Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196755.707ON23223211371e-159
KLTH0E00946g5.707ON2152164935e-62
SAKL0E15026g5.707ON290107750.32
TBLA0D054301.276ON80744701.7
ZYRO0B16434g5.707ON23734639.7
NOTE: 14 genes in the same pillar as Kwal_55.19675 were not hit in these BLAST results
LIST: Kpol_1043.74 Skud_9.16 Smik_9.17 YIL152W NCAS0G00210 TBLA0I01690 KAFR0D02200 Suva_9.36 TDEL0B02130 KLLA0A00506g KNAG0L02160 TPHA0E00180 NDAI0F00270 Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19675
         (232 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 1...   442   e-159
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...   194   5e-62
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    33   0.32 
TBLA0D05430 Chr4 (1337845..1340268) [2424 bp, 807 aa] {ON} Anc_1...    32   1.7  
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    29   9.7  

>Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 159]
           FULL
          Length = 232

 Score =  442 bits (1137), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 219/232 (94%), Positives = 219/232 (94%)

Query: 1   MNSDTQSRDHASNLFKNITALSSRERKPLQPKSVNISQLVASQKQDNAHKTVSVRAATPT 60
           MNSDTQSRDHASNLFKNITALSSRERKPLQPKSVNISQLVASQKQDNAHKTVSVRAATPT
Sbjct: 1   MNSDTQSRDHASNLFKNITALSSRERKPLQPKSVNISQLVASQKQDNAHKTVSVRAATPT 60

Query: 61  SLSTLISKSRPKSGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQEASGALIRHLF 120
           SLSTLISKSRPKSGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQEASGALIRHLF
Sbjct: 61  SLSTLISKSRPKSGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQEASGALIRHLF 120

Query: 121 KCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILILHRTSLR 180
           KCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILILHRTSLR
Sbjct: 121 KCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILILHRTSLR 180

Query: 181 DSISLRAGXXXXXXXXXXXXXYPGLRWYFQWQAVNALDSHLQSELQVSQLPK 232
           DSISLRAG             YPGLRWYFQWQAVNALDSHLQSELQVSQLPK
Sbjct: 181 DSISLRAGSELMLDSSSSLLLYPGLRWYFQWQAVNALDSHLQSELQVSQLPK 232

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score =  194 bits (493), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 140/216 (64%), Gaps = 3/216 (1%)

Query: 1   MNSDTQSRDHASNLFKNITALSSRERKPLQPKSVNISQLVASQKQDNAHKTVSVRAATPT 60
           M  +T+++D ASN+F+N++ L+S+ERKPLQP+ VNISQLVASQK  +   T +   +  +
Sbjct: 1   MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKLRSPPNTPASAKSPAS 60

Query: 61  SLSTLISKSRPKSGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQ--EASGALIRH 118
            LS  IS+SRPKS    +R SVA+VIGS +HL      Y  R KKRY+    A  AL+  
Sbjct: 61  LLSNAISRSRPKSHDGSLR-SVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNR 119

Query: 119 LFKCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILILHRTS 178
           L KCV++ ET+ RLQRHG++TH+YDR+L VQY K LSPTE LAVA+   G+E+LILH   
Sbjct: 120 LLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLP 179

Query: 179 LRDSISLRAGXXXXXXXXXXXXXYPGLRWYFQWQAV 214
                  ++G             YPGLRWYF+W+ +
Sbjct: 180 STKDAEPKSGSQLLLSSNASALLYPGLRWYFEWRVI 215

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 9/107 (8%)

Query: 114 ALIRHLFKCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILI 173
           +++  L K +    T ++L  H V+   YD  L V   + LSP E L +  SS     ++
Sbjct: 187 SMLFRLQKSLCDFNTVYKLSSH-VSKPNYDIVLTVDCTQQLSPDELLVI--SSECAHAIV 243

Query: 174 LHRTSLRDSISLRAGXXXXXX----XXXXXXXYPGLRWYFQWQAVNA 216
           LHR   ++    R                   YPGL WY  W   +A
Sbjct: 244 LHR--FKNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFADA 288

>TBLA0D05430 Chr4 (1337845..1340268) [2424 bp, 807 aa] {ON}
           Anc_1.276 YJL090C
          Length = 807

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%)

Query: 80  FSVARVIGSRHHLAHAPAQYGIRPKKRYEQEASGA--LIRHLFK 121
           F ++  + +  HL H    YGI P KR   E S    L RH  K
Sbjct: 756 FKISNNLNNDDHLPHTQITYGISPTKRVNDETSKLKRLTRHQIK 799

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
          {ON} weakly similar to uniprot|P40455 Saccharomyces
          cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 25/34 (73%)

Query: 15 FKNITALSSRERKPLQPKSVNISQLVASQKQDNA 48
          +K+ + LS+R+  PL+ K+VN++ L  S+K ++A
Sbjct: 27 YKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHA 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.126    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,423,071
Number of extensions: 688053
Number of successful extensions: 2383
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2454
Number of HSP's successfully gapped: 17
Length of query: 232
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 126
Effective length of database: 41,326,803
Effective search space: 5207177178
Effective search space used: 5207177178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)