Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196785.706ON1178117856930.0
KLTH0E00968g5.706ON1148117941930.0
SAKL0E15004g5.706ON1196119132820.0
AFR290W5.706ON121795528240.0
ZYRO0B16412g5.706ON137296428170.0
TDEL0B021405.706ON114795327590.0
Ecym_40155.706ON125795427150.0
KLLA0A00528g5.706ON122995826340.0
KNAG0C066305.706ON128199726220.0
KAFR0H001805.706ON124198026190.0
Kpol_1043.735.706ON126095625750.0
CAGL0G02541g5.706ON129595925580.0
Smik_11.3605.706ON118096425220.0
Skud_11.3365.706ON118896725100.0
YKR096W5.706ON119597124590.0
TPHA0E001905.706ON136198223790.0
CAGL0H06611g5.706ON1282101423100.0
YIL151C5.706ON111896122670.0
Skud_9.175.706ON111895422530.0
Suva_9.375.706ON111795322410.0
Smik_9.185.706ON111896122250.0
Suva_11.3335.706ON118732014071e-174
NCAS0A031705.706ON131933913181e-160
NDAI0E050705.706ON155636312241e-144
TBLA0E017105.706ON152639610761e-124
TPHA0D046405.706ON9621972123e-16
CAGL0H03487g6.211ON535124850.27
KAFR0C03660singletonON84759791.5
Smik_14.661.82ON195273782.0
NDAI0E019602.425ON60682727.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19678
         (1178 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  2197   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1619   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1268   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1092   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1089   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1067   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1050   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  1019   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1014   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1013   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   996   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   989   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   976   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   971   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   951   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   920   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   894   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   877   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   872   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   867   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   861   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   546   e-174
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   512   e-160
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   476   e-144
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   419   e-124
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    86   3e-16
CAGL0H03487g Chr8 (324020..325627) [1608 bp, 535 aa] {ON} simila...    37   0.27 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    35   1.5  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...    35   2.0  
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     32   7.6  

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 2197 bits (5693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/1178 (91%), Positives = 1078/1178 (91%)

Query: 1    MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYMXXXXXXXXXXXXXXXXXXXXXXXFLD 60
            MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYM                       FLD
Sbjct: 1    MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYMGSGVSKRRVGSGVSGTTAAAAASFLD 60

Query: 61   CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNAXXXXXXXXXXXXXXEAAVTENENGSVN 120
            CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNA              EAAVTENENGSVN
Sbjct: 61   CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNAYSPSYLPTTSSSNLEAAVTENENGSVN 120

Query: 121  FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQ 180
            FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQ
Sbjct: 121  FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQ 180

Query: 181  DFREGSTPENSSRSSRHGPHDNQESKGYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            DFREGSTPENSSRSSRHGPHDNQESKGYA                               
Sbjct: 181  DFREGSTPENSSRSSRHGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSSSPT 240

Query: 241  XXXLVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITT 300
               LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITT
Sbjct: 241  SQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITT 300

Query: 301  ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI 360
            ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI
Sbjct: 301  ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI 360

Query: 361  SISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKL 420
            SISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKL
Sbjct: 361  SISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKL 420

Query: 421  YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLM 480
            YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLM
Sbjct: 421  YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLM 480

Query: 481  VEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFF 540
            VEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFF
Sbjct: 481  VEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFF 540

Query: 541  RHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIETTSH 600
            RHAPAFAESHILQTVGFGDPKNP                             TSIETTSH
Sbjct: 541  RHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSIETTSH 600

Query: 601  LSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHM 660
            LSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHM
Sbjct: 601  LSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHM 660

Query: 661  LPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPI 720
            LPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPI
Sbjct: 661  LPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPI 720

Query: 721  DTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHP 780
            DTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHP
Sbjct: 721  DTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHP 780

Query: 781  FWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGH 840
            FWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGH
Sbjct: 781  FWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGH 840

Query: 841  PLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYR 900
            PLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYR
Sbjct: 841  PLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYR 900

Query: 901  QMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELE 960
            QMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELE
Sbjct: 901  QMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELE 960

Query: 961  RLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATN 1020
            RLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATN
Sbjct: 961  RLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATN 1020

Query: 1021 NVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLE 1080
            NVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLE
Sbjct: 1021 NVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLE 1080

Query: 1081 EHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVS 1140
            EHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVS
Sbjct: 1081 EHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVS 1140

Query: 1141 DDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            DDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN
Sbjct: 1141 DDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1619 bits (4193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1179 (68%), Positives = 906/1179 (76%), Gaps = 32/1179 (2%)

Query: 1    MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYMXXXXXXXXXXXXXXXXXXXXXXXFLD 60
            ME MRDIPT  SG    A+  QQKRQHSRS +YM                       FLD
Sbjct: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD 60

Query: 61   CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNAXXXXXXXXXXXXXXEAAVTENENGSVN 120
              GSP+RR++      + P+  MP +  S                  EAA  ENEN SV 
Sbjct: 61   SGGSPVRRKD-----AQSPSY-MPTTSSS----------------NLEAAAVENENSSVR 98

Query: 121  FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQ 180
              DICI     DP   R   +   N + +  +  S +QH T  N IQ  S+  G P G+ 
Sbjct: 99   LSDICI-----DP---RMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNA 150

Query: 181  D-FREGSTPENSSRSSRHGPHDNQESKGYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
              + E S P N++++   G      + G                                
Sbjct: 151  PAYSEHSVPNNAAQT-ESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQ 209

Query: 240  XXXXLVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFIT 299
                LVQKLQDIYRNIVKQEVELQERC+QLT SQTTDLKNLWIIYK+N ELINNYVAFIT
Sbjct: 210  TSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFIT 269

Query: 300  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 359
            TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF
Sbjct: 270  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 329

Query: 360  ISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGK 419
            ISIS MLGDMPQKF+TPW ERLGDLSRMAIALYPSGFIDWKLSAEHWY+QALSHIFGHGK
Sbjct: 330  ISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGK 389

Query: 420  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSL 479
            LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERNGGN RNSL
Sbjct: 390  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSL 449

Query: 480  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYF 539
            MVEYLKHSEVMLLSSFLESPELQKVVLSFFQ+KFG+S++NTD+F+ + +FLQDGER KYF
Sbjct: 450  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYF 509

Query: 540  FRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIETTS 599
            FRHAPAFAESHILQ VGFG+PKNP                             TS+E  S
Sbjct: 510  FRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPS 569

Query: 600  HLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTH 659
              SP EYLE+VDSPR+ YEFP DLAIW++SLSHIN TS +CS++V QKFL GPLV A  H
Sbjct: 570  PTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAH 629

Query: 660  MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP 719
            +LPW+YFLLSLA++ID LPS ELK FWI L RQ+FPWNSIV+FLNM++AF LDN WKTS 
Sbjct: 630  LLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSS 689

Query: 720  IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDH 779
            ID LCEQ DSVD R+LV+HFS++EDLPE+W+CWGALWFDVI+DKS+  D     +  +DH
Sbjct: 690  IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDH 749

Query: 780  PFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAG 839
             F D+P DGICFDEDDE G +FWKRACRL+FIFKGIAQEF++GLTL++   QSRR + AG
Sbjct: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAG 809

Query: 840  HPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGY 899
            HPLQNF F FE+ P  S+  + +  Q+P FE I+  NLDPN  PGQSMLEG+S+F+ PGY
Sbjct: 810  HPLQNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGY 869

Query: 900  RQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITEL 959
            RQ++AD+TCFNK+G+LI+CSLYTSG LE+GPI GGDDFNTERY RS++ NK +N QI EL
Sbjct: 870  RQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKEL 929

Query: 960  ERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLAT 1019
            +++ER WLD CMNPEFIEQ Y+MKFPFGDLSCNCDSGVSYFV DATSWLRHFAHV+KLAT
Sbjct: 930  DKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLAT 989

Query: 1020 NNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHL 1079
            N VLRF ICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYS+K+LLPLRFTGNVATHL
Sbjct: 990  NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHL 1049

Query: 1080 EEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALV 1139
            EEHLEFEEQITWRSHVDEFVIEAVYKAQ KFEA+NAQAKE GHDFI TT+EEPFHF+ALV
Sbjct: 1050 EEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALV 1109

Query: 1140 SDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            SDDTNMR+KAH QRI+TFS+RFMFAVCNQIGLAH ACTN
Sbjct: 1110 SDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1191 (55%), Positives = 818/1191 (68%), Gaps = 55/1191 (4%)

Query: 20   TVQQKRQHSRSYEYMXXXXX-----XXXXXXXXXXXXXXXXXXFLDCEGSPLRRREVTPT 74
            T+ QKR +S SY+Y                             FLD   +P + +E TP+
Sbjct: 29   TLHQKRHNSNSYDYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTPSKHQECTPS 88

Query: 75   LGRGPTIGMPHSVMSADNAXXXXXXXXXXXXXXEAA--VTENENGSVNFPDICIERQRTD 132
              +  T   P     AD                EAA  V  N+N SV  PDICI+ ++  
Sbjct: 89   SFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPDICIDNKQQP 148

Query: 133  PHSVRYTRTEQGN--VRPQSHESLSNHQHHTLPNSIQGG-------SSSAGLPTGDQDFR 183
                +    ++ N   +  +  + +  Q  ++ + +QG        SS+    T  Q  +
Sbjct: 149  ERRQQQRLEKRVNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTHADTNQQSDQ 208

Query: 184  EGSTPENSSRSSRHGPHDNQESKGYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
              S  + SS  S  G  +N+E+ G                                    
Sbjct: 209  HNSVQQGSSGGSDDG-ENNRENSGIPIVNVPPKHTSQA---------------------- 245

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIYR+IVKQE+ELQERC+QLT SQTTD+KNLW+IYK+N ELINNY++FITTALL
Sbjct: 246  LVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALL 305

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQPEQDLLIGQEIV IYR+ERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI+HVF+SIS
Sbjct: 306  PSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSIS 365

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             MLGD+P ++S PW ERLGDLSRMAIALYPSGFIDWKLSAEHWYSQAL + +GHGKLYYH
Sbjct: 366  NMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYH 425

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAFAER+GG+ RN  +VEY
Sbjct: 426  MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIVEY 485

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSEVMLL SFLESPELQKVVL+FFQ +FGV  +N DFF+ + +F+QDGE+++YFF HA
Sbjct: 486  LKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHA 545

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-TSIET---TS 599
            PAFAESHILQ VGFGDP+NP                              T+++    +S
Sbjct: 546  PAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLDDGNGSS 605

Query: 600  HLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTH 659
             +S   Y EN+DS R  Y FP+D+ IW++SLS++N+TS  CS  V +KFL  PL+ A+ H
Sbjct: 606  SISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPH 665

Query: 660  MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP 719
            +LPW++FL+S+A++I SL S  LK FW+  +R+IFPWNS+V FLN LMAF+LDN+   S 
Sbjct: 666  LLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSS 725

Query: 720  IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDH 779
            ++ LCE+ + +D  +LVEHF+  E+LPE+W+CWG LWFD I++KS  +   V ++G +DH
Sbjct: 726  VEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDH 785

Query: 780  PFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAG 839
             F D P DGICFD+DDE G KFWKRACR+IF+FKG+A+EF  G+ +S     +RR +T  
Sbjct: 786  LFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRRDVTTL 845

Query: 840  HPLQNFSFNFEEIPAQSQIQSFVR--NQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFP 897
            H L+ FSF FEE+P +   + F++  N I +FE I+  N +    P  SM++GESIF+F 
Sbjct: 846  HALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQ 905

Query: 898  GYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRS----EDSNKP-- 951
            GYR+MY DY CFNK+G LI+ SLYTSG LER  IQGGDDFN +R+  +       N P  
Sbjct: 906  GYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVD 965

Query: 952  --ENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLR 1009
              E    T +E  ER WL+ CM+P F+E   + +FP GDL+CN DS V+YFVLDATSWLR
Sbjct: 966  CNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATSWLR 1025

Query: 1010 HFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPL 1069
            HFAHV+KLATNNVL+F ICLTTFQELRFLRKSKDESVVEAATRAVIT RQLY ++KLLPL
Sbjct: 1026 HFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPL 1085

Query: 1070 RFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIAT-- 1127
            RFTGN+ATHLEEHLEFEEQITWRSHVDEFVIEAVYK+Q+KF+ +N QA++ G ++I T  
Sbjct: 1086 RFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDP 1145

Query: 1128 TDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
             D++ F+FV LV+DD NMR KA    I  FS+RFMFA CNQ+G   + C N
Sbjct: 1146 KDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/955 (58%), Positives = 682/955 (71%), Gaps = 42/955 (4%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L++KLQ+IYRNIV+QE ELQ+RC+QLTTSQTTDLKNLWIIYK+N ELI+NY  FITTALL
Sbjct: 285  LMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTALL 344

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            P+QPE DLLIG+EI+ +YRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI +VFISIS
Sbjct: 345  PTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFISIS 404

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             MLGD+P KFS  W ERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL + FGHGKLYYH
Sbjct: 405  NMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLYYH 464

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTL AFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERN G+HRN+ +VEY
Sbjct: 465  MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLVEY 524

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKH+EVMLL SFLES ELQ VVL+FF+ KFGV TSN DFF+PR +F+QD ER+K+FFRHA
Sbjct: 525  LKHTEVMLLPSFLESSELQDVVLAFFEQKFGV-TSNVDFFDPRLVFVQDSERLKHFFRHA 583

Query: 544  PAFAESHILQTVGFGDPKNPXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXTSIET-TS 599
              +AESH+LQ VGFGDP+NP                                TSI+   +
Sbjct: 584  SLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQYDTSIDDDCA 643

Query: 600  HLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTH 659
              +PSE+ E +DS +Y Y+FP+D+ IW+ESLS+ N+T+ +CS IV +KFL GPL+ A+ H
Sbjct: 644  FAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPH 703

Query: 660  MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP 719
            +LPW YFL +   ++ ++P  E++ FW+ LVRQ+FP+N+I+ FLN+L+ ++ +      P
Sbjct: 704  LLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFP 763

Query: 720  IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDH 779
             D   EQ   +    LV +F E+E+LPE+W CWG LWFD +  K      D+ ++G KDH
Sbjct: 764  FDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINSTGVKDH 823

Query: 780  PFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAG 839
             F D P DGI FD +DE GEKFWKR  R+I +F+ +A E  +GL          R ++ G
Sbjct: 824  MFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL----------REISGG 873

Query: 840  HPLQNFSFNFEEIPAQ---SQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDF 896
               ++  F FEE P++     ++ F       FE+I+  NLD    P   M     I   
Sbjct: 874  RNWRSLVFKFEEPPSEWCDMYLEPFTL-VFDTFEQISPVNLDQRATPYCGMTPDIDIRTL 932

Query: 897  PGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQI 956
             GYR +  DY CFN++G +I+ SLYT G LE   I GGDDFN +R          EN ++
Sbjct: 933  QGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRL--------LENGEL 984

Query: 957  TELERLERDW---LDNCMNP---EFIEQA-------YEMKFPFGDLSCNCDSGVSYFVLD 1003
               ER  RD+   +D    P   EF+          +E   P GDL C  D+ V+YFVLD
Sbjct: 985  VSTER--RDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLD 1042

Query: 1004 ATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSD 1063
            AT+WLRHF HV+KLA NN+L+F ICLTTFQELRFLRKSKDESV+EAATRAVITVRQLY +
Sbjct: 1043 ATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYE 1102

Query: 1064 KKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHD 1123
            +KLLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA++KAQ KF A+N  AK A  D
Sbjct: 1103 RKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRD 1162

Query: 1124 FIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
             I T  ++ F+F+ALV+DD NMR KA  Q I+ FSTRFMF+VCN++G A   CTN
Sbjct: 1163 CIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/964 (56%), Positives = 676/964 (70%), Gaps = 37/964 (3%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+ IVKQE+ELQERC+QLTTSQTT+LKNLW IYKIN +LINNYV F+TTALL
Sbjct: 417  LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTALL 476

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQ EQD+LIG+EIV IYRIERRLWV+GTITFLD+ KNFSNFMDPEVCCQFITHVFISIS
Sbjct: 477  PSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISIS 536

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             MLGD+P K+  PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLYYH
Sbjct: 537  NMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 596

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ERN GNHRN+ ++EY
Sbjct: 597  MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIEY 656

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSEVMLL SFLES +LQ+VVL +F+ KFG  ++N + F+ R MF Q+ + ++YFFRHA
Sbjct: 657  LKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRHA 716

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSI-------- 595
            PAFAESHILQ VGFGDPKNP                              +         
Sbjct: 717  PAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTMAIDDL 776

Query: 596  --ETTSHLS-PSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGP 652
              E +  +S P  +  N+++ R+ Y  P +L IW ESL++IN+TS +CS +V QKFL+GP
Sbjct: 777  EDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGP 836

Query: 653  LVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLD 712
            LVVA+ H +PW+YF++SLA KI  L     + FW+  V +IFPWN+IV FLN+L+A++LD
Sbjct: 837  LVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD 896

Query: 713  NNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVI 772
            N+WK+S +D+LC Q  S+    L+++F+ +E LPE+W+CWG LWFD I +K      D+ 
Sbjct: 897  NSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVEDLE 956

Query: 773  NSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQ- 831
            + G K+H F D P DGI FD +DE GE FWKRACR+IF+FKG+A+ F +G+TLS  AP  
Sbjct: 957  SVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAPVY 1016

Query: 832  -SRRPMTAGHPLQNFSFNFEE------------IPAQSQIQ-SFVRNQIPLFEEIATGNL 877
              R  ++  H L++FSF                 P+ + I    ++N + +FEE +  N+
Sbjct: 1017 CRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWENI 1076

Query: 878  DPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDF 937
              +  P  S++EGESIFD+ GYR+++ DY  ++K+G  +S SLYTS          G   
Sbjct: 1077 HMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV-- 1134

Query: 938  NTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGV 997
                +G   DS +     + E+        +  M P +     +  F    L     S  
Sbjct: 1135 -IPAHGSDVDSQRDAVQSVQEMH-----IFNQIMEPGYCGGFADDLFLRDALYQTAHSST 1188

Query: 998  SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITV 1057
            +YFVLD T+WLRHF H++KLA++ VL+F ICLTTF ELRFLRK KDE+VVEAATRA+ITV
Sbjct: 1189 TYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITV 1248

Query: 1058 RQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQA 1117
            RQLYS+ KLLPLRFTGNVATH+EEHLEFEE+ITWRSHVDEFVIEAVYKAQ KF+ +N   
Sbjct: 1249 RQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQ 1308

Query: 1118 KEAGHDFI---ATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQ 1174
             E         A  D     FV LV+DD+NMR KA  Q ++TFST+F+F++CN IGL  +
Sbjct: 1309 LEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSK 1368

Query: 1175 ACTN 1178
             CTN
Sbjct: 1369 ICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/953 (56%), Positives = 660/953 (69%), Gaps = 63/953 (6%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+ IVKQE+ELQERC+QLT SQTT+LK LW+IYK+N +LINNYV FITTALL
Sbjct: 240  LVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALL 299

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            P Q +QDL IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFITHVFISIS
Sbjct: 300  PPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISIS 359

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+P +++ PW++RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +I+GHGKLYYH
Sbjct: 360  NMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYH 419

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQRAF ERN GNHRNS ++EY
Sbjct: 420  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEY 479

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSEVMLL SFLES +LQ+VVL +F+ KFG+ T+  + F+ R MF Q+ +++KYFFRHA
Sbjct: 480  LKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHA 539

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIETTSHLSP 603
            PAFAESHILQ VGFGDPKNP                              + ET+S ++ 
Sbjct: 540  PAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSS---VTTETSSAMAI 596

Query: 604  SE----------------YLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQK 647
             E                + +N+DS    Y FP  L +W  SL ++NITS  CS IV +K
Sbjct: 597  DEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKK 656

Query: 648  FLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLM 707
            FL GP+VVA+ H+LPW+YF++++  K+  +     + FW+ LV +IFPWN+IV+FLN+L+
Sbjct: 657  FLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLI 716

Query: 708  AFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGE 767
            A+ LDN   + PID LCE+L ++    LVEHF+ +EDLPE+W+CWG LWFD I DK   +
Sbjct: 717  AYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQ 776

Query: 768  DGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSA 827
                 ++G KDH F DLP DGI FD DDE G KFWKRACR+IF+FK IA+ F   L +S+
Sbjct: 777  MDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSS 836

Query: 828  FAP-QSRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQS 886
             A    RR     H L++F F   +    S   S ++N I +FEE +  N D  + P  S
Sbjct: 837  QAQVHCRRTDPMNHVLKSFCFKLRDTFYNS--NSVLQNTIEVFEEGSDANKDMQMTPQLS 894

Query: 887  MLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSE 946
            +LE ESIF + GY+++ +D +C+++ G  +S SLYTS                  +G   
Sbjct: 895  VLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTS------------------WGNET 936

Query: 947  DSNK-PENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDAT 1005
              N+ P++    +    E D     +N    E  + + FP     C  +   ++FVLDAT
Sbjct: 937  SKNEIPQSEPTQQQTANEADLFIEGINTSLTE--FNIDFP----ECKMNGKDTFFVLDAT 990

Query: 1006 SWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKK 1065
            SWLRHFAHV+KLA+N VL+F ICLTTFQELRFLRKSKDE+VVEAATRAVITVRQLY++ +
Sbjct: 991  SWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENR 1050

Query: 1066 LLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFI 1125
            +LPLRFTGNVATH+EEHLEFEEQITWRSHVDEFV EA+ KAQ +                
Sbjct: 1051 ILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL--------------- 1095

Query: 1126 ATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
             + +   FH V LV+DD NMR KA    I T STRF+FA CN +G   + CTN
Sbjct: 1096 -SQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/954 (57%), Positives = 674/954 (70%), Gaps = 38/954 (3%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LV+KLQ+IY+NIVKQE ELQERC+QLTTSQTTDLKNLW+IYK+N ELI+NY  FITTALL
Sbjct: 323  LVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALL 382

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            P+QP+ DLLIGQEI+ +YRIERRLW++GTITFLDVLKNFSNFMDPEVCCQFI +VFISIS
Sbjct: 383  PTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISIS 442

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             +LG++P  FS  W ERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL + FGHGKLYYH
Sbjct: 443  NILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYH 502

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTL AFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERN G+HR S +VEY
Sbjct: 503  MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEY 562

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKH+EVMLL SFLE+ E Q VVL+FF  KFG +T + +FF+P  +F+QD ER+K+FFRHA
Sbjct: 563  LKHTEVMLLPSFLENVESQGVVLAFFDQKFG-ATGSANFFDPSLIFVQDCERLKHFFRHA 621

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXTSIETTSH 600
              +AESHILQ VGFGDP+NP                                 SI+ T  
Sbjct: 622  SLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSDMSIDDTFL 681

Query: 601  LSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHM 660
              P ++ E ++S + AY F +DL IW+ESL+++N TS RCS +V +KFL   L+ A+ H+
Sbjct: 682  GDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHL 741

Query: 661  LPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPI 720
            LPW+YFL+++ L++D++ + + K FWI  +RQIFPW SI +FLN+L+ ++ D      PI
Sbjct: 742  LPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPI 801

Query: 721  DTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHP 780
            D       ++    L+E+F E+EDLPE+W CWG LWFDVI  K      D+ ++G KDH 
Sbjct: 802  DEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHSTGVKDHM 861

Query: 781  FWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGH 840
            F D P DGI FD  DE GEKFWKR  R+I +F+GIA +F  G T                
Sbjct: 862  FLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT----------EFNGSD 911

Query: 841  PLQNFSFNFEEIPAQSQIQ---SFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFP 897
              ++  F F E PA+ + Q   SF + +   FE I+  N D    P + M+ G  I    
Sbjct: 912  DWKSLVFKFNEPPAEWKEQYLGSFSK-EYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQ 970

Query: 898  GYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQIT 957
            GY+Q+  DY CFNK+G LI+ SLYTSG  E G    G   ++E +G ++     EN  + 
Sbjct: 971  GYKQLVPDYLCFNKNGDLITGSLYTSGMSEGG---SGVPNDSEDFGSTK--RLLENELLV 1025

Query: 958  ELERLERDW---LDNCMNP---EFIEQAY-------EMKFPFGDLSCNCDSGVSYFVLDA 1004
              ER  RD+   LD    P   EF++  Y       E   P GDL    D+ V+YFVLDA
Sbjct: 1026 TSER--RDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDA 1083

Query: 1005 TSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDK 1064
            T+WLRHF HV+KLAT+N+L+F ICLTTFQELRFLRKSKDESV+EAATRAVITVRQLY ++
Sbjct: 1084 TTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYER 1143

Query: 1065 KLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDF 1124
            KLLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF  +N  AK +G + 
Sbjct: 1144 KLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRES 1203

Query: 1125 IATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            I T D+  F+F+ALV+DD NMR KA  Q I+ FST+FMFA+C++IGL+ + CT+
Sbjct: 1204 ITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/958 (53%), Positives = 667/958 (69%), Gaps = 35/958 (3%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LV+KLQ+IY++IVKQE ELQERC+ LTT QTTDLKNLW+ YKIN ELI+NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQ E  L IGQEIV++YRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+P K+S PW ERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L   FGHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC D F+PSPQYMQLVIDNIYQRAFAER+   +R + +V+Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKH+EVMLL SFLES ELQ VV+ +FQHKFGVS+S  +FF+P  +F+QD ER+K+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIE-----TT 598
              F++SHILQ  GFGDPKNP                              S++     + 
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQ 642

Query: 599  SHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVT 658
               S  ++   +DSP+  YEFP DL +W+ SL +IN+TS +C  IV ++FL GP+V A+ 
Sbjct: 643  QQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALP 702

Query: 659  HMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTS 718
            H+LPW  F++S+ +++D +  + LK FWI  +R+IFPW+S++ F+N L+ + +    K  
Sbjct: 703  HVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNF 762

Query: 719  PIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKD 778
             ID        ++   L+    E+E+LPE W CWG+LWF+ I+ KS+ +   + ++G  D
Sbjct: 763  DIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSD 822

Query: 779  HPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTA 838
              F D P +GICFD+DDE G K+W+R CR + +F  I +          +    ++    
Sbjct: 823  TLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE----WEACDGYGHGCKKLNPE 878

Query: 839  GHPLQNFSFNF----------EEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPG-QSM 887
                +N  F F          E  P +++   F +     FE I+  N   N++ G +SM
Sbjct: 879  ATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEK-----FEIISNLNCSDNLQDGSKSM 933

Query: 888  LEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERY---GR 944
            + G SI +  G++ MY DY CFNK+G LI+ SLYT G LE   IQGGDDFN  +    GR
Sbjct: 934  IPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGR 993

Query: 945  SEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDA 1004
                ++ E +  + +++LE+ WL+  MNP+F ++    +   G+L+C  D+ V++FVLDA
Sbjct: 994  LVVQDRLEYS--SAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDA 1051

Query: 1005 TSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDK 1064
            T+WLRHFAH++KLAT++VL+F ICLTTFQELRFLRKSKDESV+EAATRAVI VRQLY ++
Sbjct: 1052 TTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYER 1111

Query: 1065 KLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDF 1124
            KLL LRFTGNVA HLEEHLE EEQ+TW+SHVDEFVI+A+ KAQ KF  +N  A E G D 
Sbjct: 1112 KLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDC 1171

Query: 1125 IATTDE----EPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            I  +++    + F+FV+LV+DD NMR KA    I+TFSTRF+FA+C ++G     CTN
Sbjct: 1172 IPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/997 (52%), Positives = 665/997 (66%), Gaps = 68/997 (6%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+ IVKQE+ELQERC+QLTTSQTT+LKNLW IYKIN +LINNY  FITTALL
Sbjct: 291  LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTALL 350

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQP QD+LIG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFITHVFIS+S
Sbjct: 351  PSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 410

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             +L D+P K + PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLYYH
Sbjct: 411  AILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 470

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN-GGNHRNSLMVE 482
            MSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQR F +RN GGN+RN  +++
Sbjct: 471  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDLID 530

Query: 483  YLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRH 542
            YLKHSEVMLL SFL S +LQ+VVL++FQ +FG+  S  + F+ +DMF Q    +++FFRH
Sbjct: 531  YLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRH 590

Query: 543  APAFAESHILQTVGFGDPKNP-----------------------XXXXXXXXXXXXXXXX 579
            APAFAESHILQ VGFG+PKNP                                       
Sbjct: 591  APAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSSTAPKTV 650

Query: 580  XXXXXXXXXXXXXTSIETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSAR 639
                            E T+ LS  EYL+N+++ +YA E P D+  W +SL  IN+TS +
Sbjct: 651  DDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFINMTSLK 709

Query: 640  CSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSI 699
            CS IV +KFL GPL++A+ H LPW+ F+++  +K++ L + +   FW  L+++IFPW++I
Sbjct: 710  CSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTI 769

Query: 700  VDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDV 759
              FLN+L+A+VLDN   T+ I+ LC Q   +D   ++ HF++ EDLPE+W+CWG LW+D 
Sbjct: 770  TSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDA 829

Query: 760  IADKSNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF 819
            I +K++ +       G  DH F D P DGI FD +DE G KFWKRA R+IF+FKGI+++F
Sbjct: 830  ICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKF 889

Query: 820  SLGLTLSAFAP-QSRRPMTAGHPLQNFSFNFEEI--PAQSQIQSFVRNQIPLFEEIATGN 876
              GL +S  A    R    A  PL+ F+F  E    P  S+   F    IPL EE++  N
Sbjct: 890  DFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEF----IPLCEEVSAIN 945

Query: 877  LDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDD 936
             D    P  S+++GE+IF++ GYR +  D   F+K+G ++S S+YTS  ++ G       
Sbjct: 946  NDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAAS 1005

Query: 937  FNTERYGRSED------SNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKF-PFGD- 988
              T+    SE       +  P +A ++   +     + +  +P   E     KF   GD 
Sbjct: 1006 SATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDP 1065

Query: 989  ----LSCNCDSGVSY-------------------FVLDATSWLRHFAHVFKLATNNVLRF 1025
                +  N  +G SY                   F+ DATSWLRHFAH++K+ATN VL+F
Sbjct: 1066 RDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKF 1125

Query: 1026 GICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEF 1085
            G+CLTTFQELRFLRKSKDE+VVEAA RA+IT+RQLY + +LLPLRFTGNVA  +EEHLEF
Sbjct: 1126 GVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEF 1185

Query: 1086 EEQITWRSHVDEFVIEAVYKAQKKF----EAINAQAKEAGHDFIATTDEEPFHFVALVSD 1141
            EEQITWRSHVDEFVIEAV KAQ KF    E    + +  G   +    +  FH+V LV++
Sbjct: 1186 EEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKR-FHYVTLVTN 1244

Query: 1142 DTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            D NM+ KA  Q I+TFST F+F++C+++G++   CTN
Sbjct: 1245 DQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/980 (52%), Positives = 668/980 (68%), Gaps = 67/980 (6%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L++KLQ+IY+ IVKQE+ELQ+RC+QLTTSQTT+LKNLW IYK+N +LINNY+ FITTALL
Sbjct: 284  LIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALL 343

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQ  QD+ IG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFITHVFIS+S
Sbjct: 344  PSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 403

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            TML D+P K S PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLYYH
Sbjct: 404  TMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 463

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN-GGNHRNSLMVE 482
            MSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQR F +RN  GN RNS +++
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLID 523

Query: 483  YLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRH 542
            YLKHSEVMLL SFLE+ +LQ+VVL++F  +FGV  ++ + F  +DMF Q    ++++FRH
Sbjct: 524  YLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRH 583

Query: 543  APAFAESHILQTVGFGDPKNPXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXTSIETTSH 600
            APAFAESHILQ VGFG+PKNP                                SI+T   
Sbjct: 584  APAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMSIDTNDS 643

Query: 601  LSP--------------SEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQ 646
              P              +EY +N+DS R   + P ++ +W +SL H+N+TS +CS IV +
Sbjct: 644  RGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKCSVIVLR 702

Query: 647  KFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNML 706
            KFLRGPL++A+ H+LPW+YF+++  LK  S  +     FW  ++R+I PWN++  FLN+L
Sbjct: 703  KFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVL 762

Query: 707  MAFVLDNNWKTSPIDTLCEQLDSVDA-RSLVEHFSEHEDLPEIWRCWGALWFDVIADKSN 765
            +A++LDN ++T  I  LCE   + +    L+++F+ +E+LPEIW+CWG LWFDVI++K  
Sbjct: 763  LAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKR- 821

Query: 766  GEDGDVINS-GSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLT 824
              + D  N  G +DH F D P DGI FDE DE GE FW RA R++F+FKGIA+    GL 
Sbjct: 822  ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLR 881

Query: 825  LSAFAPQ--SRRPMTAGHPLQNFSFN---FEEIPAQSQIQSFVRNQIPLFEEIATGNLDP 879
            +S  AP    R  +   H L++FSF    F+E     Q  S +   +PLFE I   NLD 
Sbjct: 882  VSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDETNLDF 941

Query: 880  NIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNT 939
            + RP  S+++GE+IF++ GY++++ +   F+++G L+S S+YT+  ++          N 
Sbjct: 942  DARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVID----------ND 991

Query: 940  ERYGRSEDSNKPENAQITELERL----------ERDWLDN-----------CMNPEFIEQ 978
                 S+ +    N Q+T+ +R            R++  N            MNPE + +
Sbjct: 992  NSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNK 1051

Query: 979  AYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFL 1038
              +    +   +   +  ++YFV DATSWLRHFAH++KL+TNNVL F +CLTTFQELRFL
Sbjct: 1052 NMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFL 1111

Query: 1039 RKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEF 1098
            RKSKDE+VV AA RA+IT+RQLYS+ KLLPLRFTGNVAT +EEHLEFEEQITWRSHVDEF
Sbjct: 1112 RKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1171

Query: 1099 VIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFS 1158
            VIEAV KAQ KF + N           + T  + F+ V LV+DD NM+ KA  Q I+TF+
Sbjct: 1172 VIEAVVKAQNKFISANE----------SVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFT 1221

Query: 1159 TRFMFAVCNQIGLAHQACTN 1178
            T F+F+VC ++G+    CTN
Sbjct: 1222 THFIFSVCRKLGIQDNVCTN 1241

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/956 (52%), Positives = 670/956 (70%), Gaps = 56/956 (5%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+ I+KQEVELQERC+QLT SQTT++KNLW+IYK+N +LINNYV FITTAL 
Sbjct: 318  LVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTALF 377

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQ + DLLIG+EIV+IY+IERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFISIS
Sbjct: 378  PSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 437

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            +ML D+PQK++ PW ++LGDLSRMA+AL+PSGFIDWKLSAE WY  A+ + +G+GKLYYH
Sbjct: 438  SMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYYH 497

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGG-NHRN-SLMV 481
            MSTVQQNTLEAFVNLGKSVFC++TF+PS QY+QLVIDNIYQRAFA+RN   N RN  L+V
Sbjct: 498  MSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLLV 557

Query: 482  EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGV--STSNTDFFNPRDMFLQDGERVKYF 539
            +YLKHSEVMLL +F+ESP+LQ+VVL +F  KFG+  + +N   F PR MF+Q+ +++K++
Sbjct: 558  DYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKFY 617

Query: 540  FRHAPAFAESHILQTVGFGDPKNP-----------------XXXXXXXXXXXXXXXXXXX 582
            FRHA AFAE+ ILQ VG+G+PKNP                                    
Sbjct: 618  FRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGEDGSSTT 677

Query: 583  XXXXXXXXXXTSIETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSS 642
                       ++ET   L   ++  N+D        P  +++W +SL + N T+ +CS 
Sbjct: 678  FSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSM 737

Query: 643  IVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDF 702
            IV QKFL GPL+VA+ H+LPW YFL+S+AL+I+      +  FW   +++IFPWNS+V F
Sbjct: 738  IVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRF 797

Query: 703  LNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIAD 762
            LN+L+A+++DN W  SP++ LC+Q  S++   L+ +F+ +EDLPE+W+C G+LWFD+I +
Sbjct: 798  LNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDE 857

Query: 763  KSNGEDGD-VINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSL 821
            K N ++ D     G KD+ F D P DGI FDE+DE+G KFWKR+ R+IF+F+GI + F+ 
Sbjct: 858  KRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNG 917

Query: 822  --GLTLSAFAPQ-SRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLD 878
               L +S  AP  +RR +     L  +SF   ++ A+S    F    +  FEEI + N D
Sbjct: 918  FGNLAISYNAPVINRRGLGVNSHLVGYSF---KLMAKSDDIMFDDMLVSNFEEIDSNNSD 974

Query: 879  PNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFN 938
             N  P  SM+ GE+IF++ GY++++ADY  F+K+G LIS S Y +  + +     G   +
Sbjct: 975  FNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLS 1034

Query: 939  TERYGRSEDSNKPENAQITELERLERDWLDNCMNPEF--IEQAYEMKFPFGDLSCNCDSG 996
                  +  S+ P N         E++  + C +PE+  +++ +  +  + D+       
Sbjct: 1035 NNSSSSNAASSDPMN---------EKELFNKCFDPEYDSVDEFWNKEI-YDDIGRKFGME 1084

Query: 997  V---SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRA 1053
            +   +YF+LDATSWLRHFAHV+K+ATN++L+F ICLTTFQELRFLRKSKDE+VVEAATRA
Sbjct: 1085 LYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRA 1144

Query: 1054 VITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAI 1113
            +IT+RQL+S+ KLLPLRFTGNVATH+EEHLEFEEQITWRSHVDEFVIEAV KA+ K    
Sbjct: 1145 IITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK---- 1200

Query: 1114 NAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQI 1169
              + ++  H+       + F  V LV+DD+NM+ KA  +  +TFSTRF+FA+ N +
Sbjct: 1201 --RKEQEMHNM------KGFQIV-LVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/959 (53%), Positives = 655/959 (68%), Gaps = 57/959 (5%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+NIV+QEVELQE+CAQLT+SQTTDL ++W IY+IN+EL+ NYV FI+TALL
Sbjct: 370  LVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTALL 429

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
             SQ + DL+IGQEIV  YRI RRLWV+GTITFLDVLKNFS+FMDPEVC QFITHVFISIS
Sbjct: 430  SSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISIS 489

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            TML D+P K+S PW +RLGDLSRMAIALYPSGFIDWKLS+E+WY+QAL + +G+GKLYYH
Sbjct: 490  TMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLYYH 549

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MST+QQNTLEAFVNLGKSVFC+DTFIPSPQYMQLVIDNIYQRAF ER   N RNS ++EY
Sbjct: 550  MSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIEY 609

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSEVMLL +F+ +  LQKVV+++F+HKFG    + + F PRD+FLQ+ E +KYFFRHA
Sbjct: 610  LKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRHA 669

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTS--------- 594
            PAFAESHILQTVGFGD KNP                             TS         
Sbjct: 670  PAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMSLDN 729

Query: 595  IETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLV 654
            I T S +S  +Y  N++S ++ Y  P    IW +SLS++N+T+ +C  IV +KFL GP V
Sbjct: 730  ISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFV 789

Query: 655  VAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNN 714
            VA+ H++ W+YF++S+ LK ++L   E + FW + +R++ P NSIV FLN+L+A+ LDN+
Sbjct: 790  VALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNS 849

Query: 715  WKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINS 774
            + ++ I ++ E+LDS+D + L+  F+ +E+LPE+W+CWG LWFD I DKSN +       
Sbjct: 850  YYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYEKI 909

Query: 775  GSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQ--S 832
            G  DH F+D P DGI FD  DE GEKFWKRA R+IF+FK IA+ F +G+TLS  AP    
Sbjct: 910  GVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPVYCR 969

Query: 833  RRPMTAGHPLQNFSFNFEE-----IPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSM 887
            R  +   H L +FSF  E+        Q +I++ +   I + E     N+  +  P  S+
Sbjct: 970  RDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDATPPMSL 1029

Query: 888  LEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS--GKLERGPIQGGDDFNT---ERY 942
             E E+IF++ GY+++  +   F+K+G L S + YTS     E  P       N+      
Sbjct: 1030 QENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPENSVAGSSP 1089

Query: 943  GRSEDSNKPEN---AQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSY 999
            GRS  S   E    +  T  E      LD  +N E                       + 
Sbjct: 1090 GRSFQSQDVEENIFSVFTNEEENSTSLLDG-LNLE----------------------TTS 1126

Query: 1000 FVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQ 1059
            FVLDATSWLRH AH++KLA+N+ L F ICLTTFQELRFLRKSKDE+V+EAA RA+I +RQ
Sbjct: 1127 FVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQ 1186

Query: 1060 LYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKE 1119
            LYSD K++PLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIE++ KAQKKF         
Sbjct: 1187 LYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF--------- 1237

Query: 1120 AGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
                F+    +    F  LVSDD NM+ KAH + I+TF+TRF+FA+C+++G     CTN
Sbjct: 1238 -LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/964 (51%), Positives = 637/964 (66%), Gaps = 68/964 (7%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L+QKLQ++YR IVKQE+ELQERC+QLT SQTT+LK+LW IYKIN EL+NNYV FITTALL
Sbjct: 256  LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS+S
Sbjct: 316  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            TM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ + + HGKLYYH
Sbjct: 376  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN GN RNSL++EY
Sbjct: 436  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 495

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FN  DMF+Q+ +  KYFFRH 
Sbjct: 496  LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRHG 555

Query: 544  PAFAESHILQTVGFGDPKNP------------------XXXXXXXXXXXXXXXXXXXXXX 585
            P+FA+SHILQ VGFG+PKNP                                        
Sbjct: 556  PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSRN 615

Query: 586  XXXXXXXTSIETTSHLSPS---EYLENVDSPRYAYEFPEDLA--IWRESLSHINITSARC 640
                   T   TTS   P    E+  ++D+ R     P  L    W E+L  +N+TS +C
Sbjct: 616  GNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 674

Query: 641  SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIV 700
              IV +KFL GPL VA+ H+LPW YF++S+ LK + L     K FWI +++++FPW+++V
Sbjct: 675  GMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMV 734

Query: 701  DFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVI 760
             F+N+L+A++LDN    S I  LC +   ++   L+  F+E+EDLPEIW CWG LWFD I
Sbjct: 735  TFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFDAI 794

Query: 761  ADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817
              K   S   + +    G +D+   D P DGI FD+ DE GEKFWKRACR+IF+F+ +++
Sbjct: 795  CQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSR 854

Query: 818  EFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE---EIPAQSQIQSFVRNQIPLFEEIAT 874
             F LG+ +      +   + + + L++  +  E    I +   + S + +   + E  + 
Sbjct: 855  SFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDISEARSE 914

Query: 875  GNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGG 934
             N D +  P  S++ G++IF + GY+++  DYTCF+K+G  +S SLYTS           
Sbjct: 915  INTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW---------- 964

Query: 935  DDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCD 994
                   Y  + ++N   N      ER        CM     E AY             D
Sbjct: 965  -------YVPNCNNNLETNISYAN-ERENEALFLECMKSVHPEIAYP----------EID 1006

Query: 995  SGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAV 1054
               +YFV DATSWLRH A +FKLA N +LRF ICLTTFQELRFLRKSKDE+V+EAATR +
Sbjct: 1007 FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGI 1066

Query: 1055 ITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAIN 1114
            IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ+K E   
Sbjct: 1067 ITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE--- 1123

Query: 1115 AQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQ 1174
              AK+             F++V L+SDD  M+ KA  ++I+T STRF+F++C ++G    
Sbjct: 1124 -NAKQPN------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRH 1176

Query: 1175 ACTN 1178
             CT+
Sbjct: 1177 LCTD 1180

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/967 (51%), Positives = 640/967 (66%), Gaps = 79/967 (8%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IY+IN ELINNYV FITTALL
Sbjct: 269  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTALL 328

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQP  DLLIGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVF+S+S
Sbjct: 329  PSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 388

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            TM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ +I+ HGKLYYH
Sbjct: 389  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 448

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN GN RNSL++EY
Sbjct: 449  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 508

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSE MLL SFLESP+LQ VV+S+F  KFG+  +  + FNP DMF+Q+ +  KYFFRHA
Sbjct: 509  LKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 568

Query: 544  PAFAESHILQTVGFGDPKNP---------------------XXXXXXXXXXXXXXXXXXX 582
            P+FA+SHILQ VGFG+PKNP                                        
Sbjct: 569  PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRN 628

Query: 583  XXXXXXXXXXTSIETTSHLSPSEYLENVDSPRYAYEFPEDLA--IWRESLSHINITSARC 640
                      ++   + H   +E+  ++D+ R     P  L    W E+L  +N+TS +C
Sbjct: 629  DNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKC 687

Query: 641  SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIV 700
              IV +KFL GPL +A+ H+LPW YF+++  LK + L     K FW+ +V+++FPW++IV
Sbjct: 688  GMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIV 747

Query: 701  DFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVI 760
             F+N+L+A++LDN      I  LC +  +++   L+E F+E E+LPEIW CWG LWFD I
Sbjct: 748  TFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTI 807

Query: 761  ADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817
              K   S   D +    G KD+   D P DGI FD+ DE GEKFWKRACR+IF+F+ +++
Sbjct: 808  CQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSR 867

Query: 818  EFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE---EIPAQSQIQSFVRNQIPLFEEIAT 874
             F +G+ +S           +   L+N  +  E    I + + I + + N + + E  + 
Sbjct: 868  TFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDISEARSK 927

Query: 875  GNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGG 934
             N+D    P  S+  G++IF + GY+++  DYTCF+++G  +S SLYT   L  G     
Sbjct: 928  NNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYLPNG----- 982

Query: 935  DDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSC-NC 993
                         +N  E    +++E+ + D    CM P+                C   
Sbjct: 983  -------------NNISEALVNSDIEKGDEDLFLECMKPD----------------CPGI 1013

Query: 994  DSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRA 1053
            D   +YFV DATSWLRH A +FKLA N +L+F ICLTTFQELRFLRKSKDE+V+EAATR 
Sbjct: 1014 DFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1073

Query: 1054 VITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAI 1113
            +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ+K E  
Sbjct: 1074 IITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE-- 1131

Query: 1114 NAQAKEAGHDFIATTDEEPFH--FVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGL 1171
                  AG   +      P H  +V L+SDD  M+ KA  + I+T ST+F+F++C ++G 
Sbjct: 1132 -----NAGQPHVT-----PRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGE 1181

Query: 1172 AHQACTN 1178
                CT+
Sbjct: 1182 KRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/971 (51%), Positives = 638/971 (65%), Gaps = 86/971 (8%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IYKIN +L+NNYV FITTALL
Sbjct: 275  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL 334

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVF+S+S
Sbjct: 335  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 394

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            TM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ +I+ HGKLYYH
Sbjct: 395  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 454

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            MSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN GN RNSL++EY
Sbjct: 455  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 514

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FN  DMF+Q+ +  KYFFRH 
Sbjct: 515  LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHG 574

Query: 544  PAFAESHILQTVGFGDPKNP---------------------XXXXXXXXXXXXXXXXXXX 582
            P+FA+SHILQ VGFG+PKNP                                        
Sbjct: 575  PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRN 634

Query: 583  XXXXXXXXXXTSIETTSHLSPSEYLENVDSPRYAYEFPEDLA--IWRESLSHINITSARC 640
                      ++   + H   +E+  ++D+ R     P  L    W E+L  +N+TS +C
Sbjct: 635  DNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 693

Query: 641  SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIV 700
              IV +KFL GPL +A+ H+LPW YF++S+ LK   L     K FW+ +V++ FPW+++V
Sbjct: 694  GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV 753

Query: 701  DFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVI 760
             F+N+L+ ++LDN    S I  LC+  D +    L+E F+E E+LPEI  CWG LWFD I
Sbjct: 754  TFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTI 813

Query: 761  ADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817
             +K   S   + +    G KD+   D P DGI FDE DE GEKFWKRACR IF+F+ +++
Sbjct: 814  CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSR 873

Query: 818  EFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE-------EIPAQSQIQSFVRNQIPLFE 870
             F +G+ +       R      + L +  F  E        IP    ++S     I + E
Sbjct: 874  SFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESI----IDISE 929

Query: 871  EIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERG- 929
              +  N D +  P  S+ EG++IF + GY+++ ADYTCF+K+G  +S SLYT+  +    
Sbjct: 930  ARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYVPNSN 989

Query: 930  --PIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFG 987
               I+   ++N+E+          EN  +  LE ++ D+      PE             
Sbjct: 990  NTNIEDNINYNSEK----------ENEGLF-LECIKSDY------PEI------------ 1020

Query: 988  DLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVV 1047
                  D   +YFV DATSWLRH A +FKLA N +LRF ICLTTFQELRFLRKSKDE+V+
Sbjct: 1021 ------DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVM 1074

Query: 1048 EAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQ 1107
            EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE+V KAQ
Sbjct: 1075 EAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQ 1134

Query: 1108 KKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCN 1167
            +K E+    A E             F++V L+SDD  M+ KA  + I+T STRF+F++C 
Sbjct: 1135 EKLES----ASE------PRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCT 1184

Query: 1168 QIGLAHQACTN 1178
            ++G     CT+
Sbjct: 1185 KLGEQRHLCTD 1195

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/982 (49%), Positives = 646/982 (65%), Gaps = 73/982 (7%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            LVQKLQDIY+ IVKQE+ELQERC +LT SQTT+LKNLW IY++N EL++NY+ FITTA+ 
Sbjct: 384  LVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTAIH 443

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            P+QPE D  IG+EI+ IY+IERRLWV+GTITFLD+LKNFSNFMDPEVCCQFI HVFISIS
Sbjct: 444  PTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFISIS 503

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+PQK+   W+++LGDLSRMAIALYPS FIDWKLSAE WY  A+   +GHGKLYYH
Sbjct: 504  NMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLYYH 563

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNH-RNS-LMV 481
            MSTVQQNTLEAFVNLGKS+FC++TF+PS QY+QLVI NIYQRA+A+ N  N+ RN  L+V
Sbjct: 564  MSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQLLV 623

Query: 482  EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNT--DFFNPRDMFLQDGERVKYF 539
            +Y+KH EV LL +F ES ELQ+VVL +F  KFGV  +N+  + F  R MF+Q+ ++ K F
Sbjct: 624  DYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFKCF 683

Query: 540  FRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------- 592
            +R++ AFAES ILQ VG+G+ K+P                                    
Sbjct: 684  YRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQPRL 743

Query: 593  ------TSIETTSH----LSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSS 642
                  T++ T  +    L+  E+ EN+D+  Y    P  + IW  SL + N  S +CS 
Sbjct: 744  YHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSM 803

Query: 643  IVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDF 702
            IV++KFL  P ++A+ H LPW YF++S+ L++D   +V +  FW+  VR+IFPWNSIV F
Sbjct: 804  IVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKF 863

Query: 703  LNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIAD 762
            LN+L+A+++DN W+ S ++ LC   +S+    L+ +F+E+E+LPE+W+C G+LWFD I +
Sbjct: 864  LNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIME 923

Query: 763  KSN---GEDGDVIN-----------SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRL 808
            KSN    ++ +VIN           +G KD+ F+D P DG  FDE DE+GE+FWKRA R+
Sbjct: 924  KSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARV 983

Query: 809  IFIFKGIAQEFSL--GLTLSAFAPQSRRPM------TAGHPLQNFSFNFEEIPAQSQIQS 860
            IF+FK +A+ ++   GL LS  AP   R        T    L  FSF        S    
Sbjct: 984  IFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLN----ASSDGV 1039

Query: 861  FVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSL 920
             + + I  FE     N D +  P  SM++G+SIFD+ GY+++  ++  F+K+G  IS S 
Sbjct: 1040 MLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTSF 1099

Query: 921  YTS-------GKLERGPIQG-GDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMN 972
            + S        +L R       DD  +   G    +    N  + EL        + C +
Sbjct: 1100 FNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVF-----NECFD 1154

Query: 973  PEF--IEQAYEMKFPFGDLSCNCD-SGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICL 1029
            P++  +E+ +  +  + D   N    G +YF+LDATSWLRHFAH++K+AT+ +L+F ICL
Sbjct: 1155 PKYKTLEEFWSQEI-YPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAICL 1213

Query: 1030 TTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQI 1089
            TTFQELR+LRKSKD +VVEAATRA+IT+RQLY +  LLPLRFTGNVATH+EEHLEFEEQI
Sbjct: 1214 TTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQI 1273

Query: 1090 TWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHF--VALVSDDTNMRV 1147
            TWRSHVDEFVIEAV KA++K         +  +D    TDE+      + LV+DD  M+ 
Sbjct: 1274 TWRSHVDEFVIEAVLKAEEK-------RTDRLNDINMDTDEKEKSIFGIILVTDDITMKN 1326

Query: 1148 KAHTQRIQTFSTRFMFAVCNQI 1169
            KA  ++I+TFSTRF+F++ N I
Sbjct: 1327 KAMDRKIKTFSTRFIFSMANYI 1348

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1014 (45%), Positives = 646/1014 (63%), Gaps = 86/1014 (8%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
            L+ KLQDIY++I+ QEVELQ  C+ +T+SQTTDLK +W +YKIN+EL+NNYV FITTALL
Sbjct: 276  LISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALL 335

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            PSQ + DLLIGQEI+++Y+IERRLWV+GTITFLDVLK+FSNFMDPE+CCQFI HVFISI+
Sbjct: 336  PSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIA 395

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             M   +P+KFS PWF RLGDLSRMA ALYP G  DWKLSAE+WY +A+ + +G GKLYYH
Sbjct: 396  NMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYH 455

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
            M+TVQQN+L AF+NLGKSVFCRD F+P+ QY+QLVIDNIYQRA+  R   +  N  +++Y
Sbjct: 456  MATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDY 515

Query: 484  LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
            LKH+E+M+L +F+E+ ELQ++   +F  KFG      +FF+ R MF+Q+ E VK++FRH+
Sbjct: 516  LKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHS 575

Query: 544  PAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIETTS-HLS 602
            P FA++HILQ VG+G+  N                               SI+T S  +S
Sbjct: 576  PLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVS 635

Query: 603  PSEY---------LENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPL 653
             +E          LEN+D     +  P ++ IW +SL + N T   C  +V QKFL+GP 
Sbjct: 636  GNEIHDVGEYFNSLENIDK---EFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPF 692

Query: 654  VVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDN 713
            V A+ H+LPW YFL+S+A KI++L     + FW   +R+IFPWN+I++FLN+L+AF+ DN
Sbjct: 693  VTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDN 752

Query: 714  NWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVIN 773
            +   S ++ LCE    +    ++ +FSE+E+LPE+W CWG+LWFD I +KS      +  
Sbjct: 753  SDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKT 812

Query: 774  SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLS---AFAP 830
            +G KD  F D P DGI FDE+D+ G KFWKRACR++F+FKG A++F  GL L+   +   
Sbjct: 813  AGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNINSLNS 872

Query: 831  QSRRPMTAGHPLQNFSFNFEEIPAQS------------QIQSFVRNQIPLFEEIATGNLD 878
            +     T     +N  F F+  P               Q+ S    ++P FE I+  N+ 
Sbjct: 873  EEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNII 932

Query: 879  PNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS------------GKL 926
             +  P  S+++GESIFD+ GY+++   Y  ++K+G++   ++Y++             ++
Sbjct: 933  LDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRM 992

Query: 927  ERGP---IQGGDDFNT---------ERYGRSEDSNKPENAQITELER--LERDWLDNCMN 972
            E G    I G DD             +Y   ++S +  +  + E+ER   E +      N
Sbjct: 993  ENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSD-HLAEVEREGDETEDETEETN 1051

Query: 973  PEFIEQAY----EMKFPFGDLSCNCDSGV----SYFVLDATSWLRHFAHVFKLATNNVLR 1024
               +++ Y    ++   F  +  N +  V    +YF+ DAT+WLRHFAH++K+A + +L 
Sbjct: 1052 SRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLN 1111

Query: 1025 FGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLE 1084
            F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  KK++PLRF G +A+H+EEHLE
Sbjct: 1112 FVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLE 1171

Query: 1085 FEEQITWRSHVDEFVIEAVYKAQKK--------------FEAIN------AQAKEAGHDF 1124
            FEEQITWRSHV+EFVIEAV K+Q+               F+A N      A  K+ G+  
Sbjct: 1172 FEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSN 1231

Query: 1125 IATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
             +T  +       LV+DD NM  KA  + I+T STRF+F++C+Q+G+ +  CTN
Sbjct: 1232 ASTNSKV---LSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/961 (47%), Positives = 635/961 (66%), Gaps = 75/961 (7%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
             ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY+ FI TALL
Sbjct: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
             +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI + FIS+S
Sbjct: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I+G GKLYYH
Sbjct: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGN-------HR 476
            ++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R+ G+       HR
Sbjct: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAHR 446

Query: 477  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERV 536
            NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +DMF Q+ E +
Sbjct: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPESL 506

Query: 537  KYFFRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIE 596
            +Y+FRHAPAFAES +LQ +GFG+PKNP                              + E
Sbjct: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSE------ATE 560

Query: 597  TTSHLSP-------SEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVFQKF 648
            T+S+  P         Y +N+D+   ++ + P +L IW +SL+HIN+TS +CS  V  KF
Sbjct: 561  TSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKF 620

Query: 649  LRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMA 708
            L  PLVVA+ H L W +F++++  K++ + S ++ +FWI  +R+  PWNSIV   N+L+ 
Sbjct: 621  LHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVC 680

Query: 709  FVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGE 767
            ++LDN     P +    E+  S++   L+E+++E+E+LPEIW+CWG LWFD I      +
Sbjct: 681  YMLDN---LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI------K 731

Query: 768  DGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLGLTL 825
              DV+   G +DH F+D P DGI FDE DEVGEKFW R+ R + + KGIA++F  LGL +
Sbjct: 732  KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGLKV 791

Query: 826  SAFAPQ--SRRPMTAGHPLQNFSFNFEEIPAQSQIQSF----VRNQIPLFEEIATGNLDP 879
            S  A     R  +   + L+N +F  +     +   +     + + I + EEI   N+DP
Sbjct: 792  SFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEIEAVNMDP 851

Query: 880  NIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNT 939
               P  S++ GESIF++ GY ++  DY CF+K+G   S  +Y+           G+    
Sbjct: 852  QATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWS------NVGNGVTL 905

Query: 940  ERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSY 999
            +  G S       N  +      E+ + D       I  A +      D + NC     Y
Sbjct: 906  DVSGESIYDVANNNLSL----HWEKIFFDK------IAAASKG----SDENYNC---TLY 948

Query: 1000 FVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQ 1059
            FV+DATSWLRHFAH+FKLA NN L+F ICLTTFQELR+LR SKD++VVEAATR+VIT+RQ
Sbjct: 949  FVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQ 1008

Query: 1060 LYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEA--INAQA 1117
            LY +KK++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  ++F+A  +  + 
Sbjct: 1009 LYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN 1068

Query: 1118 KEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACT 1177
            K  G +           F  LV+DD NM  KA  + I+T +T+++F++ +++G+    CT
Sbjct: 1069 KNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCT 1117

Query: 1178 N 1178
            N
Sbjct: 1118 N 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/954 (47%), Positives = 631/954 (66%), Gaps = 61/954 (6%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
             ++KLQ+IYR IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY+ FI TALL
Sbjct: 207  FIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
             +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI + FIS+S
Sbjct: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            +ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I+G GKLYYH
Sbjct: 327  SMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER-------NGGNHR 476
            ++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R       N   HR
Sbjct: 387  IATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAHR 446

Query: 477  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERV 536
            NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +DMF Q+ E +
Sbjct: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPESL 506

Query: 537  KYFFRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIE 596
            +Y+FRHAPAFAES +LQ +GFG+PKNP                                +
Sbjct: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEVPQYRD 566

Query: 597  T-TSHLSPSEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLV 654
                 +S   Y +N+DS    + + P +L IW +SL+HIN+TS +CS  V  KFL  PLV
Sbjct: 567  PFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLV 626

Query: 655  VAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNN 714
            VA+ H L W +F++++  K++++ S  +  FWI  +R+  PWNS+V+  N+L+ ++LDN 
Sbjct: 627  VALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDN- 685

Query: 715  WKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVIN 773
                P ++   E+  S++   L+E+F+E+E+LPEIW+CWG+LWFD I      +  DV+ 
Sbjct: 686  --IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI------KKCDVME 737

Query: 774  -SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLGLTLSAFAPQ 831
              G +DH F+D P DGI FDE DE+GE+FW R+ R I I KG+A++F  LGL ++  AP 
Sbjct: 738  IPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPV 797

Query: 832  --SRRPMTAGHPLQNFSFNFEEIPAQSQIQSF----VRNQIPLFEEIATGNLDPNIRPGQ 885
               R  ++  + L+NF+F  +E        +     + + I + E+I   N D    P  
Sbjct: 798  FCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIERVNRDLRATPNL 857

Query: 886  SMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS-GKLERGPIQGGDDFNTERYGR 944
            S++ GE+IF++ GY ++  DY CF+K+G   S  +Y+    +  G +    D ++E    
Sbjct: 858  SVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL---DVSSESMYD 914

Query: 945  SEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDA 1004
            + ++N   + +    +R+     +                  GD + NC     YFV+DA
Sbjct: 915  AANNNLSPHWEKIFFDRITTAGHN------------------GDKNGNCS---VYFVIDA 953

Query: 1005 TSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDK 1064
            TSWLRHFAH+FKLA NN+L+F ICLTTFQELR+LR SKD++VVEAATR+VIT+RQLY +K
Sbjct: 954  TSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEK 1013

Query: 1065 KLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDF 1124
            K++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K  + F+             
Sbjct: 1014 KIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQT---------ERL 1064

Query: 1125 IATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            I     +   +  LV+DD NM  KA  + I+T +T+++F++ ++IG+    CTN
Sbjct: 1065 IDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/953 (46%), Positives = 626/953 (65%), Gaps = 59/953 (6%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
             ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IYK+N ELI NY+ FI TALL
Sbjct: 206  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALL 265

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
             +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLK+FSNFMDPEVCCQFIT+ FI IS
Sbjct: 266  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICIS 325

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I+G GKLYYH
Sbjct: 326  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 385

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGN-------HR 476
            ++T+QQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R+ GN       HR
Sbjct: 386  IATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAHR 445

Query: 477  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERV 536
            NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +DMF Q+ E +
Sbjct: 446  NSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPESL 505

Query: 537  KYFFRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIE 596
            +Y+FRHAPAFAES ILQ +GFG+PKNP                                +
Sbjct: 506  RYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAAEIPHYRD 565

Query: 597  TTSHLSPSE-YLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLV 654
                   SE Y +N+D+    + + P ++ IW +SL++IN+TS +CS  V  KFL  PL 
Sbjct: 566  PFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLA 625

Query: 655  VAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNN 714
            VA+ H L W +F++++  K++++ S ++ +FWI  +R+  PWNS+V F N+L+ ++LDN 
Sbjct: 626  VALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN- 684

Query: 715  WKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVIN 773
                P ++   E+  S++   L+E+F+E+E+LPE+W+CWG+LWFD +      +  DV+ 
Sbjct: 685  --LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV------KKCDVME 736

Query: 774  -SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLGLTLSAFAPQ 831
              G +DH F+D P DGI FD+ DE+GEKFW R+ R I   KGIA++F  LGL ++  A  
Sbjct: 737  IPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASV 796

Query: 832  --SRRPMTAGHPLQNFSFNF----EEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQ 885
               R  ++  + L+N +F      E+    +     + + I + E I T N+D    P  
Sbjct: 797  FCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKL 856

Query: 886  SMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRS 945
            S++ GESIF++ GY ++  DY CF+K+G   S  +YT                       
Sbjct: 857  SVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW--------------------- 895

Query: 946  EDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDAT 1005
              SN      +        D   N ++  + +  ++  F  G  + +  S   YFV+DAT
Sbjct: 896  --SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDAT 953

Query: 1006 SWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKK 1065
            SWLRHFAH+FKLA NN+L+F ICLTTFQELR+LR SKD++VVEAATR+VIT+RQLY +KK
Sbjct: 954  SWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKK 1013

Query: 1066 LLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFI 1125
            ++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  + F+      K  G    
Sbjct: 1014 IIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRS-- 1071

Query: 1126 ATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
                     F  LV+DD NM  KA  + I+T +T+++F++ +++G+    CTN
Sbjct: 1072 -------KEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/961 (47%), Positives = 629/961 (65%), Gaps = 75/961 (7%)

Query: 244  LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
             ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY+ FI TALL
Sbjct: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 304  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
             +QP  DL++GQEI++IY +E+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI + FIS+S
Sbjct: 267  TTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 364  TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
             ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I+G GKLYYH
Sbjct: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 424  MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER-------NGGNHR 476
            ++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R       N   H+
Sbjct: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAHK 446

Query: 477  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERV 536
            NS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   +  D F+ +DMF Q+ E +
Sbjct: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPESL 506

Query: 537  KYFFRHAPAFAESHILQTVGFGDPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSIE 596
            +Y+FRHAPAFAES +LQ +GFG+PKNP                             ++ E
Sbjct: 507  RYYFRHAPAFAESQLLQLIGFGNPKNP------FALLFQLPKYLKLKKDKREKKRSSATE 560

Query: 597  TTSHL-------SPSEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVFQKF 648
            T  +        SP  Y +N+D+    + + P +L IW ESL+HIN+TS +CS  V  KF
Sbjct: 561  TPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKF 620

Query: 649  LRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMA 708
            L  P V+A+ H L W YFL+++  +++++ S ++ +FWI  +R+  PWNS+V   N+L+ 
Sbjct: 621  LHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVC 680

Query: 709  FVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGE 767
            ++LDN     P +    E   S +   L+EHF+E+E+LPEIW+CWG+LWFD I      +
Sbjct: 681  YMLDN---LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI------K 731

Query: 768  DGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLGLTL 825
              DV+   G +DH F+D P DGI FDE DE+GE+FW R+ R I + KGIA++F  LGL +
Sbjct: 732  KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKV 791

Query: 826  SAFAPQ--SRRPMTAGHPLQNFSFNF----EEIPAQSQIQSFVRNQIPLFEEIATGNLDP 879
            +  AP    R  +   + L+ F+F      E     +     +   I + E+I   NLD 
Sbjct: 792  NFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINEKIDNVNLDL 851

Query: 880  NIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS-GKLERG-PIQGGDDF 937
               P  S++ GESIF++ GY ++  DY CF+K+G   S  +Y+    +  G PI    D 
Sbjct: 852  RATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI----DV 907

Query: 938  NTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGV 997
            + E      D++   + +    +R+   +  NC                 D + NC    
Sbjct: 908  SNEPIYDVTDNDLSLHWEKIFFDRIAAAY-KNC-----------------DENDNC---T 946

Query: 998  SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITV 1057
             YFV+DATSWLRHFAH+FKLA N++L F ICLTTFQELR+LR SKD++VVEAATR+VIT+
Sbjct: 947  IYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITI 1006

Query: 1058 RQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQA 1117
            RQLY ++K++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  + F+      
Sbjct: 1007 RQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQT----- 1061

Query: 1118 KEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACT 1177
                   IA    +   F  LV+DD NM  KA  + I+T +T+++F++ +++G+    CT
Sbjct: 1062 ----ERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCT 1117

Query: 1178 N 1178
            N
Sbjct: 1118 N 1118

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187
           aa] {ON} YKR096W (REAL)
          Length = 1187

 Score =  546 bits (1407), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 246/320 (76%), Positives = 286/320 (89%)

Query: 244 LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
           L+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IY+IN EL+NNYV FITTALL
Sbjct: 268 LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327

Query: 304 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
           PSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVF+S+S
Sbjct: 328 PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387

Query: 364 TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
           TM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ +++ HGKLYYH
Sbjct: 388 TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447

Query: 424 MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
           MSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN GN RNSL++EY
Sbjct: 448 MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 507

Query: 484 LKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHA 543
           LKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FNP DMF+Q+ +  KYFFRHA
Sbjct: 508 LKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 567

Query: 544 PAFAESHILQTVGFGDPKNP 563
           P+FA+SHILQ VGFG+PKNP
Sbjct: 568 PSFAQSHILQIVGFGEPKNP 587

 Score =  465 bits (1196), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 245/563 (43%), Positives = 343/563 (60%), Gaps = 57/563 (10%)

Query: 626  WRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSF 685
            W ESL  +N+TS +C  IV +KFL GPL +A+ H LPW YF++S+ LK   L     K F
Sbjct: 672  WLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEF 731

Query: 686  WITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDL 745
            WI +V++IFPW+++V F+N+L+A VLDN   +  I +LC++   ++   L++ F E E+L
Sbjct: 732  WIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEEL 791

Query: 746  PEIWRCWGALWFDVIADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFW 802
            PEIW CWG LWFD I  K   S   D D    G KD+   D P DGI FD +DE GEKFW
Sbjct: 792  PEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFW 851

Query: 803  KRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE-------EIPAQ 855
            KRACR IF+F+ +++ F +G+ ++  +  +R  + + + L N S+  E        IP  
Sbjct: 852  KRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTL 911

Query: 856  SQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSL 915
            + ++      I +FE  +  N+D +  P  S+++G SIF++ GY+++  +YTCF+K+G  
Sbjct: 912  NTLEGI----IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEF 967

Query: 916  ISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEF 975
            +S SLYTS  +  G                  SN PE    +  E+        C+  + 
Sbjct: 968  LSASLYTSWYVPNG------------------SNNPETNINSNCEKENEGQFLECLKSDD 1009

Query: 976  IEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQEL 1035
             E                D   +YFV DATSWLRH A +FKLA N +L+F ICLTTFQEL
Sbjct: 1010 RE---------------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQEL 1054

Query: 1036 RFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHV 1095
            RFLRKSKDE+V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HV
Sbjct: 1055 RFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHV 1114

Query: 1096 DEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQ 1155
            DEFVIE++ KAQ+K E  N     +            F++V L+SDD  M+ KA  ++I+
Sbjct: 1115 DEFVIESIMKAQEKLENANQLPVSSCR----------FNYVILISDDDTMKKKAEEKKIK 1164

Query: 1156 TFSTRFMFAVCNQIGLAHQACTN 1178
            T STRF+F++C ++G     CT+
Sbjct: 1165 TLSTRFVFSLCTKLGEQRHLCTD 1187

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score =  512 bits (1318), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 256/339 (75%), Positives = 287/339 (84%), Gaps = 19/339 (5%)

Query: 244 LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
           LV+KLQDIY+ IVKQE+ELQERC+QLTTSQTTDLKNLW IYK+NI+LINNYV FITTALL
Sbjct: 300 LVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALL 359

Query: 304 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
            SQ +QDL IG+EI+ IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS+S
Sbjct: 360 SSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 419

Query: 364 TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
           TML D+P K+S PW +RLGDLSRMAIALYPSGFIDWKLSAE WY +A+   + HGKLYYH
Sbjct: 420 TMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYH 479

Query: 424 MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
           MSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN+RN  ++EY
Sbjct: 480 MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIEY 539

Query: 484 LKHSEVMLLSSFLESPELQKVVLSFFQHKFGV------STSNT-------------DFFN 524
           LKHSEVMLL +FLE+ ELQ+VVL +FQ KFG+      STS T             D F 
Sbjct: 540 LKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMFR 599

Query: 525 PRDMFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNP 563
            RDMF+Q+ E++KYFFRHAPAFAESHILQ VGFGDPKNP
Sbjct: 600 SRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNP 638

 Score =  483 bits (1243), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 277/638 (43%), Positives = 384/638 (60%), Gaps = 80/638 (12%)

Query: 599  SHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVT 658
            + ++  E+ +N++  R+ Y  P  L IW  SL+HIN+ S +CS IV +KFL GPL++A+ 
Sbjct: 704  NQVTSEEFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALP 763

Query: 659  HMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTS 718
            H+LPW YF++S+ LK + L   + K FWI +++ IFPWN I++FLN+L+ + LDN    +
Sbjct: 764  HLLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPT 823

Query: 719  P--------------IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKS 764
            P              I  LC +  ++    L++HF+E+EDLPE+W+CWG LWFD I++K 
Sbjct: 824  PSAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNK- 882

Query: 765  NGEDGDVI-NSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLG 822
            NG D D   N G KDH F D P DGI +  +DE GE FWKR  R+IF+FKGIA+ F SLG
Sbjct: 883  NGMDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLG 942

Query: 823  LTLSAFAPQSRR----PMTAGHPLQNFSF-----NFEEIPAQ-------------SQIQS 860
            L +S  A    R    PM   + L+ FSF     N + + A              ++I  
Sbjct: 943  LKVSYNAGTEYRNNNVPM--DNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITE 1000

Query: 861  FVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSL 920
            FV  + P+ E     NL+  I P +SM+  E IFD+ GY+++  +   F+K+G   S S+
Sbjct: 1001 FVDIKEPIHE----TNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSI 1056

Query: 921  YTSGKLERGPIQGGDDFNTERYGRSEDSNK-PENAQITEL--ERLERDWLDNCMNPEFIE 977
            YT+  ++   +    + N       E ++       I EL   +L+R        PEF +
Sbjct: 1057 YTAWPMDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKR--------PEFRD 1108

Query: 978  QAYEMKF----PFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQ 1033
            ++  +      PF           +YFV DATSWLRHFAH++KLA+N+VL+F +CLTTFQ
Sbjct: 1109 KSTLLSSTSTEPFNRYK-------TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQ 1161

Query: 1034 ELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRS 1093
            ELRFLRKSKD +VVEA+TRA+IT+RQLYSD  LLPLRFTGNVAT +EEHLEFEEQITWRS
Sbjct: 1162 ELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRS 1221

Query: 1094 HVDEFVIEAVYKAQKKF------EAINAQAKEAGHDFIATT----DEEP---FHFVALVS 1140
            HVDEFVIEAV KAQ+KF      E +   +     D   TT    +EE    F +V L++
Sbjct: 1222 HVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLIT 1281

Query: 1141 DDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178
            DD +MR+KA  + I TF T+ +F+VC+ +G+    CTN
Sbjct: 1282 DDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  476 bits (1224), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/363 (65%), Positives = 280/363 (77%), Gaps = 43/363 (11%)

Query: 244 LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
           L+QKLQDIY+ IVKQE++LQ+RC+QLTTSQTTDLKNLW IYKIN++LINNY+ FIT ALL
Sbjct: 398 LIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALL 457

Query: 304 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
           P+Q + DL IG+EI+ IYRIERRLWV+GTITFLDVLK+FSNFMDPEVCCQFI+HVFI+IS
Sbjct: 458 PTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAIS 517

Query: 364 TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            +L D+P K+S  W +RLGDLSRMAIALYPSGFIDWKLSAEHWY++A+   + HGKLYYH
Sbjct: 518 LILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYH 577

Query: 424 MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEY 483
           MSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GNHRN  ++EY
Sbjct: 578 MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEY 637

Query: 484 LKHSEVMLLSSFLESPELQKVVLSFFQHKFGV---------------------------- 515
           LKH+EVMLL +FLES +LQ VVL +FQ KFG+                            
Sbjct: 638 LKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSS 697

Query: 516 ---------------STSNTDFFNPRDMFLQDGERVKYFFRHAPAFAESHILQTVGFGDP 560
                          S +  D F  +DMF+Q+ + +KYFFRH+  FA+SHILQ VGFGDP
Sbjct: 698 STTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDP 757

Query: 561 KNP 563
           KNP
Sbjct: 758 KNP 760

 Score =  389 bits (999), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/599 (38%), Positives = 349/599 (58%), Gaps = 91/599 (15%)

Query: 599  SHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVT 658
            S++   E+ EN+D  ++ Y+ P+ + IW ESL +IN+ S +CS IV +KFL GP+++A+ 
Sbjct: 861  SNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALP 920

Query: 659  HMLPWSYFLLSLALKI-DSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDN---- 713
            H+L W +F++S+ LKI +S+   + K FW + ++ I PWNSIV+FLN+LM ++LDN    
Sbjct: 921  HLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDE 980

Query: 714  NWKTSPIDTLCEQLDSVDARSL---VEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDG- 769
            N+K   I +L  + +S+ + SL   ++ F+++E+LPEIW+CWG LWFDVI +K+   D  
Sbjct: 981  NFKL--IISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTT 1038

Query: 770  ------------------DVINS-----------GSKDHPFWDLPGDGICFDEDDEVGEK 800
                              D++N            G +DH   D P DGI F  +DE G  
Sbjct: 1039 FLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGIN 1098

Query: 801  FWKRACRLIFIFKGIAQEF-SLGLTLS----AFAPQSRRPMTAGHPLQNFSFNFEEIPAQ 855
            F+KR+ RLIF+ K + + F +LGL +S     +   ++ P      L NF+F    +   
Sbjct: 1099 FYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIP--QNFILNNFAFKLTNLYDP 1156

Query: 856  SQI-----------------------QSFVRNQIPLF---EEIATGNLDPNIRPGQSMLE 889
            S I                       +S + N +  F   E I   NL+  ++P  S+L 
Sbjct: 1157 SLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILG 1216

Query: 890  G-ESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDS 948
            G E+IF++ GY+++  +   F+++G +IS S+Y+S  ++    +       ++     DS
Sbjct: 1217 GNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDS 1276

Query: 949  N-KPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGD----------LSCNCDSGV 997
              K EN  + ++   +  +       EF++ ++ +K               +  + +   
Sbjct: 1277 TMKNENVTVGDITPEDASF------KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHR 1330

Query: 998  SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITV 1057
            ++FV DATSWLRHFAH++KL+ N  L+F +CLTTFQELRFLRKSKD +VVEA+TRA+IT+
Sbjct: 1331 TFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITM 1390

Query: 1058 RQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQ 1116
            RQLY + KLLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q++F+  + Q
Sbjct: 1391 RQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  419 bits (1076), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/396 (53%), Positives = 264/396 (66%), Gaps = 76/396 (19%)

Query: 244 LVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALL 303
           L+QKLQ+IY+ IV QE+ELQ++C +L+TSQ+T LK LW IYK+N +LINNY+ FI T+L 
Sbjct: 269 LIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTSLS 328

Query: 304 PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 363
           PSQ   D LIG+EI+ IY+IERRLW++GTITFLD+LKNF+NFMDPE+  QFITHVF SIS
Sbjct: 329 PSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFESIS 388

Query: 364 TMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYH 423
            M+ D+P  F  PW++RLGDLSRMAIALYPS FIDWKLS+E+WY +++   F HGKLYYH
Sbjct: 389 NMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLYYH 448

Query: 424 MSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN------------ 471
           +STVQQN LEAFVNLGKSVFC DTFIPS +YMQLVIDNIYQRAF ERN            
Sbjct: 449 ISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAGSS 508

Query: 472 -----------GGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGV----- 515
                        N +   ++EYLKHSEVMLL +FLE+  L+ VVL++F + FG      
Sbjct: 509 SNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAIQS 568

Query: 516 -------------STSNT----------------------------------DFFNPRDM 528
                        S SNT                                  + FN R++
Sbjct: 569 NLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFRNI 628

Query: 529 FLQ-DGERVKYFFRHAPAFAESHILQTVGFGDPKNP 563
           F Q + + +KYFF+++  FAESHILQ +GFGDPKNP
Sbjct: 629 FKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNP 664

 Score =  268 bits (686), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 208/338 (61%), Gaps = 38/338 (11%)

Query: 866  IPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGK 925
            IP FE+ +  N D N  PG S++E ES+F++ GY++   D++ F+K+G LIS SLYTS  
Sbjct: 1148 IP-FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTI 1206

Query: 926  LE--RGPIQGGDDFNTERYGR----------------SEDSNKPENAQITELERLERDWL 967
            ++   G     +  NT                      E SN   N    EL  +E++  
Sbjct: 1207 IDTINGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIF 1266

Query: 968  DNCMNPEF--IEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRF 1025
            +  ++P++  I++ +  +  F D S       +YFVLDATSWLRHFAHV+KLATN +L+F
Sbjct: 1267 NKILDPDYKNIDEIWRGEM-FHDTSIQFSD--TYFVLDATSWLRHFAHVYKLATNGILKF 1323

Query: 1026 GICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEF 1085
             ICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLYS+K+LLPLRFTGN+ATH+EEHLEF
Sbjct: 1324 AICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEF 1383

Query: 1086 EEQITWRSHVDEFVIEAVYKAQ-KKFEAINAQAKEAGHDFIATTDEEPFH---------F 1135
            EEQITWRSHVDEFVIEA+ +AQ K+ +  N +                 +          
Sbjct: 1384 EEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMI 1443

Query: 1136 VALVSDDTNMRVKAHTQR----IQTFSTRFMFAVCNQI 1169
              LV+DD +M  K   ++    I TFST+F+F++CN +
Sbjct: 1444 FVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  229 bits (583), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 167/258 (64%), Gaps = 6/258 (2%)

Query: 596  ETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVV 655
            E   +LSP ++  N++S + ++  P  L IW ESL +INI S  CS IV +KFL GPL V
Sbjct: 781  EMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFV 840

Query: 656  AVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNW 715
            ++ HMLPWSYF++SLAL+I+SL ++E + FW+  +R+IFPWNSIV +LN++++ +LDN +
Sbjct: 841  SLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCY 900

Query: 716  KTSPIDTLCEQLDSVDARSLVEHFSEHE-DLPEIWRCWGALWFDVIADKSNGEDGDVI-N 773
            + S I  L     + +   L+  F+E+E +LPE+W+C+G+LWFDVIA+       D   N
Sbjct: 901  ENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKN 960

Query: 774  SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFS--LGLTLSAFAPQ 831
               KD    + P DG+ FDE +E G  FWKR+CRLIF+FK +   F+   GLT+S+    
Sbjct: 961  ISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSV 1020

Query: 832  --SRRPMTAGHPLQNFSF 847
              +R  +   H L+ F+F
Sbjct: 1021 YCNRSDIPNNHILRTFAF 1038

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 95/197 (48%), Gaps = 1/197 (0%)

Query: 623 LAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVEL 682
           L+ W+  +  ++ T    + ++F+KFL   + ++   +LPW  F +S+A ++ ++    +
Sbjct: 478 LSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHV 537

Query: 683 KSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEH 742
              W  L++ + PW+ IV +LN  +  V  ++  +  +  L + + S     L+ +    
Sbjct: 538 LLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYE 597

Query: 743 EDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFW 802
            +  EI  C G +WFD +A K   +     N        ++   D + +D+DD+V  K W
Sbjct: 598 SNFQEISMCEGFIWFDSLASKI-KQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMW 656

Query: 803 KRACRLIFIFKGIAQEF 819
            RA  +I + K +  ++
Sbjct: 657 TRALLIILLIKNVINDY 673

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 143/316 (45%), Gaps = 37/316 (11%)

Query: 283 IYKINIELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNF 342
           ++K++ ++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  H     L++++N+
Sbjct: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206

Query: 343 SNFM----------DPEVCCQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALY 392
            N M          + +   +FI    I I+ ML ++P KF   W   +GDL+R+ + L 
Sbjct: 207 KNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266

Query: 393 PSGFIDWKLSAEHWYS-----QALSHIFGHGK----------LYYHMSTVQQNTLEAFVN 437
                 ++L++ H Y+      A+++   +GK           Y+++S VQ ++L   V 
Sbjct: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326

Query: 438 LGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEYLKHSEVMLLSSFLE 497
           L K +   +T +      QL ID I  +   ++   N + S+    +      LLS F  
Sbjct: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSLFFG 384

Query: 498 SPE------LQKVVLSFFQHKFG--VSTSNTDFFNPRDMFLQDGE--RVKYFFRHAPAFA 547
           S        +++  L +F ++F      + +    P +   +  E     ++F +AP F+
Sbjct: 385 STSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLFS 444

Query: 548 ESHILQTVGFGDPKNP 563
              I++T+      NP
Sbjct: 445 LISIVETIIMNKKLNP 460

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 998  SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRK-SKDESVVEAATRAVIT 1056
            +YF++D  +WL+H   + +      ++  + ++   +L  L+  S+ ESV  +A+R +I 
Sbjct: 802  NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIV 861

Query: 1057 VRQLYS 1062
            +  LY+
Sbjct: 862  INYLYA 867

>CAGL0H03487g Chr8 (324020..325627) [1608 bp, 535 aa] {ON} similar
           to uniprot|P22149 Saccharomyces cerevisiae YGL071w RCS1
           iron-regulated transcriptional repressor
          Length = 535

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 21/124 (16%)

Query: 853 PAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIF-----DFPGYRQMYADYT 907
           PA S++     N++P   E  + +L PN+R   + L+ ES+F     +    R    D  
Sbjct: 412 PASSKLH----NKMPRIPEQRSDSLQPNVRFNDTALKHESLFTDDLINKSSPRHDVGDEF 467

Query: 908 CFNK--SGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSN---------KPENAQI 956
            F+K  +  L S + +T  K    P+  G  FN + +G S D+N         KP N   
Sbjct: 468 LFDKMLNKELTSLNEFTENKHSDYPVNAG-SFNLDVFGPSVDNNDSLSTLDFTKPMNDNF 526

Query: 957 TELE 960
            +LE
Sbjct: 527 VKLE 530

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 486 HSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHAP 544
           HS   L+ + + SPE   + L   + K G    N D ++PRDM+L  G +  Y F   P
Sbjct: 74  HSNATLIENSISSPEALTLTLDTSRIK-GKQADNLDLWDPRDMYLSHGYQTYYDFPFGP 131

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
           YNL271C (REAL)
          Length = 1952

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 658 THMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPW-NSIVDFL-NMLMAFVLDNN- 714
           T+  P  Y    LA   D L + E+K  W+TL  +   W ++ +D   ++ MA VL N+ 
Sbjct: 335 TNRPPIHYVQRILA---DKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSI 391

Query: 715 WKTSPIDTLCEQL 727
           +KT+P D+L ++L
Sbjct: 392 YKTAPRDSLTKEL 404

>NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425
          Length = 606

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 33/82 (40%), Gaps = 4/82 (4%)

Query: 132 DPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSI----QGGSSSAGLPTGDQDFREGST 187
           D ++ RY R     V P+      + Q H+ PN I    +G      LP   Q     S 
Sbjct: 98  DDNNNRYKRFPNKRVHPEDERETGHQQQHSNPNFIRNLPRGPKRRQPLPVSKQQQLPHSL 157

Query: 188 PENSSRSSRHGPHDNQESKGYA 209
           P   + SSR+ P+   +  G A
Sbjct: 158 PSGPAASSRYDPNSKPKQMGTA 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,934,463
Number of extensions: 5037788
Number of successful extensions: 13282
Number of sequences better than 10.0: 34
Number of HSP's gapped: 13479
Number of HSP's successfully gapped: 66
Length of query: 1178
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1057
Effective length of database: 39,606,813
Effective search space: 41864401341
Effective search space used: 41864401341
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)