Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196885.704ON39339320930.0
KLTH0E01012g5.704ON38638511811e-161
SAKL0E14960g5.704ON3843869111e-120
ZYRO0G06556g5.704ON3793767831e-101
TDEL0B021605.704ON3753887611e-97
NCAS0A031905.704ON3983997377e-94
CAGL0G02519g5.704ON3783817252e-92
KLLA0A00550g5.704ON3803156941e-87
TPHA0D046205.704ON4063626942e-87
KNAG0C066105.704ON3863946872e-86
AFR288C5.704ON4653366681e-82
KAFR0H002005.704ON3893666541e-81
NDAI0E050505.704ON4513535633e-67
Kpol_YGOB_Anc_5.7045.704ON2072024066e-47
Kwal_33.13989singletonOFF12227750.31
TBLA0A061406.229ON145749722.3
YLR233C (EST1)8.415ON69995713.4
KLLA0F10373g6.154ON34886703.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19688
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   810   0.0  
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   459   e-161
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   355   e-120
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   306   e-101
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    297   1e-97
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    288   7e-94
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   283   2e-92
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   271   1e-87
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   271   2e-87
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   269   2e-86
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   261   1e-82
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      256   1e-81
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   221   3e-67
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   160   6e-47
Kwal_33.13989 s33 (473104..473472) [369 bp, 122 aa] {OFF} [conti...    33   0.31 
TBLA0A06140 Chr1 complement(1508271..1512644) [4374 bp, 1457 aa]...    32   2.3  
YLR233C Chr12 complement(607425..609524) [2100 bp, 699 aa] {ON} ...    32   3.4  
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    32   3.9  

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/393 (100%), Positives = 393/393 (100%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60
           MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60

Query: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120
           DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF
Sbjct: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120

Query: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180
           LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL
Sbjct: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180

Query: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240
           KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY
Sbjct: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240

Query: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300
           ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN
Sbjct: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300

Query: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360
           RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP
Sbjct: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360

Query: 361 AHGSFDGRIHVKFLKEHSSFHLKVLSKYVSDNF 393
           AHGSFDGRIHVKFLKEHSSFHLKVLSKYVSDNF
Sbjct: 361 AHGSFDGRIHVKFLKEHSSFHLKVLSKYVSDNF 393

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 292/385 (75%), Gaps = 1/385 (0%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60
           M Q+VEVPLV +  TQF   VET+ +K  SFSL+  PN+   A+LDP+L +R + DIL+V
Sbjct: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQL-TRGQKDILIV 59

Query: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120
           DSIKSGTGRD +N+F  NV++P+FT LG+ ++VV+T++ ++  +LG  F+P  +NT +IF
Sbjct: 60  DSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIF 119

Query: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180
           LSGDT+ISEF+N L +     +R T++L+ LPLGTGNAWANSLG R  A +L+ FLQG L
Sbjct: 120 LSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQL 179

Query: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240
            P+ FPLYKA FPNG+E++FFIILSIGFHANLLHLC Q RF+ LGVERF++AS EI + Y
Sbjct: 180 TPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKY 239

Query: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300
            L+Y LQV+  P   YSYFALINTPNLE +YKPSP+SN L  +LH+LGYSS L Q  L++
Sbjct: 240 PLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVS 299

Query: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360
           +IMKGYSN+   DI+ +GV Y+ +++ L+VVF Q PE V  + F+ICCDGHLLNMLS QP
Sbjct: 300 KIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQP 359

Query: 361 AHGSFDGRIHVKFLKEHSSFHLKVL 385
               FDGRI ++FLK  SSF L V+
Sbjct: 360 QDQKFDGRIRIQFLKNFSSFELNVM 384

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/386 (45%), Positives = 249/386 (64%), Gaps = 4/386 (1%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60
           MA+ V  PL+   +T +SV +E +GS   SF L        S++L    +     +++++
Sbjct: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSLIS--LPSANSELIIL 58

Query: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120
           DS+ SG GR  + DF T VI+P+  +LG +++++KT++  S+AE  R   P  ++ T+IF
Sbjct: 59  DSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEP-SKSYTIIF 117

Query: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180
           LSGDTSISEF+N++  +   + +  +N+  +P+GTGNAWA+SL  +    +  +FL+  L
Sbjct: 118 LSGDTSISEFLNHIPTQNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDL 176

Query: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240
               FPLY+A FPNGY  +FFIILSIGFHANLLHLC+  ++K +GVERF+ AS +IF++Y
Sbjct: 177 IASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNY 236

Query: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300
            L Y + +  R    Y+YFA+INTPNLE  YKPSP S+PLTS LHLLG+ S L    LI 
Sbjct: 237 DLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIK 296

Query: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360
           RI +G + Q   DI + GV Y+    D D+V    P    R  F+ICCDG LLN+L  Q 
Sbjct: 297 RITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQG 356

Query: 361 AHGSFDGRIHVKFLKEHSSFHLKVLS 386
             GSFDG I V FL+++S F+LKVLS
Sbjct: 357 TEGSFDGTIKVSFLQDYSPFNLKVLS 382

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  306 bits (783), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 232/376 (61%), Gaps = 16/376 (4%)

Query: 16  QFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGD--ILVVDSIKSGTGRDVKN 73
           ++ V    +GSK  SF L +    Q S        S +  D  ++V+DS+KSG GR   N
Sbjct: 14  EYYVTFAKDGSKYTSFQLEKSHAKQSSR------ASTRSDDSTLIVLDSLKSGIGRTENN 67

Query: 74  DFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIFLSGDTSISEFVNN 133
           DF + VI P+  EL  ++  +KT + +SV++  ++  P  Q+  +  +SGDT+ISEF NN
Sbjct: 68  DFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPL-QDYEIWIISGDTTISEFCNN 126

Query: 134 LTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFLKPKNFPLYKAIFP 193
           L  ++    R  + +L LP+GTGNAWANSLGF +  TA   +L   LKP++ PLY+A  P
Sbjct: 127 LPNKK--ITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALP 184

Query: 194 NGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQVTQRPL 253
           NGY I+FF+I S+GFHANLLH C+ P++ K+G ERF++A++ I E Y LD  L ++   L
Sbjct: 185 NGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLD--LDISLDGL 242

Query: 254 EH-YSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYSNQPET 312
              Y+YFALINTPNLE  YKPSP+SNPL  EL LLGYSS L +  L+ +IM+GY N+P  
Sbjct: 243 RRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNG 302

Query: 313 DI-NEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLS-QQPAHGSFDGRIH 370
           D+   E + Y++ ++D  +V     E      F+ICCDG LLN+L  Q P        I 
Sbjct: 303 DLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIR 362

Query: 371 VKFLKEHSSFHLKVLS 386
            +FL ++S F L+V S
Sbjct: 363 FQFLNDYSGFQLQVYS 378

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  297 bits (761), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 240/388 (61%), Gaps = 17/388 (4%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60
           M+   E+ L+  H   +SV+ E   S+   F L++      + T + +   + + +++V+
Sbjct: 1   MSSTEEIKLLNIHGICYSVISEPSESR---FQLVKT-----ATTTEDDRTVQNQPNLIVI 52

Query: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120
           DS+ SG GR  +ND  T V++P+F  + +D+R++KT + +++A          Q+ TV+F
Sbjct: 53  DSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLD-ISQSHTVLF 111

Query: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180
           LSGDTSISEF+NNL    QG     +++L+ P+G+GNAWA+SLG         +F++G +
Sbjct: 112 LSGDTSISEFINNL---PQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEM 168

Query: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240
               FPLYKA+FPNGY IVFFIILS+GFHANL+H C++P ++++G+E+F+LA   I ++Y
Sbjct: 169 SHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEY 228

Query: 241 ILDYPLQVTQRPL-EHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLI 299
            LD  L++T   L   YSYFALINTPNLE  Y+PSP+S+PL  EL+LLGYSSGL +   +
Sbjct: 229 ELD--LKITVNSLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFL 286

Query: 300 NRIMKGYSNQPETDINEEGVT-YQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQ 358
            ++MKGY   P   +  +  T Y  F+   DV         PR   +ICCDG LLN+   
Sbjct: 287 TKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDL 346

Query: 359 QPAHGSFDGRIHVKFLKEHSSFHLKVLS 386
           Q A      +  ++FL  +S F++K +S
Sbjct: 347 Q-ADLEVSNKFSIEFLNHYSKFNIKAMS 373

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  288 bits (737), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 230/399 (57%), Gaps = 14/399 (3%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKK-GDILV 59
           M++ ++  L+   +  + V    EGS   SF+LL   +   S     + V  K    ++V
Sbjct: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60

Query: 60  VDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVI 119
           +DSI SG GR   NDF  NV++P+F +L L + +VKT +++SV           ++  + 
Sbjct: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLD-LTKHYEIF 119

Query: 120 FLSGDTSISEFVNNLTQEQQGT--IRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177
           FLSGDT+ISEF+N L ++       + ++++L  P GTGNA ANSLG     T  + +L 
Sbjct: 120 FLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLT 179

Query: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237
                 NFPLYKAIFPNG EIVFF+ILS+GFHANLLH C+ P +KKLGVERFR+AS++I 
Sbjct: 180 SNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDIL 239

Query: 238 EDYILDYPLQVTQ-------RPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYS 290
            +Y LD  + +          P   YSYF ++NTP LE  Y PSP+SNPL S+LH++ YS
Sbjct: 240 ANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYS 299

Query: 291 SGLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDG 350
           S LP+  L+ RI+KGY N     +N  GVTY    ++  +      E  P S F +CCDG
Sbjct: 300 SSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDG 359

Query: 351 HLLNM---LSQQPAHGSFDGRIHVKFLKEHSSFHLKVLS 386
            L N+   + +       +  I ++FL  +S F L ++S
Sbjct: 360 LLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  283 bits (725), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 235/381 (61%), Gaps = 14/381 (3%)

Query: 1   MAQIVEVPLVCSHN-TQFSV-VVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDIL 58
           MA IVE+   C +N  ++SV +VE +G K  S+ L++  ND+   + D  L   +   I+
Sbjct: 1   MAAIVEL---CRNNGIKYSVEIVEVKG-KVESYKLIK-ANDR---STDCFLKFDRDTQII 52

Query: 59  VVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFR-PCGQNTT 117
           V+DS+KSGT R+ ++D    VI+P+F  LG++Y+ +KTE+ENS+ +  R      G    
Sbjct: 53  VIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYD 112

Query: 118 VIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177
           ++FLSGDTSISEF+N L      + +  +++L +PLG+GNA A SLGF+T   AL  +L 
Sbjct: 113 ILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLN 172

Query: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237
              K    PLY A  PN   ++FFIILS+GFHANLLH  + P++K +GVERF++ASK +F
Sbjct: 173 SNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVF 232

Query: 238 EDYILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPM 297
           E Y L+  + V     + YSYFA+I  PNLE  YKPSPKS+ L  ELH+LGY +G+    
Sbjct: 233 ESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLED 292

Query: 298 LINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLS 357
           L ++IM+GY N+   DI E G  YQ F  +L++         P+  +D+C DG+LLN+  
Sbjct: 293 LQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSIKTGHN-APKYRYDMCIDGYLLNLED 351

Query: 358 QQPAHGSFDGRIHVKFLKEHS 378
                  +  +I ++F+ +H+
Sbjct: 352 CNSKDNEY--KILIRFIDDHA 370

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  271 bits (694), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 144/315 (45%), Positives = 201/315 (63%), Gaps = 12/315 (3%)

Query: 46  DPELVSRKK----GDILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENS 101
           D +L++ KK    G++L+VDS+ SG+GRD   DF TNVI   F ++ + YR++KT +++S
Sbjct: 46  DEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSS 105

Query: 102 VAELGRNFRPCGQNTTVIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWAN 161
           V EL  +     Q  TV+FLSGDTSISEFVNNL           +++L  P+GTGNAWA+
Sbjct: 106 VIELASSIDSTRQ-YTVLFLSGDTSISEFVNNLPLNHD-----CISVLPFPMGTGNAWAS 159

Query: 162 SLGFRTAATALAEFLQGFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRF 221
           SL     A   ++F+ G L   +FPLY+A F NGY + FFIILS+GFHANLLHLC++  +
Sbjct: 160 SLKLMDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEY 219

Query: 222 KKLGVERFRLASKEIFEDYILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLT 281
           +K+G+ERFR+AS+ I  +Y L+  + +       +SYFALINT NLE  Y PSP S+PL 
Sbjct: 220 QKMGIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLE 279

Query: 282 SELHLLGYSSGLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPR 341
           S+LH+L Y S L +     R+  GYSN   ++I + G  Y+      +V    DP    +
Sbjct: 280 SQLHVLAYQSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPS--QK 337

Query: 342 SAFDICCDGHLLNML 356
           S F++CCDG LLN+L
Sbjct: 338 SNFEVCCDGQLLNLL 352

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  271 bits (694), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 216/362 (59%), Gaps = 17/362 (4%)

Query: 17  FSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVVDSIKSGTGRDVKNDFC 76
           + VV E +GSK  SF L  +   + SA L+   +     +++V+DSI SG GR  +NDF 
Sbjct: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSL-LASSELVVIDSICSGVGRTGQNDFY 79

Query: 77  TNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIFLSGDTSISEFVNNLTQ 136
            NV++PVF E    ++ ++TE E+S+ +L   F    ++ T+IFLSGDTS+SEF+NNLT+
Sbjct: 80  NNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFE-ASKDYTIIFLSGDTSVSEFINNLTK 138

Query: 137 EQQGTI------RPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFLKPKNFPLYKA 190
            Q+         +  +N+  +PLGTGNA A+S+   +      +FL   L  K+FPLY  
Sbjct: 139 VQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLYTV 198

Query: 191 IFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQV-- 248
             PN   I+FFII S+GFHANLLH CD   ++K+G ERF  AS+ IF++Y L+  L    
Sbjct: 199 TLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTTKN 258

Query: 249 -TQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYS 307
            ++    +Y+YFA+INTPNLE NY PSP S+   +ELHLLGY + L    L+N+IM GYS
Sbjct: 259 GSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAGYS 318

Query: 308 NQPETDI-NEEGVTYQAFSN----DLDVVFAQDPE-LVPRSAFDICCDGHLLNMLSQQPA 361
            +    I N++ +TY    N     L ++   D +  + +  +DICCDG LLN+      
Sbjct: 319 YKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLLNLDDINNQ 378

Query: 362 HG 363
           HG
Sbjct: 379 HG 380

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  269 bits (687), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/394 (40%), Positives = 228/394 (57%), Gaps = 14/394 (3%)

Query: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60
           M   V   LV     + SV ++ +GSK   F+LL  P  Q  A   P+L +R+  +++V+
Sbjct: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAP--PQLFTRE--NLIVL 56

Query: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120
           DS+ SGTGR   ND   NVI+PV   L   Y+VVK++N  SVAE G    P  Q+ T++F
Sbjct: 57  DSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT-QSYTILF 115

Query: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALP--LGTGNAWANSLGFRTAATALAEFLQG 178
           +SGDTS+SEF N +     G   P  +L  LP  +GTGNA ANSL       A A FL+G
Sbjct: 116 VSGDTSVSEFFNGVGA---GVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172

Query: 179 FLKPKNFPLYKAIFPNG-YEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237
            L    FPLY+AI P+G   +VFFI+LS+GFHANLLH  +  ++K +GVERF+ AS +I 
Sbjct: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232

Query: 238 EDYILDYPLQVTQRPLE-HYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQP 296
           ++Y L   + + ++ +   Y+YFAL+N PNLE +Y PSP+S+P   ELHLL YSS L + 
Sbjct: 233 QNYKLQEQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRK 292

Query: 297 MLINRIMKGYSNQPETDINEEG-VTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNM 355
            L+ RIM GY N+   ++  +   TY+  S   ++      E     AF++C DG L N+
Sbjct: 293 QLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNL 352

Query: 356 LSQQPAHGSFDGRIHVKFLKEH-SSFHLKVLSKY 388
           L  +      +  I V+ +     SF + V+ K+
Sbjct: 353 LQYKSDQHQEELTIQVELIDSALGSFDILVMGKH 386

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  261 bits (668), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 144/336 (42%), Positives = 201/336 (59%), Gaps = 16/336 (4%)

Query: 55  GDILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQ 114
           G ++V+DS++SG GR+   DF   V+ PV   L +++  V+T +  SV EL   F P   
Sbjct: 135 GPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETF-PRTS 193

Query: 115 NTTVIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAE 174
            TTV+ +SGDT+ISEFVN L           V + ALPLGT NAWA+S+G  T A AL  
Sbjct: 194 ETTVLVMSGDTTISEFVNALGSGA------GVTVYALPLGTANAWAHSVGLGTPAKALQA 247

Query: 175 FLQGFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASK 234
           F+QG +    FPLY+A FP+GY I FFI+LS GFHANLLHLC+  R+++LGVERFR AS 
Sbjct: 248 FVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREAST 307

Query: 235 EIFEDYILDYPLQV-----TQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGY 289
           EI + Y L   ++V     +++    Y+YFAL+NTP+LE+ Y PSP S+PL  +LH+L +
Sbjct: 308 EILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAF 367

Query: 290 SSGLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCD 349
            + L +  L   +M GYS    + ++  G+ Y+   +   +          R A ++C D
Sbjct: 368 EAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGAS--DRVANELCVD 425

Query: 350 GHLLNMLSQQPAHGSFDGRIHVKFLKEHSSFHLKVL 385
           GHLLN++  Q     FDG I V  +   +SF LK L
Sbjct: 426 GHLLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKAL 459

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  256 bits (654), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/366 (39%), Positives = 220/366 (60%), Gaps = 14/366 (3%)

Query: 1   MAQIVEVPLVCSHNTQ-FSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILV 59
           +A  +E PL   + +Q F V +  +GSK  +F L+            P        +++V
Sbjct: 4   LATTIE-PLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY-----ENVVV 57

Query: 60  VDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVI 119
           +DS+ SGTGR+  N F   VI+P+F    + +   KT    S++   ++     ++ TVI
Sbjct: 58  IDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLD-LSKSYTVI 116

Query: 120 FLSGDTSISEFVNNLTQ--EQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177
           F+SGDTSISEF+NNL    E    ++ T+++L LP+GTGNA+++S+G +     L+ FL 
Sbjct: 117 FISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLH 176

Query: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCD-QPRFKKLGVERFRLASKEI 236
              +P +FPLY+ IFPNG  ++FFIILS+G HAN+LHLC+  P++KK G ERF+LA +++
Sbjct: 177 NRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKV 236

Query: 237 FEDYILDYPLQVTQRPLE-HYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQ 295
              Y L+  LQ+ +  L   +SYF LINTPNLE +Y PSP S+P   +LH+LGYSS L  
Sbjct: 237 MTTYDLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNN 296

Query: 296 PMLINRIMKGYSNQPETDINEEG-VTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLN 354
             L+N + +GYSN+   ++ E   + Y+  S ++ +V  +D E   +  +DICCDG L N
Sbjct: 297 EDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEE-SEKYKYDICCDGLLFN 355

Query: 355 MLSQQP 360
           +    P
Sbjct: 356 LRDMLP 361

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  221 bits (563), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 194/353 (54%), Gaps = 40/353 (11%)

Query: 52  RKKGDILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRP 111
           +    ++++DS  SG GR+ +NDF   +++P+ ++L + + + KT +++S+     NF  
Sbjct: 79  KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSI 138

Query: 112 CGQNTT-----VIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFR 166
             ++TT     +IFLSGDT+ISEF NNL  +Q  T +  +N+L +P+GT NAW+NSL   
Sbjct: 139 KTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLN 198

Query: 167 TAATALAEFLQGFLKPKNFPLYKAIFPNGY-------------EIVFFIILSIGFHANLL 213
                  +FL   L    FPLY  I P+                I FFI+LS+GFHANLL
Sbjct: 199 CPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLL 258

Query: 214 HLC-DQPRFKKLGVERFRLASKEIFEDYILDYPLQVTQRPL---------EHYSYFALIN 263
           HLC +  ++  LG+ERF+LAS EI  +Y L+  L +T             + +SYF L+N
Sbjct: 259 HLCSNDEKYSNLGLERFKLASDEILSNYNLN--LNITIESCNDKSHIILNDSFSYFNLMN 316

Query: 264 TPNLEQNYKPSPKSNPLTSELHLLGYSSG-LPQPMLINRIMKGYSNQPE----TDINEEG 318
           TP LE NY PSP S+PL + LH+L Y S    +  LI  IMKGYSN+       +I+E+G
Sbjct: 317 TPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDG 376

Query: 319 VTY-----QAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQPAHGSFD 366
           + Y     + F   L+        L     +++CCDG L N+L+ Q   G  D
Sbjct: 377 IIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGKQD 429

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  160 bits (406), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 123/202 (60%), Gaps = 8/202 (3%)

Query: 190 AIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDYILDYPLQVT 249
           A FP+   I FFIILS+GFHA LLH C +P   K+G ERF+LA+KEI E Y LD  ++V 
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV- 60

Query: 250 QRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLINRIMKGYSNQ 309
            +    Y+YFA+INT NLE  Y PSPKSN L + L LLGYSS L +  L+++IMKGY  +
Sbjct: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 310 PETDINEEGVTY----QAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQPAHGSF 365
               I  +  TY        + +D++  +         F+ICCDG LL+++  + + G  
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM--EKSKGRT 178

Query: 366 DG-RIHVKFLKEHSSFHLKVLS 386
           D   IH+  +K++ SF L+VL+
Sbjct: 179 DNLTIHINSVKDYLSFDLQVLT 200

>Kwal_33.13989 s33 (473104..473472) [369 bp, 122 aa] {OFF} [contig
           107] FULL
          Length = 122

 Score = 33.5 bits (75), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 156 GNAWANSLGFRTAATALAEFLQGFLKP 182
           G+ W N + FR AA  +A F QGFLKP
Sbjct: 41  GSCWLNCMEFRLAAALVASF-QGFLKP 66

>TBLA0A06140 Chr1 complement(1508271..1512644) [4374 bp, 1457 aa]
           {ON} Anc_6.229 YGL131C
          Length = 1457

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 311 ETDINEEGVT-YQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQ 358
           ETDIN    +  +A  N ++    QD EL+ R   DIC D  +L  L +
Sbjct: 785 ETDINHLCSSPEKAHENRIEWELVQDAELISRQRLDICIDPEVLRKLKR 833

>YLR233C Chr12 complement(607425..609524) [2100 bp, 699 aa] {ON}
           EST1TLC1 RNA-associated factor involved in telomere
           length regulation as recruitment subunit of telomerase;
           has G-quadruplex promoting activity that is required for
           telomere elongation; possible role in activating
           telomere-bound Est2p-TLC1-RNA
          Length = 699

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 11/95 (11%)

Query: 199 VFFIILSIGFHANLLHLCDQPRFKKLGVERFR-LASKEIFEDYILDYP--LQVTQRPLEH 255
           VFF+ LS  F AN++ +  +P ++K  +E FR LA   +   +I  Y   LQ T R  + 
Sbjct: 401 VFFLDLSFDFIANIIDVVIKPSWQK-NMEDFRYLAIIRLLMCWIKSYRSILQYTHRHRKF 459

Query: 256 YSYFA-----LINTP-NLEQN-YKPSPKSNPLTSE 283
            + FA     LIN+P N   N Y   PK + L  E
Sbjct: 460 CTSFALLLNDLINSPLNCSGNIYSHRPKRSYLFRE 494

>KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|P38141 Saccharomyces
           cerevisiae YBR240C THI2 Zinc finger protein of the
           Zn(II)2Cys6 type probable transcriptional activator of
           thiamine biosynthetic genes
          Length = 348

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 242 LDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSEL---HLLGYSSGLPQPML 298
           LD+PL V     +  +   LI   NL  +YKPS ++N   S+L    +  Y + +    L
Sbjct: 263 LDFPLLVQLCQCQSSNRSTLIYLRNLIAHYKPSSRNNENISKLIKMEIEQYITAIDLSTL 322

Query: 299 INRIMKGYSNQPETDINEEGVTYQAF 324
              I+  +SN  E D N+  +  Q  
Sbjct: 323 PTPILDAFSNSIEWDNNDNYMKLQVM 348

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,723,409
Number of extensions: 2014003
Number of successful extensions: 4693
Number of sequences better than 10.0: 26
Number of HSP's gapped: 4776
Number of HSP's successfully gapped: 26
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)