Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196635.708ON54454429480.0
KLTH0E00902g5.708ON54454426460.0
SAKL0E15048g5.708ON54254424830.0
KLLA0A00484g5.708ON54354524290.0
TDEL0B021205.708ON54854624090.0
AFR292W5.708ON54154423650.0
YKR097W (PCK1)5.708ON54954623600.0
NCAS0A031605.708ON55254223570.0
ZYRO0B16456g5.708ON54854623480.0
Ecym_40135.708ON54254423430.0
Suva_11.3345.708ON54854623410.0
KNAG0C066405.708ON54754323400.0
Smik_11.3615.708ON54954623400.0
Skud_11.3375.708ON54954623390.0
CAGL0H06633g5.708ON54453423110.0
NDAI0E050805.708ON55155123070.0
KAFR0H001605.708ON54954922830.0
TPHA0E001705.708ON57852022010.0
TBLA0E017005.708ON57654921830.0
Kpol_1043.755.708ON55855821770.0
Suva_7.275singletonON961101572e-12
Kpol_1049.19na 1ON943192770.86
NDAI0A005601.67ON71469770.87
ZYRO0F18722gsingletonON69996751.4
NCAS0H031902.629ON73154732.8
NCAS0A090601.346ON28256704.8
ZYRO0A11814g5.683ON108527715.1
TPHA0A052705.75ON152630715.8
KAFR0G006901.216ON410378707.5
KAFR0C052205.500ON149939698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19663
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...  1140   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...  1023   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   961   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   940   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   932   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   915   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   913   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   912   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   909   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   907   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   906   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   905   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   905   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   905   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   894   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   893   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   884   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   852   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   845   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   843   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    65   2e-12
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    34   0.86 
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    34   0.87 
ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some...    33   1.4  
NCAS0H03190 Chr8 (613975..616170) [2196 bp, 731 aa] {ON} Anc_2.629     33   2.8  
NCAS0A09060 Chr1 (1793006..1793854) [849 bp, 282 aa] {ON} Anc_1....    32   4.8  
ZYRO0A11814g Chr1 (950029..953286) [3258 bp, 1085 aa] {ON} simil...    32   5.1  
TPHA0A05270 Chr1 complement(1185683..1190263) [4581 bp, 1526 aa]...    32   5.8  
KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1...    32   7.5  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    31   8.5  

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/544 (100%), Positives = 544/544 (100%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540
           TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA
Sbjct: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540

Query: 541 GPLL 544
           GPLL
Sbjct: 541 GPLL 544

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/544 (88%), Positives = 512/544 (94%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSP+K RN VS KD IR+ELALGEEVVTIRRNAPAALLYEDALKENKT I++SGALIAFS
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           GSKTGRSPKDKRIVDEPTS+ NIWWGPVNKKCSEKTWLVNRERAAD+LRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIRVVCARAYHALFMTNMLI+PT +ELE FGEPDFTVWNAGQFPANTHTDG
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           MTSKTT+EINFQKMEMVILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGIRD D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AI+FGSVLENVAYD  TR VD+E+CEITENTRCAYPIEYIPSAKIPCLA+ HPKNIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTP QVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLA+KMS H+A+AWLINTGWTG SFVDGG+RCPLKYTRAILDA+HDG+LA+E++ETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540
           TF LH+P HVNNVP +ILNPA++W  GE KYK +V  LA LF ENFKKY+  AS +++ A
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 541 GPLL 544
           GP+L
Sbjct: 541 GPVL 544

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/544 (81%), Positives = 493/544 (90%), Gaps = 2/544 (0%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSPSK     S + RIR EL L +EVVTIRRNAPAALLYEDALKE KT IS+SGALIA+S
Sbjct: 1   MSPSK--TYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           G KTGRSP+DKRIVDE TS+ N+WWGPVNKKCSE+TW +NRERAAD+LRTRDHLYIVDAY
Sbjct: 59  GEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIK+RVVCARAYHALFMTNMLI+PT QEL EFGEPDFTVWNAGQFPANTHT G
Sbjct: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTG 178

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           MTSKTT+EINF++MEM+ILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGI DND
Sbjct: 179 MTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADND 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGL+  KEPEI+N
Sbjct: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYN 298

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AI+FGSVLENV Y+  TREVD+E+  ITENTRCAYPI+YIPSAKIPCLAD HP NIVLLT
Sbjct: 299 AIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLT 358

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVS+LTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 359 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLA+KM+ H A+AWLINTGWTG S+V GG RCPLKYTRAILD+IHDG+LAKE+YETLP
Sbjct: 419 ATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLP 478

Query: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540
           TFNL IP  VNNVPS +LNPA++W+ GEAKY + V+ LA LFVENFK Y+  A+++++ A
Sbjct: 479 TFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSA 538

Query: 541 GPLL 544
           GP L
Sbjct: 539 GPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/545 (80%), Positives = 490/545 (89%), Gaps = 3/545 (0%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSP+K +N  S ++ IR EL L  EVVTIRRNAPAALLYEDALKE  T IS +GALIA+S
Sbjct: 1   MSPTKTQN--SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           G KTGRSP+DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTRDH+YIVDAY
Sbjct: 59  GDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIK+RVVCARAYHALFMTNMLI+P+ +ELE FGEPDFTVWNAGQFPANTHT G
Sbjct: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSG 178

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           MTSKTT+EINF++MEMVILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGI+DND
Sbjct: 179 MTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDND 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKC+GL+  KEPEIFN
Sbjct: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFN 298

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AI+FGSVLEN+ YD  TREVD+E+  ITENTRCAYPIEYIPSAKIPCLAD HPKNIVLLT
Sbjct: 299 AIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLT 358

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTP+QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFL+LHP+KY
Sbjct: 359 CDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKY 418

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLA+KM+ H A+AWLINTGWTG S+V GG RCPLKYTRAILDAIHDG+LAKEEYE LP
Sbjct: 419 ATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLP 478

Query: 481 TFNLHIPLHV-NNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMC 539
            FNL IP  V + VP+++LNP+++W  GEAKY + V++LANLFVENFK Y+  A+ +++ 
Sbjct: 479 IFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLA 538

Query: 540 AGPLL 544
           AGP L
Sbjct: 539 AGPQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/546 (79%), Positives = 484/546 (88%), Gaps = 4/546 (0%)

Query: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK+   V+    V+ +IR EL+L  EV+TIRRNAPAA+LYEDAL E KT I++SGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
           IA+SG KTGRSPKDKRI++E TS  NIWWGPVNK   EKTW +NRERAAD+LRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           VDA+AGWDPRYRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           HT GM+SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           + NDVTLFFGLSGTGKTTLSADP RKLIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EI+NAI+FGS+LENV YD  TR+VD+E+  ITENTRCAYPIE+IPSAKIPCLAD HP+N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KMS H+A+AWLINTGWTG S+V GG RCPLKYTRAILDAIHDG+LAKE Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           ETLPTFNLHIP  VN VP  +LNP+++WV GEAKY T V  LA LFVENFK Y+  A+ E
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/544 (79%), Positives = 479/544 (88%), Gaps = 3/544 (0%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSPSK+    + +++IR EL L   V+TIRRNAPAA+LYEDAL E KT IS++GALIA+S
Sbjct: 1   MSPSKVYQ--TPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           G KTGRSPKDKRIVDEPTSS NIWWGPVN+K SEKTWL+NRERAADFLRTR+HLYIVDAY
Sbjct: 59  GEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIR+VC RAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFPANTHT+G
Sbjct: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPINH VLTLHSSANQG  +ND
Sbjct: 179 MSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNND 237

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSAD  RKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 238 VTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFN 297

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AI++GSVLENV YD  TR VD+E+  ITENTRCAYPIEYIPSA+IPCL++ HP NIVLLT
Sbjct: 298 AIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLT 357

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVS+LTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 358 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 417

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLA+KMS H A AWLINTGWTG S+  GG RCPLKYTRAILD+IHDGTLA+ EYETLP
Sbjct: 418 ATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLP 477

Query: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540
            F L IP  V  VP+ +LNPA++WV GE KY + V  LA+ F ENFK Y+  A+ E++ A
Sbjct: 478 VFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRA 537

Query: 541 GPLL 544
           GP +
Sbjct: 538 GPQI 541

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/546 (77%), Positives = 480/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK+   V     V+ +IR+ELAL +EV TIRRNAPAA+LYED LKENKT IS+SGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EIF+AI+FGSVLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILD+IHDG+LA E Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           ETLP FNL +P  VN VP+ +LNPA++W  GE+KY+  V  LANLFV+NFK Y+  A+ +
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/542 (77%), Positives = 476/542 (87%)

Query: 3   PSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGS 62
           P  I +   V+  IRKEL L E+V TIRRNAPAA+LYEDAL E KT I++SGALIA+SGS
Sbjct: 11  PIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGS 70

Query: 63  KTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAG 122
           KTGRSP+DKRIV+E TS  N+WWGPVNK CSEKTW +NRERAAD+LRTRDHLYIVDA+AG
Sbjct: 71  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAG 130

Query: 123 WDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMT 182
           WDP+YRIK+RVVCARAYHA+FMTNMLI+PT +EL  FGEPDFT+WNAGQFPAN +T  M+
Sbjct: 131 WDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMS 190

Query: 183 SKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVT 242
           SKTTIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP+ H +LTLHSSANQGI++ DVT
Sbjct: 191 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVT 250

Query: 243 LFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAI 302
           LFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFNAI
Sbjct: 251 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAI 310

Query: 303 RFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCD 362
           ++GS+LENV YD  TR VD+++  ITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTCD
Sbjct: 311 KYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCD 370

Query: 363 ASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYAT 422
           ASGVLPPVSKLTPEQVMYHFISGYTSK+AGTEEGVTEPE+TFSSCFGQPFLALHP++YAT
Sbjct: 371 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYAT 430

Query: 423 MLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTF 482
           MLA+K+SHH ADAWLINTGWTG S+V+GG RCPLKYTRAILD+IHDG+LAK+ YETLP F
Sbjct: 431 MLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIF 490

Query: 483 NLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGP 542
           NL +P  VN VP  ILNPA++W  GEAKY T V  L +LFVENFK Y+  A+ +++ AGP
Sbjct: 491 NLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550

Query: 543 LL 544
            +
Sbjct: 551 QI 552

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/546 (76%), Positives = 474/546 (86%), Gaps = 4/546 (0%)

Query: 1   MSPSK----IRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK    I +   V+++IRKELALG EVVTIR NAPAA LYED LKE KT + +SGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
            A+SGSKTGRSPKDKRI++E TS   +WWGPVNK  SEKTW +NRERAAD+LRTRDHLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           +DAYAGWDPRYRIK+RV+CARAYHALFMTNMLI+P+P+EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           +T+GMTSKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
              DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI LT  KEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EI+NAI+FGSVLENV +D+  REVD+ +  ITENTRCAYPI+YIPSAKIPCLAD+HP NI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KM  H A+AWL+NTGWTG S+  GG RCPLKYTRAILD+IHDG+L+K +Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           ETLP FNLH P  VN VP ++LNPA+SWV G  KY + V+TLA  F ENFK Y+  A+ +
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/544 (77%), Positives = 474/544 (87%), Gaps = 2/544 (0%)

Query: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60
           MSPSK+    S +++IR EL L   V+ IRRNAPAALLYEDAL E  T IS++GALIA+S
Sbjct: 1   MSPSKV--FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120
           G KTGRSPKDKRIVDEPTS+  +WWGPVN+K SE+TW +NRERA D+LRTR+HLYIVDA+
Sbjct: 59  GEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAF 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIR+VC RAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFPANTHT+G
Sbjct: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178

Query: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240
           M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPINH VLTLHSSANQGI   D
Sbjct: 179 MSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGD 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSAD  R LIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 239 VTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFN 298

Query: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360
           AIR+GSVLENV Y+  +R VD+++  ITENTRCAYPIEYIPSAKIPCL++ HP NIVLLT
Sbjct: 299 AIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLT 358

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 359 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418

Query: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480
           ATMLA+KMS H A+AWLINTGWTG S+V GG RCPLKYTRAILDAIH G+LA  +YETLP
Sbjct: 419 ATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLP 478

Query: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540
            F L IP  V  VPS +LNP+R+WV GE KY   V +LANLFV+NFK Y+  A+ E++ A
Sbjct: 479 VFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYA 538

Query: 541 GPLL 544
           GP L
Sbjct: 539 GPQL 542

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/546 (76%), Positives = 478/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK+  +      V+ +IR+ELAL +EV TIRRNAPAA+LYED LKE KT IS+SGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H +LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD+GVFNIEGGCYAKCI L+  KEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EIF+AIRFG+VLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KMS H+A+A+LINTGWTG S+V GG RC LKYTRAILD+IHDG+LAK  Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           E+LP FNL +P  VN VP+ +LNPA++W  GEAKYK  V  LANLFVENFK Y+  A+ +
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/543 (76%), Positives = 477/543 (87%)

Query: 2   SPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSG 61
           S S   + +SV+ +IR+EL L +EV+TIRRNAPAA+LYEDAL E KT I++SGALIA+SG
Sbjct: 5   SNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSG 64

Query: 62  SKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYA 121
            KTGRSPKDKRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTRDHLYIVDA+A
Sbjct: 65  EKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFA 124

Query: 122 GWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGM 181
           GWDP+YRIK+RVVCARAYHALFMTNMLI+P+ +EL  FGEPDFTVWNAGQFPAN HT  M
Sbjct: 125 GWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDM 184

Query: 182 TSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDV 241
           +SK+TIEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI++ DV
Sbjct: 185 SSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDV 244

Query: 242 TLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNA 301
           TLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+A
Sbjct: 245 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDA 304

Query: 302 IRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTC 361
           IRFGSVLENVAYD  + EVD+++  ITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTC
Sbjct: 305 IRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTC 364

Query: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYA 421
           DASGVLPPV+KL+PEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALHP++YA
Sbjct: 365 DASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYA 424

Query: 422 TMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPT 481
            MLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILDAIHDG+LA+  YE+LP 
Sbjct: 425 KMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPI 484

Query: 482 FNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAG 541
           FNL +P  VN VP  +LNPA++W  GEAKY   V  LA+LFVENFK Y+  A+ +++ AG
Sbjct: 485 FNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAG 544

Query: 542 PLL 544
           P+L
Sbjct: 545 PIL 547

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/546 (76%), Positives = 477/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK+   V     V+ +IR+ELAL +EV TIRRNAPAA+LYED LKE KT IS+SGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EIF+AI+FG+VLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KMS HKA+A+LINTGWTG S+V GG RCPLKYTRAILD+IHDG+LA E Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           E+LP FNL +P  V  VP+ +LNPA++W  GE KYK  V +LA LFVENFK Y+  A+ +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/546 (76%), Positives = 478/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKIR----NLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56
           MSPSK+     +   V+ +IR+ELAL +EV TIRRNAPAA+LYED LKE KT IS+SGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+E TS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356
           EIF+AI+FG+VLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476
           P++YATMLA KMSHHK++A+LINTGW+G S+V GG RCPLKYTRAILD+IHDG+LA E Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536
           E+LP FNL +P  V  VP+ +LNPA++W  GEAKYK  V  LANLFVENFK Y+  A+ +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 537 IMCAGP 542
           ++ AGP
Sbjct: 541 VLAAGP 546

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/534 (77%), Positives = 469/534 (87%)

Query: 11  SVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGSKTGRSPKD 70
           SV++RIR EL L +EV  IRRNAPAA+LY+DALKE KT IS++GALIA+SG KTGRSPKD
Sbjct: 11  SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKD 70

Query: 71  KRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYRIK 130
           KRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTR+ LY+VDA+AGWDP+YRIK
Sbjct: 71  KRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIK 130

Query: 131 IRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIEIN 190
           +RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN  T  MTSKTTIEIN
Sbjct: 131 VRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEIN 190

Query: 191 FQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLSGT 250
           F+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSS NQGI++ DVTLFFGLSGT
Sbjct: 191 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGT 250

Query: 251 GKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVLEN 310
           GKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AIRFGSVLEN
Sbjct: 251 GKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLEN 310

Query: 311 VAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLPPV 370
           V YDS + EVD+++  ITENTRCAYPI++IPSAKIPCLA  HPKNI+LLTCDASGVLPPV
Sbjct: 311 VIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPV 370

Query: 371 SKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKMSH 430
           SKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL+LHP++YATMLA+KM  
Sbjct: 371 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHE 430

Query: 431 HKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPLHV 490
           H A+AWLINTGWTG S+V GG RC LKYTRAILDAIHDG+LAK E+E+LP FNL +P  V
Sbjct: 431 HSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAV 490

Query: 491 NNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGPLL 544
             VPS +LNPAR+W  GEAKY++ V  LA LFVENFK Y+  A+++++ AGP L
Sbjct: 491 EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/551 (75%), Positives = 473/551 (85%), Gaps = 7/551 (1%)

Query: 1   MSPSKIRNLV-------SVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISAS 53
           MSP K  N          V+ +IR+EL L ++V TIRRNAPAA+LYEDAL E  T IS++
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 54  GALIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDH 113
           GAL+A+SG KTGRSP+DKRIV+E TS  +IWWGPVNK CSE+TW +NRERAAD+LRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 114 LYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFP 173
           LYIVDA+AGWDP YRIK+RVVCARAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 174 ANTHTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSAN 233
           AN HT  M+SKTTIEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H +LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 234 QGIRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEA 293
           QGIR+ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 294 KEPEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHP 353
           KEPEIF AI++GS+LENV YD  TR V +++  +TENTRCAYPIE+IPSAKIPCLAD HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 354 KNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFL 413
            NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 414 ALHPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAK 473
           ALHP++YATMLA K+S H A+AWLINTGWTG S+V GG RCPLKYTRAILD+IHDG+LAK
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 474 EEYETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANA 533
           +E+ETLP FNL +P +VNNVP  +LNPA++W  GEAKY   V  LA+LFVENFK Y+  A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 534 STEIMCAGPLL 544
           + E++ A P +
Sbjct: 541 TPEVLAAAPRI 551

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/549 (74%), Positives = 477/549 (86%), Gaps = 5/549 (0%)

Query: 1   MSPSKI----RNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENK-TRISASGA 55
           MSPSK+    ++L +V+ +IR+EL L   V TIRRNAP ++LYEDALK+ K T IS++GA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 56  LIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLY 115
           LIA+SG KTGR PKDKRIV+E  S ++IWWGPVNK CSE+TW +NRERAAD+LRTR+H+Y
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 116 IVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPAN 175
           IVDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT  ELE FG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 176 THTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQG 235
            HT+ M+SKTTIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPI+H VLTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 236 IRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKE 295
           I   DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 296 PEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKN 355
           PEIFN+I+FGS+LENV YD  +REVD+++  ITENTRCAYPIE+IPSAKIPC+A+ HPKN
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 356 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLAL 415
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSK+AGTE+GVTEP+ TFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 416 HPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEE 475
           HP+KYATMLA+KM  HKA+AWLINTGWTG S++ GG RCPL YTRAILDAIHDG+L KE 
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 476 YETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANAST 535
           +ETLP FNL +P +VNNVP+ +LNP+++W  GE KY   V+ L+ LF+ENFK YE  A+ 
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 536 EIMCAGPLL 544
           E++ AGP L
Sbjct: 541 EVLAAGPRL 549

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/520 (75%), Positives = 447/520 (85%)

Query: 25  EVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGSKTGRSPKDKRIVDEPTSSQNIW 84
           +++ I+RN P A LYED LKENKT +S++GALIA+SG KTGRSPKDKRIV+E  S  NIW
Sbjct: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118

Query: 85  WGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFM 144
           WGPVNK+CSE+TW +NRERA D+L TRD LY++DA+ GWDPRYRIKIRVVCARAYHALFM
Sbjct: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178

Query: 145 TNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIEINFQKMEMVILGTEYA 204
            NMLI+PT +ELE FG+PDFTVWNAGQF AN+ T+ M+SKT++EINF++MEM ILGTEYA
Sbjct: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238

Query: 205 GEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLSGTGKTTLSADPARKLI 264
           GEMKKGIFTVMFYLMPI H VLTLHSSANQ   + DVTLFFGLSGTGKTTLSADP R+LI
Sbjct: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298

Query: 265 GDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVLENVAYDSFTREVDFEN 324
           GDDEHCWSD+GVFNIEGGCYAKCIGL++ KEP+IFNAI+FGSVLEN  YD  T EVD++N
Sbjct: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358

Query: 325 CEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLPPVSKLTPEQVMYHFIS 384
             ITENTRCAYPI+YI +AKIPCLAD+HP N++LLTCDASGVLPPVSKLTPEQVMYHFIS
Sbjct: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418

Query: 385 GYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKMSHHKADAWLINTGWTG 444
           GYTSK+AGTE GVTEP+ TFSSCFGQPFLALHP+KYA+MLA+KM  HKA+AWL+NTGWTG
Sbjct: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478

Query: 445 QSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPLHVNNVPSNILNPARSW 504
            S+V GG RCPLKYTRAILDAIHDG+L  EEYETLP FNL IP + N VPS +LNPA SW
Sbjct: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538

Query: 505 VGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGPLL 544
                 Y T V+ L  LF ENFK YE  A+ E++ AGP+L
Sbjct: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/549 (72%), Positives = 455/549 (82%), Gaps = 8/549 (1%)

Query: 2   SPSKIRNLVSVKDRIRKEL----ALGEEVVTIRRNAPAALLYEDALKENKTRISASGALI 57
           +PS  +  +S++D++  +L    +    ++ I+ N  AA+LYEDALKE KT IS+SGALI
Sbjct: 26  NPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALI 85

Query: 58  AFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIV 117
           A+SG+KTGRSPKDKRIV E  S  N+WWGPVNK CSEKTW +NRER  D+L TR +LY++
Sbjct: 86  AYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVI 145

Query: 118 DAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTH 177
           DAY GWDPRYR+K+RVVCARAYHALFMTNMLI+PT +EL+ F EPDFTVWNAG F AN++
Sbjct: 146 DAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSY 205

Query: 178 TDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIR 237
           T  MTSKT++EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPI+H +LTLHSSAN+GI 
Sbjct: 206 TADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIE 265

Query: 238 DNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPE 297
             DVT+FFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEPE
Sbjct: 266 KKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPE 325

Query: 298 IFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIV 357
           IF+AIRFGSVLENV Y+    +VD+ +C ITENTRCAYPI+YI SAKIPCLA+ HPKN++
Sbjct: 326 IFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLI 385

Query: 358 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHP 417
           LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP
Sbjct: 386 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP 445

Query: 418 LKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYE 477
           + YATMLA KM  +K++AWLINTGWTG S+  GG RCPLKYTRAILDAIHDGTLA E YE
Sbjct: 446 ITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYE 505

Query: 478 TLPTFNLHIPLHVNNVPSNILNPARSWVGGEAK----YKTKVRTLANLFVENFKKYEANA 533
           TLP FNL IP HVN VP+ ILNP  SW     K    Y   V  LA LFVENFK Y+  A
Sbjct: 506 TLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKA 565

Query: 534 STEIMCAGP 542
           + +++ AGP
Sbjct: 566 TDDVLAAGP 574

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/558 (70%), Positives = 458/558 (82%), Gaps = 14/558 (2%)

Query: 1   MSPSKIRNL-VSVKDRIRKELALGEEV-------------VTIRRNAPAALLYEDALKEN 46
           M+P+KI +  ++ ++ I K L     V             +TI+RN P A LYED LKE+
Sbjct: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60

Query: 47  KTRISASGALIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAAD 106
            T +S++GAL+A+SG KTGRSPKDKRIV+EP+S  NIWWGPVNK CSE TW +NRERA D
Sbjct: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120

Query: 107 FLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTV 166
           +L TR  LY++DAYAGWD  YRIKIRVVCAR YHALFM NMLI+PT +ELE FGEPDFT+
Sbjct: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180

Query: 167 WNAGQFPANTHTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVL 226
           WNAG F AN+ T  MTSKT+IEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+ H VL
Sbjct: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240

Query: 227 TLHSSANQGIRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAK 286
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADP R+LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300

Query: 287 CIGLTEAKEPEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIP 346
           CIGLTE KEPEIFNAI+FGSVLEN  YD  T  VD+++  ITENTRCAYPI++I SAKIP
Sbjct: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360

Query: 347 CLADEHPKNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSS 406
           CL D+HP N++LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFS+
Sbjct: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420

Query: 407 CFGQPFLALHPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAI 466
           CFGQPFLALHP+KYA MLADKM+HHKA AWLINTGWTG S+  GG RCPLKYTRAILDAI
Sbjct: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480

Query: 467 HDGTLAKEEYETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENF 526
           H+G+LA EEYETLP FNL IP +V NVPS +LNP+++W   +  Y   V+ L +LFV+NF
Sbjct: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540

Query: 527 KKYEANASTEIMCAGPLL 544
             Y+  A+ +++ AGP L
Sbjct: 541 TIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 57/110 (51%), Gaps = 18/110 (16%)

Query: 373 LTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKMSHHK 432
           LT E+VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 433 ADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTF 482
             A+LINTG+  +             TR   D+IHD +LAKE +   PT+
Sbjct: 58  -SAYLINTGYALK-------------TRVNFDSIHDDSLAKELFRA-PTY 92

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
           (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 77/192 (40%), Gaps = 42/192 (21%)

Query: 341 PSAKIPCLADEH--------PKNIVLLTCDA---------SGVLPPVSKLTPEQVMYHFI 383
           PS+ IPC++ E+        P+  +  T D          S   PPV  +TP+ +M   I
Sbjct: 96  PSSSIPCISKENIYEERIYEPETTLKQTPDVINNCTEGGFSSYCPPVPIVTPDSIMASAI 155

Query: 384 SGYTSKVAGTEEGVT----EPEATFSSCFGQPFLALHPLKYATMLAD-KMSHHKADAWLI 438
           +  T+ V  +  G++     PE    S      L   PL   + + D KM   +A   ++
Sbjct: 156 TPATTAVNSSINGLSNNMHSPEEVTKSK-----LYDIPLTVPSFMKDMKMELWEAKDTIV 210

Query: 439 NTG--------WTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPLHV 490
             G        ++  +F+        KY RA+  +IH  +L K +            + V
Sbjct: 211 EYGCLRFVEPAFSTHTFIQLD-----KYARALCGSIHGISLIKLQERLEENIAKEDGMMV 265

Query: 491 NNVPSN--ILNP 500
           NN P N  IL+P
Sbjct: 266 NNNPDNMDILSP 277

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 246 GLSGTGKTTLSADPARKL-IGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRF 304
           G SG+GK+T+++   R   + +      D+ + N     Y + IG T  +EP +FN    
Sbjct: 480 GFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-TVQQEPSLFN---- 534

Query: 305 GSVLENVAY 313
           GS+L+N+ Y
Sbjct: 535 GSILDNIIY 543

>ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some
           similarities with uniprot|P32319 Saccharomyces
           cerevisiae YBL017C PEP1 Type I transmembrane sorting
           receptor for multiple vacuolar hydrolases cycles between
           the late-Golgi and prevacuolar endosome-like
           compartments
          Length = 699

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 9/96 (9%)

Query: 304 FGSVLENVAYDSFTREVDFENCE-----ITENTRCAYPIEYIPSAKIPCLADEHP--KNI 356
           FG  +  V  D F +E  F         +TE+   ++    +P  +I C +D HP   N+
Sbjct: 90  FGEGIPWVDVDKFHKERAFVTTSSGKIYMTEDQGRSWKQLSLPQDEIDCFSDTHPFNTNL 149

Query: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAG 392
           +LL CD+   L    + TP+   +     Y S  AG
Sbjct: 150 LLLHCDSR--LENNPETTPDSSSFQERIAYASDDAG 183

>NCAS0H03190 Chr8 (613975..616170) [2196 bp, 731 aa] {ON} Anc_2.629
          Length = 731

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 142 LFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIEINFQKME 195
           L + N+L+ P P+E +E  E  FT+ NAG+     + D +  K   +I F  +E
Sbjct: 525 LSVENLLLNPQPEERDEVNERRFTLCNAGK----KYGDLVMMKELFDIYFYDLE 574

>NCAS0A09060 Chr1 (1793006..1793854) [849 bp, 282 aa] {ON} Anc_1.346
           YBR257W
          Length = 282

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 12/56 (21%)

Query: 464 DAIHDGTLA--KEEYETLPTFNLHIPLH----------VNNVPSNILNPARSWVGG 507
           D ++D  L   KE Y++LPT+  ++P+H          + N+P+N+ N ++  + G
Sbjct: 112 DTLNDYLLENNKELYDSLPTYEKYLPMHEKLWVGYMKEILNIPANLSNSSKLSING 167

>ZYRO0A11814g Chr1 (950029..953286) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P15938 Saccharomyces cerevisiae YKR086W PRP16
           RNA helicase in the DEAH-box family involved in the
           second catalytic step of splicing exhibits ATP-
           dependent RNA unwinding activity
          Length = 1085

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 228 LHSSANQGIRDNDVTLFFGLSGTGKTT 254
           + S   Q IRDN VT+  G +G+GKTT
Sbjct: 367 MRSQIIQTIRDNQVTIIIGETGSGKTT 393

>TPHA0A05270 Chr1 complement(1185683..1190263) [4581 bp, 1526 aa] {ON}
            Anc_5.75 YHR164C
          Length = 1526

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 237  RDNDVTLFFGLSGTGKTTLSADPARKLIGD 266
            R  D  L  G+ GTGKTTL A+  R ++G+
Sbjct: 1075 RAEDYALVLGMPGTGKTTLIAEIIRHIVGN 1104

>KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1.216
            YKR054C
          Length = 4103

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 13/78 (16%)

Query: 176  THTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQG 235
            +H+D + S    + NF+    V  G EY G  ++ I+T +       HG  +L  S  Q 
Sbjct: 1736 SHSDELCSLRVSQCNFE----VCYGFEYIGVPERLIYTPLLV-----HGFASLMGSLTQR 1786

Query: 236  IRDNDVTLFFGLSGTGKT 253
            +       FFG +GTGKT
Sbjct: 1787 LGG----CFFGPAGTGKT 1800

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 217 YLMPINHGVLTLHSSANQGIRDNDVTLFFGLSGTGKTTL 255
           Y +PI HG   L  + +  ++   +T   G SG GKTTL
Sbjct: 858 YDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,905,361
Number of extensions: 2615042
Number of successful extensions: 6255
Number of sequences better than 10.0: 33
Number of HSP's gapped: 6379
Number of HSP's successfully gapped: 33
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)