Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196615.709ON37137120050.0
KLTH0E00880g5.709ON37137113950.0
SAKL0E15070g5.709ON38537711271e-153
TDEL0B021105.709ON38935010951e-148
NCAS0G002005.709ON43835010351e-138
Kpol_2001.775.709ON4133419981e-133
Ecym_40125.709ON3953359921e-133
YIL153W (RRD1)5.709ON3933779871e-132
AFR293C5.709ON3653269821e-131
Suva_9.355.709ON3933779831e-131
Skud_9.155.709ON4023569781e-130
ZYRO0B16478g5.709ON3913159741e-130
Smik_9.165.709ON3933289701e-129
NDAI0F002405.709ON4643289571e-126
KLLA0A00462g5.709ON3533609231e-123
CAGL0H06655g5.709ON4243409211e-121
TPHA0D046505.709ON4214139151e-120
TBLA0E016905.709ON4883398861e-115
KNAG0L021705.709ON3963888691e-114
KAFR0D021905.709ON4263998491e-110
Ecym_23998.674ON3512594429e-51
ZYRO0F07326g8.674ON3522984351e-49
NDAI0E024108.674ON3593024298e-49
YPL152W (RRD2)8.674ON3582994263e-48
NCAS0C016908.674ON3593024254e-48
CAGL0M02255g8.674ON3582994237e-48
Skud_16.1308.674ON3582554211e-47
Smik_6.3498.674ON3582984183e-47
Kpol_1013.48.674ON3583014183e-47
ACR139C8.674ON3592554132e-46
Suva_16.1588.674ON3582994114e-46
SAKL0H06622g8.674ON3552984098e-46
TPHA0D012408.674ON3592964081e-45
KLTH0D11176g8.674ON3532534027e-45
Kwal_26.87838.674ON3552223913e-43
KNAG0J016908.674ON3633043881e-42
TDEL0A062008.674ON3552983852e-42
KAFR0H024408.674ON3533013852e-42
KLLA0F11187g8.674ON3602653853e-42
TBLA0C018608.674ON3563043819e-42
Ecym_35631.489ON38370820.11
Skud_11.2382.518ON625120790.30
NCAS0D001502.20ON476118760.68
SAKL0B09306g3.419ON830103751.1
KLLA0E13685g5.247ON668161694.7
YER083C (GET2)7.277ON285107676.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19661
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   776   0.0  
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   541   0.0  
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   438   e-153
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   426   e-148
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      403   e-138
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   389   e-133
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   386   e-133
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   384   e-132
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   382   e-131
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   383   e-131
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   381   e-130
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   379   e-130
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   378   e-129
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      373   e-126
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   360   e-123
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   359   e-121
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   357   e-120
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   345   e-115
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   339   e-114
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   331   e-110
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   174   9e-51
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   172   1e-49
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   169   8e-49
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   168   3e-48
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   168   4e-48
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   167   7e-48
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   166   1e-47
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   165   3e-47
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   165   3e-47
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   163   2e-46
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   162   4e-46
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   162   8e-46
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   161   1e-45
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   159   7e-45
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   155   3e-43
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   154   1e-42
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   152   2e-42
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   152   2e-42
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   152   3e-42
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   151   9e-42
Ecym_3563 Chr3 complement(1069119..1070270) [1152 bp, 383 aa] {O...    36   0.11 
Skud_11.238 Chr11 (433135..435012) [1878 bp, 625 aa] {ON} YKR008...    35   0.30 
NCAS0D00150 Chr4 complement(11891..13321) [1431 bp, 476 aa] {ON}...    34   0.68 
SAKL0B09306g Chr2 complement(788332..790824) [2493 bp, 830 aa] {...    33   1.1  
KLLA0E13685g Chr5 (1209218..1211224) [2007 bp, 668 aa] {ON} high...    31   4.7  
YER083C Chr5 complement(326174..327031) [858 bp, 285 aa] {ON}  G...    30   6.4  

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/371 (100%), Positives = 371/371 (100%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60
           MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60

Query: 61  PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS 120
           PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS
Sbjct: 61  PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS 120

Query: 121 IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSL 180
           IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSL
Sbjct: 121 IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSL 180

Query: 181 VRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAG 240
           VRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAG
Sbjct: 181 VRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAG 240

Query: 241 SNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300
           SNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH
Sbjct: 241 SNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300

Query: 301 FWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHPMNPPHLRNVS 360
           FWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHPMNPPHLRNVS
Sbjct: 301 FWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHPMNPPHLRNVS 360

Query: 361 RFIAHDRLKKG 371
           RFIAHDRLKKG
Sbjct: 361 RFIAHDRLKKG 371

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 297/371 (80%), Gaps = 2/371 (0%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60
           M  ++ID  + TFTEP KRIFDSRG+HVFQSSVAM RLK +LHKY+  +SG +IP  ++N
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60

Query: 61  PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS 120
             V S  ++L   S+LVD TPALPGPRRYGNLACR WHDK++E +   L +FLPE  + S
Sbjct: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120

Query: 121 IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSL 180
           IVEL YYLGNAFGSRERLDYGTGHELSFF+ ICALDMLG+WG+ FQA D+L+LF++YY+L
Sbjct: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180

Query: 181 VRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAG 240
           VRKL+  Y+LEPAGSHGVWGLDDHFHLIYIFGASQW D K A  +PRE+Q K+IVDEY  
Sbjct: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240

Query: 241 SNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300
           +NFYCQAISFIF+VKSGPFSEHSPML+DISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH
Sbjct: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300

Query: 301 FWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPS-MTKLRHPMNPPHLRNV 359
           FWFGT LFPWTS   G  LPTYE SQE   Q  L   T   P+ +   R  MNPP+LR +
Sbjct: 301 FWFGTGLFPWTSLGDGYALPTYEASQEAQGQV-LQHTTAPAPTNLNSARRQMNPPNLRGI 359

Query: 360 SRFIAHDRLKK 370
           +R  + DR ++
Sbjct: 360 NRLTSQDRFRR 370

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/377 (56%), Positives = 265/377 (70%), Gaps = 11/377 (2%)

Query: 5   QIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI 64
           +IDV  T FTEPVK+IFD++GT  FQSSV M RL+ +LHKY+ ++  + IPS ++N  V 
Sbjct: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVN 68

Query: 65  SLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVEL 124
              +I+   S+ +DETP LPGPRR+GN ACR WH KM   +   LQ F+PEKY+  IVE+
Sbjct: 69  RFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEI 128

Query: 125 AYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKL 184
            YYLGNAFGS+ERLDYGTGHELSF +V+ A+DML +WGS    +D+L+LFN YY+LV+KL
Sbjct: 129 RYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKL 188

Query: 185 ITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFY 244
           I  Y+LEPAGSHGVWGLDDHFHL YI G+SQ A        P +I  +  V++YA +N Y
Sbjct: 189 IATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLY 248

Query: 245 CQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
            QAI+FI KVKSG FSEHSPMLYDI+++V TWSKVQRGLLKMY AEVLNKFPVVQHFWFG
Sbjct: 249 FQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFG 308

Query: 305 TALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHP------MNPPHL-- 356
           T  FPW +   G +LPTYE +QE +          + P+ TK   P      M PP +  
Sbjct: 309 TGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPPPTILP 368

Query: 357 -RN--VSRFIAHDRLKK 370
            RN  + +F   DR K+
Sbjct: 369 SRNSPMGKFANRDRFKR 385

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/350 (58%), Positives = 250/350 (71%), Gaps = 3/350 (0%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60
           + + +ID+  T F  PVK IFDS+G   FQ SVA+ RLK HL KY  M+ GQ I  E S 
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61

Query: 61  PNVIS-LRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYP 119
             V++ +  +L   S+LVDETP   GPRRYGNLACRDWHDK++  + E LQ+ LP+ Y+ 
Sbjct: 62  IEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121

Query: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYS 179
            I EL+YYLGN+FGS  RLDYGTGHELSF +V+ ALDMLG+W S F  KD+L LF+ YY 
Sbjct: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181

Query: 180 LVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYA 239
           LVRKLI  Y+LEPAGSHGVWGLDDHFH+IYI G+SQW+       +PR++++K++V +YA
Sbjct: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241

Query: 240 GSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299
            +N YCQAI FIF VKSGPFSEHS MLYDI+ +V TWSKVQ GLLKMY+ EVL KFPVVQ
Sbjct: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301

Query: 300 HFWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRH 349
           HFWFG   +PW S   G  LP YE ++    Q   P MT   PS T + H
Sbjct: 302 HFWFGPGFYPWISDRNGQKLPIYENAESEKKQP--PSMTTMAPSNTTMYH 349

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  403 bits (1035), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 244/350 (69%), Gaps = 15/350 (4%)

Query: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI- 64
           +D+ TT F+ P KRIFDS+ T  FQSS+A+ RL+  L KY+ M++  + P E +  +V  
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 65  --SLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQI----REQLQEFLPE--- 115
             S+ ++L+  S L+DETP L GPRRYGNLACRDWH KME Q+     E L  +LP+   
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 116 ---KYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLY 172
                +P I EL YY+ NAFGS  RLD+GTGHELSF + I A+DMLG+W  G Q  D+L 
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 173 LFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSK 232
           LFN YY+LVRKLI  Y+LEPAGSHGVWGLDDHFHL YI G+SQW   ++A   PR+++  
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDI 270

Query: 233 MIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVL 292
            +V +YA SN YCQ I+FIF+VKSGPFSEHSP+LYDI+ SV TWSKVQRGL+KMY  EVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 293 NKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQP 342
            KFPVVQHFWFG   +PW +   G  LP YE S E D   Q   + Q+ P
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAP 380

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  389 bits (998), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/341 (54%), Positives = 235/341 (68%), Gaps = 10/341 (2%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSET-- 58
           M+Q  ++     F  PVKRI+DS+GT +FQSSVA+ RLK  + KY+ ++    IP E+  
Sbjct: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62

Query: 59  -SNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPE-- 115
              P V  L K++   S LVDETP  PGPRR+GNL+CR+WH K++  ++  L + L +  
Sbjct: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122

Query: 116 -----KYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL 170
                K   S+VEL+YYLGN+FGS  RLDYGTGHELSF +VI  +DMLG+W    +  DL
Sbjct: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182

Query: 171 LYLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQ 230
           L +FNEYY L++KLI  Y+LEPAGSHGVWGLDDHFH  YI G++QW+++ +    P +I 
Sbjct: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242

Query: 231 SKMIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAE 290
           +K +V EYA +N YC AI FI  VKSGPFSEHSPMLYDIS+SV  WSKV+ GLLKMY  E
Sbjct: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302

Query: 291 VLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQ 331
           VLNKFPVVQHFWFGT LFPW   +    LP YE   +  T 
Sbjct: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTS 343

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 193/335 (57%), Positives = 235/335 (70%), Gaps = 20/335 (5%)

Query: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS 65
           +++  T F+ PVKRIFDS GTH FQ S+ M RL+ HL +YLG++  Q +P  ++N +V S
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 66  LRKI-LHFFSKLVDETPALPG-PRRYGNLACRDWHDKMEEQIREQLQEFLP----EKYYP 119
              I L  F +L+DETP     PRR+GN+ACRDWH K++E++    + FLP      Y  
Sbjct: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122

Query: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIW-----GSGFQAKDLLYLF 174
            I+EL YYLGNAFGS ERLDYGTGHELSF +V+ A+DMLG+W     G G    DLLYL+
Sbjct: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182

Query: 175 NEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMI 234
           N+YYS+V KLI  Y+LEPAGSHGVWGLDDH HL YI GASQW+D KD  A    IQ   I
Sbjct: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSD-KDQNA---PIQLSDI 238

Query: 235 VD-----EYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFA 289
           +D     +Y  +N YC +I+F+ KVKSGPFS+HSPMLYDISR+VPTWSK   GL+KMY  
Sbjct: 239 LDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV 298

Query: 290 EVLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEV 324
           EVLNKFPVVQHFWFGT  FPW     G  LP YE+
Sbjct: 299 EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYEL 333

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  384 bits (987), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/377 (51%), Positives = 253/377 (67%), Gaps = 14/377 (3%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60
           M  D++D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P   + 
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 61  PNVIS----LRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116
            + I+    L  +L   + L+DETP LPGPRRYGNLACR+WH K++E++ + LQE LP +
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALDMLG++    +  D+  LFN+
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179

Query: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PREI  K +
Sbjct: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPREILDKSL 238

Query: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298

Query: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTY---EVSQETDTQAQLPRMTQHQ---PSMTKLR 348
           FPVVQHFWFGT  FPW +   G  LP +   E        A  P   Q     P+ T + 
Sbjct: 299 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMP 358

Query: 349 HPMNPPHLRNVSRFIAH 365
            P  PP   N++  ++H
Sbjct: 359 PPGVPPSGNNINYLLSH 375

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  382 bits (982), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 227/326 (69%), Gaps = 2/326 (0%)

Query: 5   QIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI 64
           +  V  T F+ PVKRIFD+ GTH FQ S+ M RL+ HL +YL ++ GQ+IP  + N  V+
Sbjct: 2   EFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVV 61

Query: 65  SLRKILHFFSKLVDETPALPG-PRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVE 123
               IL     L+DETP   G  RR+G+LACRDWHD+M+ ++   L+  LPE    S  E
Sbjct: 62  RFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAE 121

Query: 124 LAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSG-FQAKDLLYLFNEYYSLVR 182
           L YYLG+AFGSRERLDYGTGHEL+F +V+ ALDMLG+W    F  +D+LY++  YY+LV 
Sbjct: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181

Query: 183 KLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSN 242
           +LI  Y+LEPAGSHGVWGLDDH HL YI GASQWA  ++    P +I     V  Y+ +N
Sbjct: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETN 241

Query: 243 FYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFW 302
            YC +I+F+ +VK+G F++HSPML+DI+++VPTWSKV  GL+KMY  EVLNKFPVVQHFW
Sbjct: 242 LYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFW 301

Query: 303 FGTALFPWTSTDGGDVLPTYEVSQET 328
           FGT  FPW     G  LP YE   ET
Sbjct: 302 FGTGFFPWVDMAHGMSLPNYEAPSET 327

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  383 bits (983), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 256/377 (67%), Gaps = 14/377 (3%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIP----S 56
           M  D +D     F+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P    +
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116
            +S P V  L  +L  F++L+D+TP LPGPRRYGNLACR+WH K++  + + L+E LP +
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LF++
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179

Query: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PR++  K +
Sbjct: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPRDVLDKSL 238

Query: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298

Query: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYE------VSQETDTQAQLPRMTQHQPSMTKLR 348
           FPVVQHFWFGT  FPW +   G  LP +E      + Q   T A   R +   P+ T + 
Sbjct: 299 FPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPASTSMP 358

Query: 349 HPMNPPHLRNVSRFIAH 365
            PM PP   NV+  ++H
Sbjct: 359 PPMAPPSANNVNSLLSH 375

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 245/356 (68%), Gaps = 10/356 (2%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIP----S 56
           M  D +D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P    +
Sbjct: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69

Query: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116
            +S   V  L  +L   ++L+DETP LPGPRRYGNLACR+WH K++E + + LQE LP +
Sbjct: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129

Query: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LFN+
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNK 188

Query: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWA--DSKDAEASPREIQSKMI 234
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW   D++ A   PRE+  K +
Sbjct: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR-APLQPREVLDKSL 247

Query: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V +Y  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307

Query: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHP 350
           FPVVQHFWFGT  FPW +   G  LP +E  ++ D   +        P+ T  R P
Sbjct: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFE--EKEDETIEQANAASPGPNHTSTRFP 361

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  379 bits (974), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/315 (55%), Positives = 230/315 (73%), Gaps = 1/315 (0%)

Query: 10  TTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS-LRK 68
            T F  PVKRIFDS+ T  FQ+SVA++RLK  + KY  +++   IP   S  +V++    
Sbjct: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67

Query: 69  ILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYL 128
           +L+  S LVD+TP L GPRRYGNLACRDWH K++EQ+    ++ LP++++  IVEL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 129 GNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLITKY 188
           GN+FGS  RLDYGTGHELSF +V+ A+DMLG++   FQ +D L + N YY++VRKLI  Y
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 189 SLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAI 248
           +LEPAGSHGVWGLDDHFHL Y+FG++QWA+ K+A   PR+I +  +V EYA  N YCQ I
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247

Query: 249 SFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTALF 308
            FI++VK GPF EHS MLYD++ +V TW+K++ GL+KMY  EVLNKFPVVQHFWFGT  +
Sbjct: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307

Query: 309 PWTSTDGGDVLPTYE 323
           PW     G  L  Y+
Sbjct: 308 PWVDNQTGKQLLIYD 322

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  378 bits (970), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 235/328 (71%), Gaps = 8/328 (2%)

Query: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS---- 56
           M  D +D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P     
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116
            +S P    L ++L   + L+DETP LPGPRRYGNLACR+WH K++E++ + L+E LP +
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LFN+
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNK 179

Query: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PREI  K +
Sbjct: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPREILDKSL 238

Query: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298

Query: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTY 322
           FPVVQHFWFGT  FPW +   G  LP +
Sbjct: 299 FPVVQHFWFGTGFFPWVNIQNGTNLPVF 326

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  373 bits (957), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/328 (54%), Positives = 231/328 (70%), Gaps = 9/328 (2%)

Query: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN--PNV 63
           +D+  T F+ PVKRIFDS+ T  FQSS+A+ RL+  L +Y+ +++   IP    +    +
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 64  ISLRKILHFFSKL---VDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPE-KYYP 119
           + +  I+H  ++L   V +TP L GPRRYGNLACRDWH K+E ++ + L++ +P     P
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYS 179
           SI+EL YY+ N+FGS  RLDYGTGHELSF + I ALDMLG++      KDLL +FN YYS
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192

Query: 180 LVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYA 239
           LVR+LI  Y+LEPAGSHGVWGLDDHFHL YI G+SQW +  +A  +P+EI +  +V +Y+
Sbjct: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDYS 250

Query: 240 GSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299
             N YCQ I F+  VKSGPF+EHSP+LYDIS SV  W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 300 HFWFGTALFPWTSTDGGDVLPTYEVSQE 327
           HFWFGT  +PW +      LP YE S E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  360 bits (923), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 235/360 (65%), Gaps = 16/360 (4%)

Query: 7   DVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS---ETSNPNV 63
           D     F+ P KRIFDS+GT  FQ+SVAM+R++ HL KY+ +  GQ+IP    E+   N+
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63

Query: 64  ISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVE 123
           +   ++L   S L+DETP      RYGNL+ RDW  K + Q+   L E LPEKY  SI+E
Sbjct: 64  VV--ELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIE 121

Query: 124 LAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRK 183
           L+YY+ NAFGS+ER+DYGTGHELSF +VI  LDML I     +   LLY FN YY +++K
Sbjct: 122 LSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQK 179

Query: 184 LITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNF 243
           LI  Y LEPAGSHGVWGLDDHFH  YI GA+Q  D  +    P++I +  ++++ + SN 
Sbjct: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDV-NTSLIPKDISNTRLMEQNSSSNL 238

Query: 244 YCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWF 303
           +C++I FI  VKSGPFS HSP+LY+ISRSV TW K+Q+GL+KMY  EVLNKFPVVQHFWF
Sbjct: 239 FCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWF 298

Query: 304 GTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRHPMNPPHLRNVSRFI 363
           GTA FPWTS      LP Y+ ++  D    L        +       M PP   + SRFI
Sbjct: 299 GTAFFPWTSYGNNHSLPIYQPAENNDDADFL--------TANNATTKMPPPLSTSTSRFI 350

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 233/340 (68%), Gaps = 10/340 (2%)

Query: 13  FTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHF 72
           F+EPVKRI+DS+G + FQSS A+ RL+  + KY  ++  + +     +  V  + K+L  
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLDR 61

Query: 73  FSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS----IVELAYYL 128
             +LV ETP +PGPRRYGN+ACRDWH+K+E +I   L++ +   ++PS    +VEL YYL
Sbjct: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLI-SSHFPSELQCVVELRYYL 120

Query: 129 GNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLITKY 188
            N+FGS  RLD+GTGHELSF + + ALDMLG   + F    +LY+F+ YYSLV +LI  Y
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLILSY 177

Query: 189 SLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAI 248
           +LEPAGSHGVWGLDDHFHL YI G+SQW + K     P ++   ++V++Y+ +N +C+ +
Sbjct: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237

Query: 249 SFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTALF 308
           +F+F VKSG F EHSPML+DISRSV TW+KV++GL KMY  EVLNKFPV+QHFWFGT  +
Sbjct: 238 NFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFY 297

Query: 309 PWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLR 348
           PW     G  LP YE S + D    L   TQ Q +M   R
Sbjct: 298 PWVDYKNGKPLPNYENSPDIDETNDL--KTQAQANMDGTR 335

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  357 bits (915), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 185/413 (44%), Positives = 251/413 (60%), Gaps = 48/413 (11%)

Query: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS 65
           I++   +F+ P+KRI+DS+ T  FQSS+A+ RLK +LHKY+ M+    IP  T    +  
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 66  LRKILHFFSKL---VDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLP-------- 114
           + ++    ++L   +D  P   GPRRYGNLACR+WH  ++ ++   L++ L         
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEK 126

Query: 115 ---EKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLL 171
              EK    I+EL YYL N+ GS  RLDYGTGHELSF +VI A+DMLG+W   F+  DLL
Sbjct: 127 GEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLL 186

Query: 172 YLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQS 231
           ++F+ YY LV+KLI  Y+LEPAGSHGVWGLDDHFHL YI G+SQ +++ +   SP +I +
Sbjct: 187 HMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIIN 246

Query: 232 KMIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEV 291
           K IV EY   NFYC  I FI+KVKSGPFSEHSP+LYDIS +V +W KV  GL+KMY  EV
Sbjct: 247 KKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEV 306

Query: 292 LNKFPVVQHFWFGTALFPWTSTDGGDVLPTY--EVSQETD-------------------- 329
           LNKFPVVQHFWFG   +PW +     +L  Y  + +QE +                    
Sbjct: 307 LNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNKDRS 366

Query: 330 ---TQAQLPRMTQHQPSMTKL------RHPMNPPH---LRNVSRFIAHDRLKK 370
                +QL R+ Q++ +   +      R PM PP    + N+ +F   DR ++
Sbjct: 367 VNQNPSQLNRIPQNRYTAIPVNNRDLRRPPMGPPSSHGVENILQFKPIDRFRR 419

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  345 bits (886), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/339 (49%), Positives = 227/339 (66%), Gaps = 22/339 (6%)

Query: 13  FTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSE---TSNPNVISLRKI 69
           F+ P K+IFDS+GT  F  S+A  R++  + KY  ++  + IP     +SN  +  + KI
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74

Query: 70  LHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLP---EKYYPS--IVEL 124
           ++   KLV+ETP LPGPRRYGNL+CR WH ++++ I E  +++L     K+      +EL
Sbjct: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLEL 134

Query: 125 AYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKL 184
            YY   + GS  RLDYGTGHELSF + I ALDML +  +     D+L++FNEYY L+RKL
Sbjct: 135 IYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTDILFIFNEYYRLIRKL 193

Query: 185 ITKYSLEPAGSHGVWGLDDHFHLIYIFGASQW----ADSKDAEAS---------PREIQS 231
           I  Y+LEPAGSHGVWGLDDHFHLIYIFG+SQW    AD  +   S         P +I +
Sbjct: 194 ILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILN 253

Query: 232 KMIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEV 291
           K +++++  SNFYCQ+I FI  VK+GPF EHSP+L+DI+++V  W KV+ GLLKMY  EV
Sbjct: 254 KNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEV 313

Query: 292 LNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDT 330
           LNKFPVVQHFWFGT  +PW ++     LPTYE++ + + 
Sbjct: 314 LNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNN 352

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  339 bits (869), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 240/388 (61%), Gaps = 24/388 (6%)

Query: 3   QDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPN 62
           Q  +DV    F +P KRIFDS+ T  FQ SVA+ R++ H+ KY+ M+ G    S   + +
Sbjct: 13  QLPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDT--SGGISAS 70

Query: 63  VISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIV 122
           V  + +IL     LVDETP L GPRRYGNLACRDWHDK++  +     +        + +
Sbjct: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACI 130

Query: 123 ELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVR 182
           E  YYL N+FGS+ RLDYGTGHELSF + + ALDM+     G    +L  L++ YY LVR
Sbjct: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMS-QPRGITPVELSRLWDRYYRLVR 189

Query: 183 KLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVD-EYAGS 241
           +LI  Y+LEPAGSHGVWGLDDHFHL Y++GASQ+A++      PR++ S +I   + A +
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNP-VGVQPRDVLSGVIPGRDDAPA 248

Query: 242 NFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHF 301
           NF  +AI F+  VK GPF E+SPML DI   V +W K+QRGL +MY AEVLNKFPVVQHF
Sbjct: 249 NFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHF 308

Query: 302 WFGTALFPWTSTDGGDVLPTYEVSQETDTQ------------AQLPRM-TQHQPSMTKLR 348
           WFGTA FPWTS   G  LP YE S +T+ +              LP + T    S+   R
Sbjct: 309 WFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSRR 368

Query: 349 HPMNPPHLRNVSRFIAH------DRLKK 370
             M PP  R V++FI H      DRL++
Sbjct: 369 PAMGPPAGRQVNKFIQHTTASHRDRLRR 396

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/399 (44%), Positives = 240/399 (60%), Gaps = 39/399 (9%)

Query: 2   EQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNP 61
           +Q  +D   + F+ P KRIFDS+ T  FQ SVA  RLK   +KY+ ++ G  +P  + N 
Sbjct: 6   DQPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPV-SRNI 64

Query: 62  NVISLRKILHFF---SKLVDETPALPGPRRYGNLACRDWHDKMEE----QIREQLQEFLP 114
            +   R IL      S+ +DETP L  PRR+GNL+CR WHDK+      +++  +  F  
Sbjct: 65  TMTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFST 124

Query: 115 EKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLF 174
            +      EL YYL N+FGS+ RLDYGTGHELSF + I  +DM+ +      A D L ++
Sbjct: 125 IENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIW 183

Query: 175 NEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMI 234
             YY+L RKLI  Y+LEPAGSHGVWGLDDHFHL YIFG+SQ   S  +  +P++I  K +
Sbjct: 184 QSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKKDV 242

Query: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V E+  +N YCQAI+FIF VK GPF+EHSP+LYDIS++V +WSKV +GLLKMY  EVLNK
Sbjct: 243 VAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNK 302

Query: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQ--------------ETDTQAQLP----- 335
           FPVVQHFWFG   FPW   + G  LP +E S+               T+T A        
Sbjct: 303 FPVVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSS 362

Query: 336 ---------RMTQHQ-PSMTKLRHPMNPPHLRNVSRFIA 364
                    +M+ H+ PS++K    M PP    ++ +++
Sbjct: 363 KSPIMNPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLS 401

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  174 bits (442), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 148/259 (57%), Gaps = 11/259 (4%)

Query: 52  QRIPSETSNPNVISLRKILHFFSKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQL 109
           Q I S+  N     L  +L   +K+VD+ P +   G  R+G +  RD++D++ E  +E +
Sbjct: 46  QPISSQIEN-----LCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELI 100

Query: 110 QEFLPEKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKD 169
                E     + ELA Y   ++G R+R+DYG+GHEL+F   +  L    +     +   
Sbjct: 101 SSLSSELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNL 160

Query: 170 LLYLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREI 229
           +L +F +Y  ++R L TKY LEPAGSHGVWGLDD+  L ++FGA Q    K     P+ I
Sbjct: 161 VLKVFIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPKSI 218

Query: 230 QSKMIVDEYAGSNFYCQAISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYF 288
            +  IV+ +     Y + ++FI KVK +     HSPML DIS  V TWSKV  G++KMY 
Sbjct: 219 HNPEIVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYK 277

Query: 289 AEVLNKFPVVQHFWFGTAL 307
           AEVL K P++QHF+F T L
Sbjct: 278 AEVLGKLPIMQHFFFSTFL 296

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 164/298 (55%), Gaps = 9/298 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS--ETSNPNVISLRKILHFF 73
           P KR+  ++   ++  S  M  L + +      + G+   +  E  + ++    ++L   
Sbjct: 3   PEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDMEPTMQLLKKV 62

Query: 74  SKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNA 131
           + L+D+ P +      R+G +  RD++D ++    E +    P      + ELA YL  +
Sbjct: 63  NDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAVYLYES 122

Query: 132 FGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYSL 190
           +G++ R+DYG+GHEL+F   I  L +  ++     A DL L +F EY  ++R L TKY L
Sbjct: 123 WGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q A        P+ I ++ +V+ +     Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAHQLATH--PHLRPKSIHNEEVVEMFMDKYIYFGCIAF 240

Query: 251 IFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           I  VKS      HSPML DIS  V TW+KV  G++KMY AEVL+K P++QHF+FG  L
Sbjct: 241 INSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFGNIL 297

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  169 bits (429), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 165/302 (54%), Gaps = 17/302 (5%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETS------NPNVISLRKI 69
           P KR+       ++++S      KK L  ++  L+      E S      +P + +L +I
Sbjct: 3   PEKRLLTEDDMKLWEASST----KKELLDFISTLAEAVKGCENSQISEPISPAINTLEQI 58

Query: 70  LHFFSKLVDETPALPGPR--RYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYY 127
           L    K++D+ P L      R+G    R ++D++ E   + + E  P   +  + +L  Y
Sbjct: 59  LVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIY 118

Query: 128 LGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLIT 186
           L  ++G+++R+DYG+GHEL+F   +  L    +      A+++ L +F +Y  ++R L T
Sbjct: 119 LDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLET 178

Query: 187 KYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQ 246
           KY LEPAGSHGVWGLDD+  L ++FGA Q A  K     P  I ++ +V+ +A    Y  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHK--HLKPLSIHNEELVEMFAKKYLYFG 236

Query: 247 AISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGT 305
            I+FI  VK +     HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+F  
Sbjct: 237 CIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYFSE 295

Query: 306 AL 307
            L
Sbjct: 296 FL 297

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 161/299 (53%), Gaps = 11/299 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHFFSK 75
           P KR+       +++ S       K +      + G    S+   P   S+  +++  S+
Sbjct: 3   PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHE-NSQYKEPISESINSMMNLLSQ 61

Query: 76  LVDETPALP-----GPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGN 130
           + D T   P        R+G +  RD++D++    R+ L+   P      + +L+ YL  
Sbjct: 62  IKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDE 121

Query: 131 AFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYS 189
           ++G++ R+DYG+GHEL+F  ++  L   GI+     + +L L +F EY  ++R L TKY 
Sbjct: 122 SWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYW 181

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q    K     P  I +  +V+ +A    Y   I+
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNNELVEMFAHRYLYFGCIA 239

Query: 250 FIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           FI KVKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 240 FINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFL 297

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 166/302 (54%), Gaps = 17/302 (5%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETS------NPNVISLRKI 69
           P KRI       V+++S      +K L  ++  L+      E S      +P++ SL  +
Sbjct: 3   PEKRILTENDMEVWKNSAT----RKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSL 58

Query: 70  LHFFSKLVDETPALPGPR--RYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYY 127
           L   +KLVD+ P +   +  R+G +  RD++D++ E+    ++          + +L+ Y
Sbjct: 59  LDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIY 118

Query: 128 LGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLIT 186
           L  ++G++ R+DYG+GHEL+F   +  L   G++     A +L L +F +Y +++R L T
Sbjct: 119 LDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLET 178

Query: 187 KYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQ 246
           KY LEPAGSHGVWGLDD+  L ++FGA Q    K     P  I ++ +V+ +     Y  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHK--HLKPMSIHNEELVELFKDKFLYFG 236

Query: 247 AISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGT 305
            ISFI  VK +     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F  
Sbjct: 237 CISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYFSE 295

Query: 306 AL 307
            L
Sbjct: 296 FL 297

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  167 bits (423), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 163/299 (54%), Gaps = 11/299 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVA---MIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHF 72
           P KRI   +   +++ S     ++   + L K +      ++ SE  + +V S   +L  
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQV-SEPVSDSVQSTIAVLTE 61

Query: 73  FSKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGN 130
             KL+   P +      R+G +  RD++D + E+  + L    P      I +L+ YL  
Sbjct: 62  IDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQE 121

Query: 131 AFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYS 189
           ++G++ R+DYG+GHEL+F   +  L    I+     A++L L LF EY  ++R++ T Y 
Sbjct: 122 SWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYW 181

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q A  K     P+ I ++ +V+ +A    Y   I+
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLAPHK--HLKPKSIHNEELVEMFADKYLYFGCIA 239

Query: 250 FIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           FI  VK S     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F   L
Sbjct: 240 FINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYFSEFL 297

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 148/255 (58%), Gaps = 7/255 (2%)

Query: 57  ETSNPNVISLRKILHFFSKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFLP 114
           E  +  +IS+  +L     ++ + P +      R+G +  RD++D++ +  R+ L+   P
Sbjct: 46  EPISEQIISMMNLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFP 105

Query: 115 EKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYL 173
                 + +L+ YL  ++G++ R+DYG+GHEL+F  ++  L   GI+     + +L L +
Sbjct: 106 HLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKV 165

Query: 174 FNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKM 233
           F EY  ++R L TKY LEPAGSHGVWGLDD+  L ++FGA Q    K     P  I +  
Sbjct: 166 FIEYLQIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNNE 223

Query: 234 IVDEYAGSNFYCQAISFIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVL 292
           +V+ +A    Y   I+FI KVKS      HSPML DIS  V TWSKV  G++KMY  EVL
Sbjct: 224 LVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVL 282

Query: 293 NKFPVVQHFWFGTAL 307
           +K P++QHF+F   L
Sbjct: 283 SKLPIMQHFYFCEFL 297

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  165 bits (418), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/298 (34%), Positives = 160/298 (53%), Gaps = 9/298 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIP--SETSNPNVISLRKILHFF 73
           P KR+  S    +++ S       K +      + G       E  +  +  +  +L + 
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 74  SKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNA 131
             ++ + P +      R+G +  RD++D++ +  R+ L+   P      + +L+ YL  +
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYSL 190
           +G++ R+DYG+GHEL+F  ++  L   G++     + +L L +F EY  ++R L T+Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETRYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K     P  I +  +V+ +A    Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTSHK--HLKPISIHNNELVEMFANRYLYFGCIDF 240

Query: 251 IFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           I KVKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYFSDFL 297

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  165 bits (418), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 163/301 (54%), Gaps = 15/301 (4%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSG--QRIPSETSNPNVISLRKILHFF 73
           P KR+       ++  S     L + + K    + G   +   E   P + S   +L   
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 74  SKLVDETPALPGPR--RYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNA 131
           + ++D+ P +   +  R+G +  RD++D++  Q +  +    P      + +L  YL  +
Sbjct: 63  NNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDES 122

Query: 132 FGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKD----LLYLFNEYYSLVRKLITK 187
           +G+++R+DYG+GHEL+F  ++  L    I+    ++KD    +L +F EY  ++R L TK
Sbjct: 123 WGNKQRIDYGSGHELNFLCLLYGLHKYKIFD---ESKDFTNMVLKIFIEYLRVMRILETK 179

Query: 188 YSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQA 247
           Y LEPAGSHGVWGLDD+  L ++FGA Q A  K     P  I ++ +V+ +     Y   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHK--HLKPLSIHNEELVEMFQDKYLYFSC 237

Query: 248 ISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTA 306
           ++FI  VK S     HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+FG  
Sbjct: 238 VAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFGEF 296

Query: 307 L 307
           L
Sbjct: 297 L 297

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 143/255 (56%), Gaps = 6/255 (2%)

Query: 56  SETSNPNVISLRKILHFFSKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFL 113
           +E  +P + +L  +L     +    P L      R+G +  RD+H +++ +    + +  
Sbjct: 53  AEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVD 112

Query: 114 PEKYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYL 173
           P        ELA YLGNA+G  +R+DYG+GHEL+F   +  L   G+         +L +
Sbjct: 113 PSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRV 172

Query: 174 FNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKM 233
           F +Y  ++R L TKY LEPAGSHGVWGLDD+  L ++FGA Q A  K  +  P+ I +  
Sbjct: 173 FVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLK--PKSIHNPE 230

Query: 234 IVDEYAGSNFYCQAISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVL 292
           +V+ +     Y   I+FI +VK +     HSPML DIS  V +W+KV  G++KMY AEVL
Sbjct: 231 VVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVL 289

Query: 293 NKFPVVQHFWFGTAL 307
            K P++QHF+F   L
Sbjct: 290 GKLPIMQHFFFSRFL 304

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 104/299 (34%), Positives = 160/299 (53%), Gaps = 11/299 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHFFSK 75
           P KR+  +    +++ S       K +      + G    S+   P    + ++L   S+
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHE-NSQYKEPVSEQITRMLSLLSR 61

Query: 76  LVDETPALP-----GPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGN 130
           + D     P        R+G +  RD++D++ +  R+ L+          + +L+ YL  
Sbjct: 62  VRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYLDE 121

Query: 131 AFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYS 189
           ++G++ R+DYG+GHEL+F  ++  L   G++     + +L L +F EY  ++R L TKY 
Sbjct: 122 SWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETKYW 181

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q    K     P  I +  +V+ ++    Y   I+
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNSELVEMFSDRYLYFGCIA 239

Query: 250 FIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           FI KVKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 240 FINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYFSEFL 297

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  162 bits (409), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 106/298 (35%), Positives = 156/298 (52%), Gaps = 9/298 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS--ETSNPNVISLRKILHFF 73
           P KR+       ++  S     L   + K    + G+      E  + ++  L  +L   
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 74  SKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNA 131
           +K+V   P +      R+G +  RD++D +  +  E +     +   P + ELA Y   +
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAAYFRKS 122

Query: 132 FGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYSL 190
           +G+R R+DYG+GHEL+F   +  L+    +     A ++ L +F +Y  ++R L TKY L
Sbjct: 123 WGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q A  K     P+ I +K  V+ +     Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLATHK--HLKPKSIHNKEFVEMFEKRYLYFGCIGF 240

Query: 251 IFKVKSG-PFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           I  VK+      HSPML DIS  V TWSKV  G++KMY AEVL K P++QHF+FG  L
Sbjct: 241 INSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFGDFL 297

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 156/296 (52%), Gaps = 11/296 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSET---SNPNVISLRKILHF 72
           P KR+  +    ++  S     L   L +    + G+     T   S P V S+ K+LH 
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQP-VESMMKLLHK 61

Query: 73  FSKLVDETPALPGPR--RYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGN 130
              ++ + P +      R+G +  RD++D +  Q +  L+E  P      I +L  Y+  
Sbjct: 62  VQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYVDE 121

Query: 131 AFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYS 189
           ++G+++R+DYG+GHEL+F   I  L    I+     A +L L +F +Y  L+R L  +Y 
Sbjct: 122 SWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQYW 181

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q +  K     P  I +  +++ +A    Y   I 
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAYQLSTHK--HLKPSSIHNDDLIEMFADKYLYFGCIE 239

Query: 250 FIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
           FI  VK +     HSPML DIS  V  WSKV  G+ KMY AEV+ K P++QHF+F 
Sbjct: 240 FINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFN 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  159 bits (402), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 144/253 (56%), Gaps = 7/253 (2%)

Query: 59  SNPNVISLRKILHFFSKLVDETPALPGPR--RYGNLACRDWHDKMEEQIREQLQEFLPEK 116
           +  ++ S  ++L   + L ++ P        R+G +  R ++D ++ + +  +Q      
Sbjct: 48  TGSSIESCCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDAL 107

Query: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFN 175
                 EL+ Y   ++G R R+DYG+GHEL+F   +  L   G++      +++ L LF 
Sbjct: 108 DGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFI 167

Query: 176 EYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIV 235
           +Y  ++R L TKY LEPAGSHGVWGLDD+  L ++FGA Q +  K  +  P+ I +  +V
Sbjct: 168 KYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLK--PKSIHNSEVV 225

Query: 236 DEYAGSNFYCQAISFIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           + +     Y   I FI KVK+      HSPML DIS  V TW+KV  G++KMY AEVLNK
Sbjct: 226 EMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNK 284

Query: 295 FPVVQHFWFGTAL 307
            P++QHF+FG+ L
Sbjct: 285 LPIMQHFFFGSFL 297

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  155 bits (391), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 128/222 (57%), Gaps = 5/222 (2%)

Query: 88  RYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNAFGSRERLDYGTGHELS 147
           R+G +  R ++D +  + ++ + +   +       EL  Y   ++G RER+DYG+GHEL+
Sbjct: 79  RFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFVESWGDRERIDYGSGHELN 138

Query: 148 FFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFH 206
           F   +  L   G++      ++L L +F  Y  L+R L T Y LEPAGSHGVWGLDD+  
Sbjct: 139 FICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLETTYWLEPAGSHGVWGLDDYHF 198

Query: 207 LIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAISFIFKVK-SGPFSEHSPM 265
           L ++FGASQ A  K     P+ I +  +VD +A    Y   I FI +VK +     HSPM
Sbjct: 199 LPFLFGASQLAPHK--HLKPKSIHNNELVDMFASRYLYFGCIDFINRVKTTASLRWHSPM 256

Query: 266 LYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           L DIS    +WSKV  G++KMY  EVL K P++QHF FG+ L
Sbjct: 257 LDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGSFL 297

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  154 bits (388), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 157/304 (51%), Gaps = 17/304 (5%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQR-----IPSETSNPNVISLRKIL 70
           P KR+   R   +++SS     L   + +    + G+      +P   S   V +L  +L
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISAS---VEALMGLL 62

Query: 71  HFFSKLVDETPALPG---PRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYY 127
                +++  P         R+G +  RD++D++  +    +    P+     + +L  Y
Sbjct: 63  QQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTY 122

Query: 128 LGNAFGSRERLDYGTGHELSFFSVICALDMLGIW--GSGFQAKDLLYLFNEYYSLVRKLI 185
           L  ++G + R+DYG+GHEL+F   +  L    ++  G   +A  +L  F EY  ++R L 
Sbjct: 123 LEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFIEYLKIMRVLE 182

Query: 186 TKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYC 245
           T+Y LEPAGSHGVWGLDD+  L ++FGA Q +  K     P  I ++ +V+ +A    Y 
Sbjct: 183 TEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK--HLKPLSIHNEEVVELFADKYLYF 240

Query: 246 QAISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
             I FI  VK +     HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+F 
Sbjct: 241 GCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYFS 299

Query: 305 TALF 308
             L 
Sbjct: 300 DFLL 303

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  152 bits (385), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 156/298 (52%), Gaps = 10/298 (3%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNP---NVISLRKILHF 72
           P KR+       ++Q+      L K L +    + G    S+ S P   ++ S+  ++  
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLE-NSQYSQPIGGSIQSVEALIEC 62

Query: 73  FSKLVDETPA-LPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGNA 131
             + ++  P    GP R+G    RD +D +  +    ++E         + +L+ Y   +
Sbjct: 63  VDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNES 122

Query: 132 FGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKLITKYSL 190
           +G + R+DYG+GHEL+F   +  L   G++      ++L L +F +Y   +R + T Y L
Sbjct: 123 WGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGASQ +  +     P+ I +  +V+ ++    Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGASQLSTHR--HLKPKSIHNPEVVEMFSEKYLYFGCIDF 240

Query: 251 IFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTAL 307
           I  VK +     HSPML DIS  V  W+KV +G++KMY AEVL K P++QHF+F   L
Sbjct: 241 INSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYFSEFL 297

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  152 bits (385), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 156/301 (51%), Gaps = 16/301 (5%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLS---GQRIPSETSNP---NVISLRKI 69
           P KR+       ++ SS    + KK L  ++  L+     R  ++   P    V S   +
Sbjct: 5   PQKRLLTKDDMEIWDSS----QTKKELINFITDLAEAVKDRDNTQFKEPISAEVSSTLAL 60

Query: 70  LHFFSKLVDETPALPGP-RRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYL 128
           L     +VDE P L     R+G    R ++  ++      L +         I +L+ Y 
Sbjct: 61  LDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLSIYF 120

Query: 129 GNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYL-FNEYYSLVRKLITK 187
             ++G+ ER+DYG+GHEL+F   +  L    ++     + +++ L F +Y  ++R+L T 
Sbjct: 121 YESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRLETL 180

Query: 188 YSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQA 247
           Y LEPAGSHGVWGLDD+  L ++FGA Q ++ K     P+ I +  IVD +     Y   
Sbjct: 181 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHK--HLKPKSIHNDEIVDMFKDKYLYFGC 238

Query: 248 ISFIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTA 306
           I+FI  VK+      HSPML DIS  V  WSKV  G++KMY AEVL+K PV+QHF+F   
Sbjct: 239 IAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYFSEF 297

Query: 307 L 307
           L
Sbjct: 298 L 298

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 145/265 (54%), Gaps = 13/265 (4%)

Query: 53  RIPSETSNPNVISLRKILHFFSKLVD-----ETPALPGPRRYGNLACRDWHDKMEEQIRE 107
           R  ++ + P   +++++ +  SK+ +     E        R+G +  RD++D + E   E
Sbjct: 38  RENNDYTQPISDNVQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNE 97

Query: 108 QLQEFLPEKYYPS---IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSG 164
            + +       P    + ++  Y  N++G R R+DYG+GHEL+F   +  L    ++   
Sbjct: 98  LISKIFEGIEKPDTGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLE 157

Query: 165 FQAKDL-LYLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAE 223
             + ++ L LF +Y  ++R L  KY LEPAGSHGVWGLDD+  L ++FGA Q +  K   
Sbjct: 158 NDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK--H 215

Query: 224 ASPREIQSKMIVDEYAGSNFYCQAISFIFKVKS-GPFSEHSPMLYDISRSVPTWSKVQRG 282
             P+ I +  +V+ +     Y   I+FI KVK+      HSPML DIS  V  WSKV  G
Sbjct: 216 LKPKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEG 274

Query: 283 LLKMYFAEVLNKFPVVQHFWFGTAL 307
           ++KMY AEVL K P++QHF+FG  L
Sbjct: 275 MVKMYKAEVLQKLPIMQHFYFGYFL 299

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  151 bits (381), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 160/304 (52%), Gaps = 19/304 (6%)

Query: 16  PVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHFFSK 75
           P KR+  S+   ++ +S    + K+ L  ++  L+   +  + S  ++     I + FS 
Sbjct: 2   PEKRLLSSQDLTIWINS----KTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFSL 57

Query: 76  LVD----------ETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELA 125
           L D          E+       R+G +  + ++D + +   + ++          I EL+
Sbjct: 58  LQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELS 117

Query: 126 YYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL-LYLFNEYYSLVRKL 184
            YL  ++G+R+R+DYG+GHEL+F   +  L    I+     + +L L +F EY +++R +
Sbjct: 118 IYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRII 177

Query: 185 ITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFY 244
            TKY LEPAGSHGVWGLDD+  L ++FGA Q   SK     P  I ++ +V+ +     Y
Sbjct: 178 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--SKHKHLKPISIHNEEMVEMFKDKYMY 235

Query: 245 CQAISFIFKVK-SGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWF 303
              I FI  +K +     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F
Sbjct: 236 FGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFYF 294

Query: 304 GTAL 307
              L
Sbjct: 295 SDFL 298

>Ecym_3563 Chr3 complement(1069119..1070270) [1152 bp, 383 aa]
          {ON} similar to Ashbya gossypii AFR366W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 7  DVGTTTFTEPVKRIFD-----SRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNP 61
          D  + TFT P K + +     S G  V+Q  V  ++L++H+ K  GM +G    S T + 
Sbjct: 18 DFRSDTFTIPTKEMIEVAFTASVGDAVYQEDVDTMKLEQHVAKLFGMEAGLFCVSGTLS- 76

Query: 62 NVISLRKILH 71
          N I+LR  LH
Sbjct: 77 NQIALRTHLH 86

>Skud_11.238 Chr11 (433135..435012) [1878 bp, 625 aa] {ON} YKR008W
           (REAL)
          Length = 625

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 13/120 (10%)

Query: 67  RKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAY 126
            K+LH+F+KLVD T  +      G+L+ ++  DK+  ++ E   E + +   P   E+ +
Sbjct: 172 EKLLHYFNKLVDGTEKIINQALLGSLSPKNLDDKV--KLSEPFMELVDKDELPDYYEIVH 229

Query: 127 YLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLIT 186
                   ++ LD G   ++  F     +DML I+ +        ++FN+  +L+ K  T
Sbjct: 230 NPMALSIVKQNLDIGQYSKIYDF----IIDMLLIFQNA-------HIFNDPSALIYKDAT 278

>NCAS0D00150 Chr4 complement(11891..13321) [1431 bp, 476 aa] {ON}
           Anc_2.20 YDL238C
          Length = 476

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 19/118 (16%)

Query: 23  SRGTHVFQSSVAM---------IRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHFF 73
           SR  H+    +AM         ++L      YL  + G R+ S  S  ++  + K   F 
Sbjct: 350 SRSAHLVSRHLAMKIKGSNKEHVKLSVPECLYLATVGGARVLSMDSEISLFEVGK--QFD 407

Query: 74  SKLVD-ETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYLGN 130
           S+L+D  +P  P       +   DW  +M  Q  + L + LP+ +YP ++   ++ G+
Sbjct: 408 SQLIDLNSPNSP-------IDVFDWQYQMNNQAEDTLYKKLPQPHYPDLLAKWFFNGD 458

>SAKL0B09306g Chr2 complement(788332..790824) [2493 bp, 830 aa] {ON}
           similar to uniprot|Q06096 Saccharomyces cerevisiae
           YPR105C COG4 component of oligomeric Golgi complex
          Length = 830

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 15/103 (14%)

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGA--------SQWADSKDAEASPREIQSKMIVDEYAGS 241
           LE +    V GL   F +  + G         S++     AE S R+I + ++     GS
Sbjct: 201 LEASKRQDVQGLTMFFQMFPLIGKPDLGLDSYSKYVCDIIAEQS-RKIMTTVV---NRGS 256

Query: 242 NFYCQAISFIFKVKSGPFSEHSPML---YDISRSVPTWSKVQR 281
           NFY QA+  +FK+ S   ++HS ++   Y     V   +KV++
Sbjct: 257 NFYAQALLHLFKIVSTIINDHSKIIAKYYGKKHMVHIMTKVEK 299

>KLLA0E13685g Chr5 (1209218..1211224) [2007 bp, 668 aa] {ON} highly
           similar to uniprot|P47077 Saccharomyces cerevisiae
           YJL010C Protein required for cell viability
          Length = 668

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 71/161 (44%), Gaps = 20/161 (12%)

Query: 2   EQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS----E 57
           + D+ D    +F E +  + D+ G+H  Q+ +A  R+K ++ +   +    RIP     +
Sbjct: 328 DSDEKDPKEESFVEYL--LSDAVGSHFLQNVIASTRIK-YVERLYRLYMKDRIPKLAKRD 384

Query: 58  TSNPNVI-SLRKILH------FFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQ 110
           T+   V+ SL K+L+         +LV +   L            D   + +  +R+++ 
Sbjct: 385 TTAAFVLQSLLKVLNSKEVKEIMDELVPDLSVLLNSNMDFGTEIIDASIRHDNYLRDEII 444

Query: 111 EFLPEKYYP------SIVELAYYLGNAFGSRERLDYGTGHE 145
           E L +KYYP      +I+E    L ++     R D+ T  E
Sbjct: 445 EQLMKKYYPRESSDKNILESCLQLSSSTLGNTRDDWPTAEE 485

>YER083C Chr5 complement(326174..327031) [858 bp, 285 aa] {ON}
           GET2Subunit of the GET complex; involved in insertion of
           proteins into the ER membrane; required for the
           retrieval of HDEL proteins from the Golgi to the ER in
           an ERD2 dependent fashion and for meiotic nuclear
           division
          Length = 285

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 47/107 (43%), Gaps = 3/107 (2%)

Query: 3   QDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVA-MIRLKKHLHKYLGMLSGQRIPSETSNP 61
           +  +D  +   T P   +  +       S+VA  + L K L    G  +G+  P ++S P
Sbjct: 44  ESPLDAPSAAKTTPPASVHSATPDIKEDSNVAPQLDLLKQLAAMQGQGTGKSTPQDSSTP 103

Query: 62  NVISLRKILHFFSKLVDETPAL--PGPRRYGNLACRDWHDKMEEQIR 106
           +++SL   ++      + TP+     P    N A  D+HD +  +++
Sbjct: 104 DLLSLLSSMNTGMPSAEGTPSFGQAAPAAPINQAALDYHDYLLNRLK 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,188,992
Number of extensions: 1818248
Number of successful extensions: 4450
Number of sequences better than 10.0: 48
Number of HSP's gapped: 4450
Number of HSP's successfully gapped: 48
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)