-126
TBLA0G010205.703ON5944779661e-124
TPHA0E002105.703ON5444849381e-121
KAFR0D022105.703ON5844779261e-119
CAGL0H06589g5.703ON5834779261e-118
KNAG0L021505.703ON6164919191e-117
KLLA0A00572g5.703ON5774638101e-101
ZYRO0C03498g3.8ON43338780.54
TDEL0D064903.581ON48761741.4
TBLA0I035403.581ON48673723.1
CAGL0I00968g5.634ON99790713.8
ZYRO0B11704g8.231ON171480714.6
Ecym_55648.231ON161474697.1
KAFR0B025108.231ON158178698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19691
         (466 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   931   0.0  
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   675   0.0  
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   511   e-177
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   413   e-139
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   403   e-135
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   403   e-135
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   402   e-135
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   395   e-132
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   393   e-131
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   394   e-131
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   387   e-129
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   387   e-128
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   380   e-126
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   376   e-124
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   365   e-121
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   361   e-119
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   361   e-118
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   358   e-117
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   316   e-101
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...    35   0.54 
TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa] ...    33   1.4  
TBLA0I03540 Chr9 complement(847840..849300) [1461 bp, 486 aa] {O...    32   3.1  
CAGL0I00968g Chr9 (78375..81368) [2994 bp, 997 aa] {ON} similar ...    32   3.8  
ZYRO0B11704g Chr2 (921912..927056) [5145 bp, 1714 aa] {ON} highl...    32   4.6  
Ecym_5564 Chr5 (1147940..1152784) [4845 bp, 1614 aa] {ON} simila...    31   7.1  
KAFR0B02510 Chr2 (496496..501241) [4746 bp, 1581 aa] {ON} Anc_8....    31   8.0  

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/466 (96%), Positives = 449/466 (96%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
           SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNY 300
           QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNY
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNY 300

Query: 301 AKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXXXX 360
           AKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFS         
Sbjct: 301 AKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQKQ 360

Query: 361 XXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNVSL 420
                   IHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNVSL
Sbjct: 361 MKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNVSL 420

Query: 421 APSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           APSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV
Sbjct: 421 APSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/445 (70%), Positives = 374/445 (84%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           +ENF N+RK EE +I+HR  +L  RVHTF+G+ + K  +P+ V+EKE  SG  +SRRY++
Sbjct: 116 VENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMS 175

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
           + EL EI+++IK+LRLPKLFSKVRPPKFTEPDYANWVA+GI+  KS VK+TSSSKP+KYF
Sbjct: 176 TSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYF 235

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           KMT+TDFTH+LD+Y+FNN NVEKYYNLRVGDIIAILN DILPWRPSQV NDEFSG  VKS
Sbjct: 236 KMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKS 295

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNLSIR N+DCVLEIGTS+DLGFC+I NKA  K CGAPINRAA DRC+YHQ++RFR VNA
Sbjct: 296 FNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNA 355

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNY 300
           QRVELNGS SLRSPVKNGKKQALYG+SGVKRKL LLPDKHAPQ QD ESQNTL+FSNPNY
Sbjct: 356 QRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNY 415

Query: 301 AKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXXXX 360
           AKAFFDD+YQNPD+L NL++KRRK++D+E ER LQ QL+ A+GK G Q F+         
Sbjct: 416 AKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQ 475

Query: 361 XXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNVSL 420
                   ++SGLL++IGFDP +GKMR+VLK GKN  +  ++KS QV+EI+  +K+NVSL
Sbjct: 476 MKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKEIMSFKKSNVSL 535

Query: 421 APSKADQKKRLLRREQVWKEHFETK 445
           APSKA+QKKRLLRREQVW+EHF+T+
Sbjct: 536 APSKAEQKKRLLRREQVWREHFDTE 560

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  511 bits (1315), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/468 (52%), Positives = 330/468 (70%), Gaps = 10/468 (2%)

Query: 2   ENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIAS 61
           +NF++S+KA+E   + + EML+ RVHTF G    +   PIAV E+E  SG W+S+RYI +
Sbjct: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173

Query: 62  DELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFK 121
           ++  +IL++ K+LRLPKLF+KVRPP FTEP Y+NWV +GI+  KS VKMT+ +KP++YF 
Sbjct: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233

Query: 122 MTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSF 181
           +T+TDF H++++Y+F N NVEKYYNL+VGDIIA+LN +I PWRPS+V +++ S A +KSF
Sbjct: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293

Query: 182 NLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQ 241
           NL I+ N++ +LEIGTSRD GFC IYNK +GK CG PIN++  DRC YHQE++FRQVNA+
Sbjct: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353

Query: 242 RVELNGSMSLRSPVKNGKKQALYG--SSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPN 299
           R+ELNG+ SLRSP KNG K  LYG   SG   K +LLPD++APQ Q ++SQN LYFSNPN
Sbjct: 354 RLELNGNKSLRSPTKNGVKHILYGKNKSG---KYDLLPDRYAPQTQSKDSQNVLYFSNPN 410

Query: 300 YAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXXX 359
            A+AFFDD YQNPD L NLDSKRRK+   + E+ LQ QL + +GK     F         
Sbjct: 411 AARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQD 470

Query: 360 XXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTD-TKSIQVREIIETRKTNV 418
                    + SGL+K IGFDPT G+M  VLK   NSK   +  K+  V EI++ +K  +
Sbjct: 471 EIRRATKNALESGLIKKIGFDPTSGRMSSVLK--NNSKGLKEQAKNSAVEEILQIKKEKI 528

Query: 419 SLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
            L PSK   +++  +RE+VW  HF+ + +P  N  + S   DS+LEIV
Sbjct: 529 ELKPSKEALRQKFKKREEVWNHHFKKEENP--NPGVESSDGDSELEIV 574

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  413 bits (1061), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 300/478 (62%), Gaps = 27/478 (5%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           ME F NS+K  E ++     M+ SRVHTF G  + K  KP  V+E +  S LW+  RYI 
Sbjct: 111 MEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIP 170

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            DEL  +L DIKILRLPKLF+KVRPPKFTEP Y+NWV  GI+  K  +K TSSSKPTKYF
Sbjct: 171 VDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYF 230

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K TI+DF H+LDV++F    VEKYYNLRVGD++AILN +ILPWRPS+  N   SG+++KS
Sbjct: 231 KFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSGSTIKS 288

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I   +DC+LEIG SRDLG+C I N +K  +C  PIN++  D+C YH+EI+FR+  +
Sbjct: 289 FNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTS 348

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSG------VKRKLNLLPDKHAPQQQDRESQNT-- 292
            RVEL+G+ +L +P K   + ALY + G      V++  N++ D H  +++D     T  
Sbjct: 349 NRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRM 408

Query: 293 LYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSX 352
            +FS  N AKAFFD+ +QNPD+L NLDSKRRK++D++ ER L   L   + K+ +     
Sbjct: 409 HHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKN---- 464

Query: 353 XXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIE 412
                           + +G+L+ +GFDPT GK+  V++   +    T+   ++ +E ++
Sbjct: 465 -----FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALD 519

Query: 413 T----RKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
                RK  V+L PSK D  KR + R++ WK+ F  +     NN    D S SDL+I+
Sbjct: 520 DLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNN----DDSGSDLKIL 573

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  403 bits (1036), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 294/472 (62%), Gaps = 20/472 (4%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           M+ F ++++ E+ +I     M+++RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 112 MQKFQDAKRNEDKQIAKYEGMMNARVHTFG--TDNKEYKPIITNELESFSNLWVKKRYIP 169

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            ++L   L +IKILRL KLF+K+RPPKF EPDYANW  VG++ HKS +K TSS KP K+F
Sbjct: 170 EEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFF 229

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
             TITDF HSLDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +KS
Sbjct: 230 MFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKS 283

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN      CDYH+E++FR   A
Sbjct: 284 FNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGA 343

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298
           +R+ELNG  +L +P K   + +LY + G + + N++    K   ++++R  +N+  F+N 
Sbjct: 344 KRIELNGGYALGAPTKVDSQPSLYRAKG-ENQFNIVRSTRKGLSEEEERVKRNSHNFTNS 402

Query: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXX 358
           N AKAFFD+ +QNPD+L NLDSKRRK+ DT+    L  +L + + +              
Sbjct: 403 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 462

Query: 359 XXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414
                     + +GL++ +GFDPT GK+  VLK     G++  N  + K   + ++++ +
Sbjct: 463 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 522

Query: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           K  V LAPSK +  K+   RE+VW+ HF +K       ++ SD+S SDLEIV
Sbjct: 523 KEKVILAPSKNEWFKKRSHREEVWQRHFGSK-----ETEVASDASGSDLEIV 569

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  403 bits (1036), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/471 (44%), Positives = 296/471 (62%), Gaps = 18/471 (3%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           ++NF NS+K E+   + R E+L  RVHTFRG+      K +AVEE E  S LWV +RYI+
Sbjct: 110 IDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYIS 169

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            D+L ++L ++KILRL KLF+K++PPKF EP Y+NW  +GI+  K  VK +SS KP KYF
Sbjct: 170 QDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYF 229

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K T+TDF ++LDVYVF    VE+YYNLRVGDI+AILN ++LPWRPS+ GN       +KS
Sbjct: 230 KFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGN------FIKS 283

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I  ++ C+LEIG SRD+ +C+ +NK++ K CG PIN+     CD+H+EI+FR  +A
Sbjct: 284 FNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHA 343

Query: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNP 298
           +R+ELNGS +L +P K     ALY   S+G  R   +LP+ +            ++FSN 
Sbjct: 344 KRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNG 403

Query: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXX 358
           N AKAFF+D +QNPD+L NLDSKRRK +D +    LQ QL R   +              
Sbjct: 404 NAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKY 462

Query: 359 XXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVG---KNSKNSTDTKSIQVREIIETRK 415
                     + SGL++N+GFDPT G++ +VLK     K++    + K  +V  +++ +K
Sbjct: 463 EEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKK 522

Query: 416 TNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
            +V L P+K    +R   RE+ W+E+F    D + N  + SD SDSD+EIV
Sbjct: 523 EHVELKPAKEVLLQRKRDRERAWQENF---GDKSVN--LSSD-SDSDIEIV 567

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  402 bits (1033), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 293/472 (62%), Gaps = 19/472 (4%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           M+ F N++K E+ +I     M+D+RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 114 MQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPIIANELEGFSNLWVKKRYIP 171

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            D+L   L +IKILRL KLF+KVRPPKF  P+YANW  VG++ HKS +K TSS KP K+F
Sbjct: 172 EDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFF 231

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
             TITDF H+LDVY+F    VE+YYNLR+GDIIAILN ++LPWRPS  GN       +KS
Sbjct: 232 MFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGN------FIKS 285

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I  ++ C+LEIG+SRDLG+C I N    K CG+PIN +    CDYH+E++FR  +A
Sbjct: 286 FNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSA 345

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298
           +R+ELNG  +L +P K   + +LY + G  R  N++ D  K   ++++R  +++  F+N 
Sbjct: 346 KRIELNGGYALGAPTKVNSQPSLYKAKGENR-FNIIRDARKGLSEEEERMKKSSHNFTNS 404

Query: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXX 358
           N AKAFFD+ +QNPD+L NLD+KRRK+ DT+  + L  +L++ + +              
Sbjct: 405 NSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEK 464

Query: 359 XXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414
                     + +GL++ +GFDPT G++  VLK     G++  N  + K   + +++  +
Sbjct: 465 QKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYK 524

Query: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           K  V LAPSK +  K+   RE+VW+ HF     P    +  SD+S SDLEI+
Sbjct: 525 KEKVILAPSKNEWFKKRNHREEVWQRHF----GPKGEAEEASDASASDLEII 572

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  395 bits (1016), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 212/473 (44%), Positives = 292/473 (61%), Gaps = 22/473 (4%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           M+ F N+++ EE +      M+++RVHTF G    + R  IA  E E  S +WV +RYI 
Sbjct: 114 MQKFQNAKRNEEKQRAKYENMMNARVHTF-GTDKKEYRATIA-NELEEFSNIWVKKRYIP 171

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            D+L   L +IKILRL KLF+K+RPPKF EPDYANW  VG++ HKS VK TSS KP K+F
Sbjct: 172 EDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFF 231

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
             TITDF H+LDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +KS
Sbjct: 232 MFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGN------FIKS 285

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I  ++ C+LEIG+SRDLG+C I N+ K + CG+PIN A    CDYH+E++FR  +A
Sbjct: 286 FNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSA 345

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298
           +R+ELNG  +L +P K   +  LY + G +   NL+    K   ++++R  +N+  F N 
Sbjct: 346 KRIELNGGYALGAPTKVDAQPTLYRAKG-ENNFNLVRSIRKTLSEEEERMKKNSHNFRNS 404

Query: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXX 358
           N AKAFFD+ +QNPD+L NLDSKRRK+ D++    L  +L + + + G            
Sbjct: 405 NSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEK 464

Query: 359 XXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414
                     + +GLL+ +GFDPT GK+  VLK     G+        K   + +++  +
Sbjct: 465 QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYK 524

Query: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETK-TDPTANNQIPSDSSDSDLEIV 466
           K  V LAPSK +  K+   RE+VW++HF +K TD        SD+S SDLEIV
Sbjct: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEV------SDASTSDLEIV 571

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  393 bits (1009), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/478 (44%), Positives = 297/478 (62%), Gaps = 32/478 (6%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRK--PIAVEEKEPASGLWVSRRY 58
           ME F N++K E+ +I     M+++RVHTF    +T  +K  PI   E E  S LWV +RY
Sbjct: 114 MEKFQNAKKNEDKQIAKFESMMNARVHTF----STDEKKYVPIITNELESFSNLWVKKRY 169

Query: 59  IASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTK 118
           I  D+L   L +IKILRL KLF+K+RPPKF EP+YANW  VG++ HKS +K TSS KP K
Sbjct: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVK 229

Query: 119 YFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASV 178
           +F  TITDF H+LDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +
Sbjct: 230 FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FI 283

Query: 179 KSFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQV 238
           KSFNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN +    CDYH+E++FR  
Sbjct: 284 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 343

Query: 239 NAQRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFS 296
           +A+R+ELNG  +L +P K   + +LY + G +   N++    K   ++++R  +++  F+
Sbjct: 344 SAKRIELNGGYALGAPTKVDSQPSLYKAKG-ENGFNIIKGTRKRLSEEEERLKKSSHNFT 402

Query: 297 NPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSX---- 352
           N N AKAFFD+ +QNPD+L NLD+KRRK+ +T+        LSR LGK  ++R S     
Sbjct: 403 NSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKK----STALSRELGKIMRRRESSGLED 458

Query: 353 XXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLK---VGKNSKNS-TDTKSIQVR 408
                           + +GL++ +GFDPT GK+  VLK    G   KN+    K   + 
Sbjct: 459 KSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVIN 518

Query: 409 EIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           +++  +K  V LAPSK +  K+   RE+VW++HF +K          SD S SDLEI+
Sbjct: 519 DLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKET-----SDGSASDLEII 571

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  394 bits (1011), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/474 (43%), Positives = 293/474 (61%), Gaps = 12/474 (2%)

Query: 2   ENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIAS 61
           E FA +R +  S ++ + E+L  RV+TF            AV+E E  S + +++RY+  
Sbjct: 140 EKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPE 199

Query: 62  DELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFK 121
           ++L  IL DIK+LRLPKLF+KVRPPKF+EPDYANWV +G + +KS VK TS  KP KYF 
Sbjct: 200 EDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFT 259

Query: 122 MTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSF 181
           + ITDF + + + VF   NVEKYY LRVGD+IAILN +I PW+ S     E +  + +SF
Sbjct: 260 IRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSF 319

Query: 182 NLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQ 241
            LSI+ N +C+LEIG S++LGFC   NK KG  CGAPIN+     C YHQE   R VNA+
Sbjct: 320 GLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAK 379

Query: 242 RVELNGSMSLRSPVKNGKKQALY---GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNP 298
           RVELNG++SLR+P ++G +QA Y    S G   K+ LLPD +AP+    E +   +F++ 
Sbjct: 380 RVELNGNISLRAPTRDGIQQAGYMTRNSHGT--KIGLLPDVYAPRAPGAEQKFREHFASA 437

Query: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXX 358
           N  +A+FD  Y NPD+L+NL+SKRRK++ ++ ++Q+  QLS  LGK+  Q          
Sbjct: 438 NAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEESL 497

Query: 359 XXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNV 418
                     + +G+L++IGFDPT G+M  VL  G +    T  +   + EI+  +K N+
Sbjct: 498 QQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADT-VREPSISEILANKKRNI 556

Query: 419 SLAPSKADQKKRLLRREQVWKEHFETKTDPTANN-----QIPS-DSSDSDLEIV 466
            L PSK  ++KR+ +R +V+   F+ +   T        Q+ S DSSD +LEIV
Sbjct: 557 DLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQLSSADSSDEELEIV 610

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  387 bits (993), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 294/473 (62%), Gaps = 24/473 (5%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           +E ++ S++ ++  ++ + ++L +RVHTF+G +     KPI   E E  S LW+S+RYI 
Sbjct: 113 IEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIP 172

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            +E   I  +IKILRL KLF+KV+PPKF EP Y+NW  +G++ +K  VK TS++ P KYF
Sbjct: 173 KEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYF 232

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K T+T+F +S+D Y+F    VE+YYNLRVGDIIAILN  +LPWRPS       + A +KS
Sbjct: 233 KFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSG------TKAHIKS 286

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I   ++C+LEIG SRDLG+C ++NK+K ++C APIN+   D C+YH+E++FR  NA
Sbjct: 287 FNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNA 346

Query: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLL---PDKHAPQQQDRESQNTLYF 295
           +RVEL+G+ +L +P +   + ALY  GSS      N++    D  + ++ +    N  +F
Sbjct: 347 KRVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHF 406

Query: 296 SNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXX 355
           SN N AKAFFD+ +QNP+ L NL++KRRK+RD    R+  + L+R L K+ +        
Sbjct: 407 SNRNAAKAFFDERFQNPETLRNLENKRRKLRDN---RKSNI-LNRELKKNSELDIKHKSA 462

Query: 356 XXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGK--NSKNSTDTKSIQVREIIET 413
                        + SG++KN+GFDPT+GK+  V K  +  + K     K   V  ++  
Sbjct: 463 EEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVASLLSF 522

Query: 414 RKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           +K NV L PSK    K+  RRE+VWKEHF +  D         D SDSDLEIV
Sbjct: 523 KKDNVKLKPSKEILIKQKRRRERVWKEHFGSGGD-------EKDDSDSDLEIV 568

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  387 bits (994), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/488 (43%), Positives = 303/488 (62%), Gaps = 28/488 (5%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGL-KATKSRK----PIAVEEKEPASGLWVS 55
           ME F + +K EE       +ML +RVH F+GL K++K  K    P A  E E  S L + 
Sbjct: 129 MEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVEEYSMLRIQ 188

Query: 56  RRYIASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSK 115
           +RYI   EL +I ++IKILRL KLF+KVRPPKF EP Y+NWV +GI+  K  +K TSS K
Sbjct: 189 KRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKFTSSDK 248

Query: 116 PTKYFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSG 175
           P KYFK TI+DF +++D+++F+   VE+YYNLR+GDIIAILN ++LPWRPS   N    G
Sbjct: 249 PKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN----G 304

Query: 176 ASVKSFNLSIRGNYDCVLEIGTSRDLGFCQIYNKA-KGKVCGAPINRAAVDRCDYHQEIR 234
             +KSFNL I  NY C++E+G S+DLGFC I NK  +   C  PI+ +  DRC YHQEIR
Sbjct: 305 TGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYHQEIR 364

Query: 235 FRQVNAQRVELNGSMSLRSPVKNGKKQALYGSSGVK-------RKLNLLPDKHAPQQQDR 287
           FR   ++R+ELNGS +L +PVK G +  LY ++ V         + N++      + + +
Sbjct: 365 FRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRKNESK 424

Query: 288 --ESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKD 345
             E +   YFS+ N AKAFFD+ +QNPD+L NLD+KRRK+ D +    L  +LS+A+   
Sbjct: 425 LMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKAIENK 484

Query: 346 GQQRFS-XXXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNS--KNSTDT 402
              R S                  + +G+++ +GFDPT GK+  VL+ GK+S   N  +T
Sbjct: 485 SSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDNVHNT 544

Query: 403 KSIQ-VREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETK---TDPTANNQIPSDS 458
             ++ V++++E +K  V LAP+K +  KR  RRE+VW++HF +     +   N+ +  D+
Sbjct: 545 HKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV--DT 602

Query: 459 SDSDLEIV 466
           S+SDLEIV
Sbjct: 603 SESDLEIV 610

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  380 bits (977), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/468 (43%), Positives = 290/468 (61%), Gaps = 22/468 (4%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           ME F  S+K EE +I+    M+++RVHTF+     +  KPI V E E  S +W+ +RYI 
Sbjct: 114 MEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIP 173

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
             EL ++L +IKILRL KLF+KVRPPKF+EP Y+NW A+GI+  K   K T++ KP KY 
Sbjct: 174 QSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYL 233

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K T+TDF H LDVY+F    VE+YYNLRVGD+IAILN ++ PWRPS  G  +F    +KS
Sbjct: 234 KFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS--GKGQF----IKS 287

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I  ++ C+LEIG+S+DLGFC++ ++  G +C  PIN +  DRCDYHQEIRFR  N+
Sbjct: 288 FNLRINHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDNNS 346

Query: 241 QRVELNGSMSLRSPVKNGKKQALY----GSSGVKRK--LNL-LPDKHAPQQQDRESQNTL 293
           +R+ELNGS +L +P K      LY    G +   RK   N  +        +D+      
Sbjct: 347 KRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNR 406

Query: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXX 353
           +FSN N AKAFFD+ +QNPD+L NL+SKRRK++D +   ++  +LS+A+G          
Sbjct: 407 HFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGER 466

Query: 354 XXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQ------- 406
                          + SG+++ +GFDPT GK+ +VL+   +SK   DT S Q       
Sbjct: 467 SAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTT-HSKEEKDTLSEQMSGKKDK 525

Query: 407 VREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQI 454
           V +++  RK++V LAP++ +  +R  RRE++W+E+F  K  P + N +
Sbjct: 526 VNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQKRKPISANDL 573

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  376 bits (966), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 203/477 (42%), Positives = 294/477 (61%), Gaps = 21/477 (4%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGL-KATKSRKPIAVEEKEPASGLWVSRRYI 59
           M NFA+S+K E  +I+    ++ +RVH+F       K  + I VEEKE  SGLW+SRRY+
Sbjct: 128 MNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYL 187

Query: 60  ASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKY 119
             + + ++L+DIKILRL KLF+K+RPPKF  P Y+NWVAVG++  KS  K+TSS+ P KY
Sbjct: 188 KEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKY 247

Query: 120 FKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVK 179
           FK TI DF  ++ ++VFN   + KYYNLRVGDII ILN  I PWRPS+          +K
Sbjct: 248 FKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE------ENGYIK 301

Query: 180 SFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAK-GKVCGAPINRAAVDRCDYHQEIRFRQV 238
           SFNLSI+  YDC++EIG SRDLG+C +  K+K GK CG PIN+     C++H+E  FR  
Sbjct: 302 SFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRNA 361

Query: 239 NAQRVELNGSMSLRSPVKNGKKQALYGSSG----VKRKLNLLPDKHAPQQQDRESQNTLY 294
            A+R+ELNGS +L +P K     +LY         K + N++  ++A ++ D +  N+  
Sbjct: 362 AAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNS-N 420

Query: 295 FSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQ--QRFSX 352
           F + N AKAFF+D +QNPD++ NLDSKRRK++D + + +L  +L++ L K+    +    
Sbjct: 421 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 480

Query: 353 XXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNS-TDTKSIQVREII 411
                           +  G+LKNIG+DPT GKM+ ++K       S T  +S  V +++
Sbjct: 481 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 540

Query: 412 ETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQ--IPSDSSDSDLEIV 466
             +K  V+L P K+D   +  +R+++W E+F    D + +N+  I S   DSDLEIV
Sbjct: 541 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF---GDQSKSNRDIILSSGDDSDLEIV 594

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  365 bits (938), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/484 (39%), Positives = 297/484 (61%), Gaps = 29/484 (5%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           M+NF  ++K E  ++K   + + SRVH+F G   +K  + I VEE E  S   +S+RY+ 
Sbjct: 72  MQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRYLP 131

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
            +E+++ L +IKILRL KLF+K+RPPKF+EPDYANW   GI+C K  +K+TSS  P K+F
Sbjct: 132 KEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVKFF 191

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K TIT+F H+LD+++F    VEKYYNLRVGDII ILN ++LPWRP      EF G S+KS
Sbjct: 192 KFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRP------EFKGNSIKS 245

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I   +DC+LEI  S+D+ +CQ  N+  G  C  PIN++  D CDYH+E++FR  NA
Sbjct: 246 FNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANA 305

Query: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVK-----RKLNLLPDKHAPQQQDRESQNT--L 293
           +RVEL+G+ +L +P +   + ALY S            N++ D+   ++++ +  N+   
Sbjct: 306 KRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKENDPINSKRH 365

Query: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXX 353
           +FS+ N AKAFFD+ +QNPD+L NL++KRRK++D + +  LQ  L  ++G + +      
Sbjct: 366 HFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVG-NSKLLLKDK 424

Query: 354 XXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDT-----KSIQVR 408
                          + +G ++ +GFDPT G+++ VL+  K++  ST +     KS  + 
Sbjct: 425 SNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLE--KSADKSTQSKLQKQKSNAME 482

Query: 409 EIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQ------IPSDSSDSD 462
            ++  +K++V+L PS+    ++L  REQ + ++   K+   A N+        +D+   D
Sbjct: 483 NLVTFKKSSVNLKPSREVLLEKLHHREQSFAQY--KKSIIAAENRDRKSASTKNDTDSDD 540

Query: 463 LEIV 466
           LEI+
Sbjct: 541 LEII 544

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  361 bits (926), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/477 (42%), Positives = 282/477 (59%), Gaps = 26/477 (5%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           ME F ++++ E+  I+    M+ SRVHTF G++     + + V+E E  S LW+++RY  
Sbjct: 123 MEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRYTP 182

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
              L  +L ++KILRL KLF+KVRPPKF EP Y+NWV VGI+  KS +K T+S+KP KY 
Sbjct: 183 VSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQKYL 242

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           K T+TDF H +D Y+F    VE+YYNLR+GDIIA+LN +ILPWRPS   N       +KS
Sbjct: 243 KFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQN------YIKS 296

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDR-CDYHQEIRFRQVN 239
           FNL I   Y C+LEIG SRDL  C I  ++  K CG PIN+  VDR C+YH+E+  R+  
Sbjct: 297 FNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINK-KVDRCCEYHREMEIRKGP 355

Query: 240 AQRVELNGSMSLRSPVKNGKKQALY---GSSGVK-RKLNLLP--DKHAPQQQDRESQNTL 293
           ++R++L+G  +L +P K   + ALY    +  VK +   L P   ++ P   D+  + + 
Sbjct: 356 SKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSK 415

Query: 294 YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXX 353
           +FSN N AKAFFDD +QNPD++ NLD+KRRK+ +      L  +L R L KD  Q     
Sbjct: 416 FFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKD--QDLEGK 473

Query: 354 XXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNST----DTKSIQVRE 409
                          + SGL + +GFDPT GK+  +LK  + SK+        K   V +
Sbjct: 474 TREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDD 533

Query: 410 IIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           ++  +K  + LAPSK D   +  +RE+VW+E+F        N    +  SDSDLEIV
Sbjct: 534 LMAFKKEYIILAPSKVDLLNKKNKREKVWQENF------GQNKSNDNSESDSDLEIV 584

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  361 bits (926), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 193/477 (40%), Positives = 283/477 (59%), Gaps = 42/477 (8%)

Query: 4   FANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIASDE 63
           F NS+  E   +    +M+ +R HTF G  +    K I  +E EP S   + +RYI  DE
Sbjct: 135 FKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHIKKRYIPKDE 194

Query: 64  LAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFKMT 123
           + ++L  IKILRL KLF+KVRPP F+EP Y+NWVA+G +  K  VK+T+++KP KYFK T
Sbjct: 195 VDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFT 254

Query: 124 ITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSFNL 183
           +TDF H+LDVYVF    VE+YYNLRVGDIIA+LN +ILPWRPS   N       +KSFNL
Sbjct: 255 LTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVN------GIKSFNL 308

Query: 184 SIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQRV 243
            I  +++C+LEIG SRDLG+CQ+ N  + K+C +PIN      C++H+E++ R   ++R+
Sbjct: 309 RIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTASKRI 368

Query: 244 ELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKH-----------APQQQDRESQNT 292
           EL+GS +L +P K G + ++Y  +   R  N  P KH             Q++++     
Sbjct: 369 ELSGSYALGAPTKVGTQPSIYKDNNKSRNTN--PAKHKMFSITGHGSKKEQEKEKHEIEA 426

Query: 293 LYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSX 352
            +FSN   AKAFFDD++Q+P LL NL+SKRRK++ ++ +R L   L+   G+D  Q    
Sbjct: 427 HHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN---GEDASQ---- 479

Query: 353 XXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQ---VRE 409
                           + +G+++ +GFDP+ G++  VL   + +K    T S +   + +
Sbjct: 480 --SKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLIND 537

Query: 410 IIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           +I  +K  + L PS+  Q ++  RRE +WK+HF+   D           SDSDLEIV
Sbjct: 538 LIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTND-----------SDSDLEIV 583

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  358 bits (919), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/491 (39%), Positives = 280/491 (57%), Gaps = 31/491 (6%)

Query: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60
           +E F  S+K E+  I+ +  ML +RVHTF+G+   K  +  AV E E  S LW+S+RYI 
Sbjct: 132 LEKFQQSKKTEKLEIEAQETMLSARVHTFQGV--DKEFQLEAVNELEQFSDLWISKRYIP 189

Query: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120
              L E L+D+K+LRL KLF+KVRPPKF EP Y+NW  + I+  KS VK T+S  P K+ 
Sbjct: 190 KQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKNPQKFI 249

Query: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180
           + T+T+F   LD++VF +  V++YYNLR GDI+A+LN +ILPWRPS  G  +    S+KS
Sbjct: 250 RFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPS--GGSQ-QTTSIKS 306

Query: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240
           FNL I   + C+LEIG SRDLG+C +  K   + CG+ IN A    C+YH+E++ RQ ++
Sbjct: 307 FNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQNSS 366

Query: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLLPDKHA------PQQQDRESQNT 292
           +R++LNG  +L +P K G +  L+   S   K+    LP          P    R  Q  
Sbjct: 367 KRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHGQGG 426

Query: 293 L----------YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRAL 342
                      +F++ N AKAFFDD +QNPD+L NLD+KRRK++D++  RQL  +L R L
Sbjct: 427 SSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRKLKRLL 486

Query: 343 GKDGQQRFSXXXXXXXXXXXXXXXXXIHSGLLKNIGFDPTKGKMRDVLK-------VGKN 395
            KD  +                    +H+GL++ +GFDPT G+   V+K        G N
Sbjct: 487 SKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSERGSGAN 546

Query: 396 SKNSTDTKSIQVREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIP 455
              +   K   V E++  ++   +L PS+     R   R +VW+E F  K  P  +  + 
Sbjct: 547 EDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPVDSQPVD 606

Query: 456 SDSSDSDLEIV 466
           +D SD DLEIV
Sbjct: 607 NDDSD-DLEIV 616

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  316 bits (810), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/463 (38%), Positives = 269/463 (58%), Gaps = 21/463 (4%)

Query: 11  EESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIASDELAEILKD 70
           E   IK + E+L  RV+TF G       +PI V+EK+  SGL + RRY+    L +  K+
Sbjct: 129 EHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPLAVLRKHTKN 187

Query: 71  IKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFKMTITDFTHS 130
           IK+LRLPKLFSKVR PKF+EPDY NW+ +GI+  K+  +MT+S KP K+F +TI+DF   
Sbjct: 188 IKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTISDFQFE 247

Query: 131 LDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSFNLSIRGNYD 190
           L+V  F    VEKYY LR+GD+IAILN +I+P +  + G    +  S  +F+L +  + +
Sbjct: 248 LNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG----ASPSYATFSLKVSKDTN 303

Query: 191 CVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQRVELNGSMS 250
            +LE+G S++ G CQ Y K KGK+CGAPIN+   + C YH+E + RQ +++RVE++ S++
Sbjct: 304 NILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSVA 363

Query: 251 LRSPVKNGKKQALY------GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPNYAKAF 304
           +R+PV  G +Q +       G + ++ + N  PDK   ++      N   FS+ N + AF
Sbjct: 364 MRAPVVKGYQQTIVKSQHNNGKTSIRYQQN--PDKPFVREPAAAETNRFLFSSANASTAF 421

Query: 305 FDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSXXXXXXXXXXXXX 364
           FDD Y+NPD+L NLD+KRRK+++  + R L+ +L    G   +                 
Sbjct: 422 FDDDYENPDILANLDNKRRKIQELRNNRNLEKKLK---GLSDKLLSKKEDRVNQEAKKTA 478

Query: 365 XXXXIHSGLLKNIGFDPTKGKMR-DVLKVGKNSKNSTDTKSIQVREIIETRKTNVSLAPS 423
                  GL   IG+DPTKGK   ++L+    +K   + K + + +I   +K NVSL PS
Sbjct: 479 TLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKDNVSLKPS 538

Query: 424 KADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466
           K   K+++ +R  ++ E  +   +    ++  SD    DLEI+
Sbjct: 539 KKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSD----DLEII 577

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 160 ILPW-RPS----QVGNDEFSGASVKSFNLSIRGNYDCV 192
           I+ W +PS    Q G D  SG  +  FNLSIRG+ +CV
Sbjct: 258 IMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCV 295

>TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa]
           {ON} Anc_3.581 YGL253W
          Length = 487

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 283 QQQDRESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRAL 342
           Q QD    NT Y  + +Y     DD ++N +  ++L SK   ++ T  ER+L  +L   +
Sbjct: 329 QGQDLTKLNTPYIMDTSYPSKIEDDPFENLEDTDDLFSKDLGIKTTSPERKLIRRLCELI 388

Query: 343 G 343
           G
Sbjct: 389 G 389

>TBLA0I03540 Chr9 complement(847840..849300) [1461 bp, 486 aa] {ON}
           Anc_3.581 YGL253W
          Length = 486

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 275 LLPDKHAP----QQQDRESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTES 330
           +L D HA     + QD    N  Y  + +Y   F DD ++N + +  +  K   ++ T  
Sbjct: 317 VLVDLHAQGFILKDQDLTKLNVPYCMDTSYPSRFEDDPFENLENVAEIFEKDFGIKTTSP 376

Query: 331 ERQLQVQLSRALG 343
           ER+L  +LS A+G
Sbjct: 377 ERKLIRKLSEAIG 389

>CAGL0I00968g Chr9 (78375..81368) [2994 bp, 997 aa] {ON} similar to
           uniprot|P32480 Saccharomyces cerevisiae YOR038c HIR2
           histone transcription regulator
          Length = 997

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%), Gaps = 6/90 (6%)

Query: 375 KNIGFDPTKGKMRDVLKVGKN--SKNSTDTKSIQVREIIETRKTNVSLAPSKADQKKRLL 432
           KN+   P + K + +L  GKN  SK+S+ T S  +++ +E  K+NVS+    A +KK   
Sbjct: 469 KNLEARPIEAKSKKILN-GKNLESKSSSVTTSDNIQKKVEDSKSNVSVT---ATEKKTKP 524

Query: 433 RREQVWKEHFETKTDPTANNQIPSDSSDSD 462
            ++ +  E+ E+K +   N   P +S+ +D
Sbjct: 525 DKKSIKSENGESKVNKAQNTISPKESNTTD 554

>ZYRO0B11704g Chr2 (921912..927056) [5145 bp, 1714 aa] {ON} highly
           similar to uniprot|P32660 Saccharomyces cerevisiae
           YER166W DNF1 Non-essential P-type ATPase that is a
           potential aminophospholipid translocase localizes to the
           plasma membrane and late exocytic or early endocytic
           membranes likely involved in protein transport
          Length = 1714

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 140 NVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASV-------KSFNLSIRGNYDCV 192
           N + + N+RVGD++ I N D +P     +   +  GA            NL +R +  C 
Sbjct: 442 NKDYWKNVRVGDVVRIHNNDEIPADIILLSTSDLDGACYVETKNLDGETNLKVRQSLKCT 501

Query: 193 LEIGTSRDLGFCQIYNKAKG 212
            +I  SRD+   + + +++G
Sbjct: 502 HKIRNSRDVTRTKFWVESEG 521

>Ecym_5564 Chr5 (1147940..1152784) [4845 bp, 1614 aa] {ON} similar
           to Ashbya gossypii AGR120C
          Length = 1614

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 7/74 (9%)

Query: 146 NLRVGDIIAILNADILPWRPSQVGNDEFSGASV-------KSFNLSIRGNYDCVLEIGTS 198
           N++VGDI+ I N D +P     +   +  GA            NL +R +  C  +I  S
Sbjct: 476 NVKVGDIVRIQNNDEVPADIILLATSDSDGACYVETKNLDGETNLKVRQSLKCSYKIRNS 535

Query: 199 RDLGFCQIYNKAKG 212
           +D+  C  + +++G
Sbjct: 536 QDISKCNFWVESEG 549

>KAFR0B02510 Chr2 (496496..501241) [4746 bp, 1581 aa] {ON} Anc_8.231
           YER166W
          Length = 1581

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 142 EKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASV-------KSFNLSIRGNYDCVLE 194
           E + N+ VGDI+ I N + +P     +   +  GA            NL +R +  C L+
Sbjct: 398 EFWKNVTVGDIVRIHNNEEIPADLILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSLD 457

Query: 195 IGTSRDLGFCQIYNKAKG 212
           I +SRD+   + + +++G
Sbjct: 458 IRSSRDVARSRFWVESEG 475

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,511,954
Number of extensions: 2162172
Number of successful extensions: 7438
Number of sequences better than 10.0: 46
Number of HSP's gapped: 7627
Number of HSP's successfully gapped: 46
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)