Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.196495.711ON64164132730.0
KLTH0E00836g5.711ON64164130400.0
SAKL0E15114g5.711ON64962025920.0
KLLA0A00418g5.711ON64259324660.0
TDEL0B020905.711ON64359324420.0
CAGL0H06699g5.711ON65062023800.0
ZYRO0B16522g5.711ON64360923150.0
KAFR0D021705.711ON66061923120.0
TPHA0E001505.711ON64661523010.0
Ecym_40105.711ON64461722970.0
Kpol_1043.775.711ON65760522870.0
AFR295W5.711ON63160922650.0
NCAS0G001805.711ON65460722490.0
TBLA0E017505.711ON66560122040.0
Skud_9.135.711ON64961921770.0
NDAI0F002105.711ON65360021730.0
YIL155C (GUT2)5.711ON64960321610.0
Smik_9.145.711ON65260321420.0
Suva_9.325.711ON53854020230.0
KNAG0L021905.711ON64559419880.0
Suva_10.5264.276ON114446790.70
TBLA0A106804.380ON26186761.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19649
         (641 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...  1265   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...  1175   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...  1003   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   954   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   945   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   921   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   896   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   895   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   890   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   889   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   885   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   877   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   870   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   853   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   843   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   841   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   837   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   829   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   783   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   770   0.0  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    35   0.70 
TBLA0A10680 Chr1 (2640996..2641781) [786 bp, 261 aa] {ON} Anc_4....    34   1.1  

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/641 (95%), Positives = 612/641 (95%)

Query: 1   MFARTLSKRVXXXXXXXXXXXXXXMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMA 60
           MFARTLSKRV              MVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMA
Sbjct: 1   MFARTLSKRVLTTATLAAGGYAAYMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMA 60

Query: 61  KTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120
           KTEQFDVLII               RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA
Sbjct: 61  KTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120

Query: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180
           FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG
Sbjct: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180

Query: 181 SQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240
           SQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN
Sbjct: 181 SQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240

Query: 241 YMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPR 300
           YMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPR
Sbjct: 241 YMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPR 300

Query: 301 NDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFF 360
           NDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFF
Sbjct: 301 NDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFF 360

Query: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPL 420
           LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPL
Sbjct: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPL 420

Query: 421 IRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF 480
           IRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF
Sbjct: 421 IRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF 480

Query: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEK 540
           QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEK
Sbjct: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEK 540

Query: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDA 600
           NQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDA
Sbjct: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDA 600

Query: 601 RQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
           RQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL
Sbjct: 601 RQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/641 (86%), Positives = 594/641 (92%)

Query: 1   MFARTLSKRVXXXXXXXXXXXXXXMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMA 60
           MFART+S+RV               +Q D+ A +EV V+ PLKAEAPA+P+RSELL+KMA
Sbjct: 1   MFARTVSRRVLAGATLAAGGYAAFALQRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA 60

Query: 61  KTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120
           KT+QFDVL+I               RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA
Sbjct: 61  KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120

Query: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180
           FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG
Sbjct: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180

Query: 181 SQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240
           SQNLKSSYMM+A+RASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN
Sbjct: 181 SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240

Query: 241 YMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPR 300
           YMEVT+L+KN+++GR+EGAM RDRETG+EFRI AKVVVNSTGPFSDR+LQMD AKDG PR
Sbjct: 241 YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR 300

Query: 301 NDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFF 360
           NDLVQFANEGHDSIGSR+AVSNPRMVVPSAGVHIVLPAFYCPK+IGLLDAKTSDGRVMFF
Sbjct: 301 NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF 360

Query: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPL 420
           LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKR DVLSAWAGIRPL
Sbjct: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL 420

Query: 421 IRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF 480
           +RDPRT+KEGDDVSSTQGLVRNHFL+TSDNGLVTIAGGKWTTYREMAEETIDEVVKQG F
Sbjct: 421 VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF 480

Query: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEK 540
           QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMF+RDEK
Sbjct: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEK 540

Query: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDA 600
           NQLPVTFGGRENVTVYKNVNFDSFRYPFTI ELKYS++YEYTRTALDFLMRRTRFGFLDA
Sbjct: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDA 600

Query: 601 RQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
           +QAL AV GTVS+MGDELGW +++R +E QQAS+FIKTFG+
Sbjct: 601 KQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/620 (76%), Positives = 540/620 (87%), Gaps = 7/620 (1%)

Query: 27  QNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXR 86
           Q   +  ++V VT P++     LPTR +LL K++KT QFDVLII               R
Sbjct: 32  QQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATR 91

Query: 87  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTA 146
           GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNER HML TA
Sbjct: 92  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTA 151

Query: 147 PHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASI 206
           PHLCK+LPIMIPVYNYWQ PYFYVGCKMYDLFAGSQNLKSSYM++A RA+EVAPMLDAS 
Sbjct: 152 PHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASK 211

Query: 207 LKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRET 266
           LKAGLVYHDGSFNDSRMNA LAVTA+E+GATVLNYMEV QL+KN+Q+G++EGA+ +DRET
Sbjct: 212 LKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRET 271

Query: 267 GEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMV 326
           GE FRIKAKVVVN+TGPFSDR+LQMD    G P + L+Q +N  + +I S++AV+NP+MV
Sbjct: 272 GETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNI-NATISSKVAVANPQMV 330

Query: 327 VPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTAT 386
           VPSAGVHIVLP+FYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTAT
Sbjct: 331 VPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 390

Query: 387 EADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDD-----VSSTQGLVR 441
           EADIQDILKELQHYIKFPVKR DVLSAWAGIRPL++DPR  + G++      SSTQ LVR
Sbjct: 391 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRK-RIGENPHRVAASSTQELVR 449

Query: 442 NHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPN 501
           +HFL+TSDN LVTIAGGKWTTYREM+EETI+EVVK GKF AKPCIT+K+KLAGAE +DPN
Sbjct: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509

Query: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNF 561
             AMLAQEYHLSSKMAE+LANNYGTR+P+ICE+FK D+KN+LP+ FGG+ENVTVY NV+F
Sbjct: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569

Query: 562 DSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWS 621
           DSFRYPFTIGELKYS+  EYTRTALDFLMRRTR+ FLDA+QAL AVDGTV VMGDEL W 
Sbjct: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629

Query: 622 DDRRQAERQQASEFIKTFGL 641
            +RRQ ER++A+EFIKTFG+
Sbjct: 630 SNRRQEEREKATEFIKTFGV 649

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/593 (74%), Positives = 516/593 (87%), Gaps = 3/593 (0%)

Query: 49  LPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTK 108
           LP+R+ LL +++KT++FDVLII               RGLNVALVEMNDFASGTSSKSTK
Sbjct: 53  LPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTK 112

Query: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168
           MAHGGVRYLEKAFWELSKAQLDLVIEALNER HMLNTAPHLCK+LPIMIPVYNYWQVPYF
Sbjct: 113 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYF 172

Query: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228
           YVG KMYDLFAGSQNLKSSY++S  RASEVAPMLDAS LKAGLVYHDGSFNDSRMN++LA
Sbjct: 173 YVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLA 232

Query: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288
           +TAIE+GATVLNY+++ QLVKN ++G++EGA+  DRETG+E++IKAKVVVN+TGP+SDRL
Sbjct: 233 ITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRL 292

Query: 289 LQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLL 348
           LQMD +  G P + ++Q  NE + ++ ++IAV NP+MVVPSAGVHIVLP+FYCPKEIGLL
Sbjct: 293 LQMDQSPTGLPDDSVLQKINE-NATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351

Query: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRG 408
           DA+TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQDILKELQHYI FPVKR 
Sbjct: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411

Query: 409 DVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAE 468
           DVLSAWAGIRPL++DPR    G    STQ LVR+HFL+TS + LVTI+GGKWTTYREMAE
Sbjct: 412 DVLSAWAGIRPLVKDPRKADSGS--GSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAE 469

Query: 469 ETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRS 528
           ETIDEVVK G+F +KPC+TKK+KL G E W+PN  A+L+Q+YHLSS M+EHLANNYGTR+
Sbjct: 470 ETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRA 529

Query: 529 PIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDF 588
           P+ICE+F  D +N+LPV   G+ENV+V+ +V++DSFRYP+TIGELKYS++YEY R  LDF
Sbjct: 530 PLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDF 589

Query: 589 LMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
           LMRRTR+ FLDA+QAL AV+GTV VMGDELGW   +RQ E QQA+E+IKTFG+
Sbjct: 590 LMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/593 (73%), Positives = 513/593 (86%), Gaps = 5/593 (0%)

Query: 49  LPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTK 108
           LP+R +LL K++KT+QFDVL+I               RGLNVALVEM+DFASGTSSKSTK
Sbjct: 56  LPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKSTK 115

Query: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168
           MAHGGVRYLEKA ++LSKAQLDLVIEALNERGHMLNTAPHLCK+LPIMIPVY YWQ+PYF
Sbjct: 116 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYF 175

Query: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228
           YVGCKMYDLFAGSQNLK+SY+++ ++A+++APMLD + LKAGLVYHDGSFNDSRMN ALA
Sbjct: 176 YVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALA 235

Query: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288
           VTAIE GATVLNYMEV QL+K+ ++G+++GA+V +RETGE+F +KAKV VN+TGP+SD+L
Sbjct: 236 VTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKL 295

Query: 289 LQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLL 348
           LQMD  KDGKP +      N    +I +++AV NP+MVVPSAGVHI+LP+FYCP+E+GLL
Sbjct: 296 LQMDENKDGKP-DPTKPLPNA---TISTKVAVENPKMVVPSAGVHIILPSFYCPREMGLL 351

Query: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRG 408
           D KTSDGRVMFFLPWQGKVLAGTTDIPMKQVP+ PTA E+DIQDIL+ELQHYIKFPVKR 
Sbjct: 352 DVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKRE 411

Query: 409 DVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAE 468
           DVLSAWAGIRPL+ DPR   +G+   STQGLVR+H  +T+DNG+VTIAGGKWTTYREMAE
Sbjct: 412 DVLSAWAGIRPLVIDPRK-SQGNTGGSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMAE 470

Query: 469 ETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRS 528
           ETI+EVVK GKF  KPCIT+K+KL+GAE W+PN  A+LAQ+YHLS  M+ HL+ NYGTR+
Sbjct: 471 ETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLSENYGTRA 530

Query: 529 PIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDF 588
           P+ICEMF+ DE+NQLPVTFGGRENVTVY NVNFDSFRYPFTIGEL YS+ YEYTRTALDF
Sbjct: 531 PLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGELNYSVDYEYTRTALDF 590

Query: 589 LMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
           LMRRTRF FLDARQAL AV+GTV+VMGD+L W   RR+ E +++ EFI+TFG+
Sbjct: 591 LMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/620 (70%), Positives = 508/620 (81%), Gaps = 8/620 (1%)

Query: 27  QNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXR 86
            N+K+  ++V +  P++     LPTR ELL+K+++T QFDVLII               R
Sbjct: 34  NNNKLISNDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATR 93

Query: 87  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTA 146
           GLNVALVE NDFASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLVIEALNER H+LNTA
Sbjct: 94  GLNVALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTA 153

Query: 147 PHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASI 206
           PHLCK+LPI+IPVYNYWQVPYFY GCKMYDLFAGSQNLK SY+MS     EVAPMLD S 
Sbjct: 154 PHLCKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSN 213

Query: 207 LKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRET 266
           LKAGLVYHDGSFND+RMNA LAVTAIE  ATVLNYMEV QLVK D+ G++ GA+V DRET
Sbjct: 214 LKAGLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVK-DKDGKVAGAVVEDRET 272

Query: 267 GEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKP-----RNDLVQFANEGHDSIGSRIAVS 321
           G+ + ++AKVVVN+TGP+SDRLLQMDA  DG P     + + +   N    SI S++AV+
Sbjct: 273 GKTYSVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVT 332

Query: 322 NPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPE 381
            P MVVPSAGVHI+LP+FYCPKE+GLLDAKTSDGRVMFFLPWQGKVLAGTTDIP+KQVPE
Sbjct: 333 KPNMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 392

Query: 382 NPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVR 441
           NPTATEADIQDILKELQ YIKFPVKR DVLSAWAGIRPL+ DPR   + D   STQGLVR
Sbjct: 393 NPTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKAD--GSTQGLVR 450

Query: 442 NHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPN 501
           +HF++TSD+GLVTIAGGKWTTYR MAEETIDEVVK GKF AKPCIT+K+KLAGAE WDPN
Sbjct: 451 SHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPN 510

Query: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNF 561
             A+LAQ+YHLS KM+ +LA NYGTR+P+ICEMF  D +N+LP+    +E   V  +V+F
Sbjct: 511 LPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDF 570

Query: 562 DSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWS 621
           DSFRYP TI ELKY+++YEY RTALDFLMRRTRF FLDA+QAL AV+GTV +MGD LGW 
Sbjct: 571 DSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWD 630

Query: 622 DDRRQAERQQASEFIKTFGL 641
           + RRQ E + ++EFIKTFG+
Sbjct: 631 EQRRQDEIRYSTEFIKTFGV 650

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/609 (68%), Positives = 497/609 (81%), Gaps = 6/609 (0%)

Query: 34  SEVRVTRPLKAEAPA-LPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVAL 92
           +EV V  P+       LP+R +LL  + KT++FDVLII               RGLNVA 
Sbjct: 40  NEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVAC 99

Query: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152
           VE NDFASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLVIEALNERGHML TAPHLCK+
Sbjct: 100 VEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKI 159

Query: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLV 212
           LPIMIPVY+YWQVPYF+ GCK+YD FAG QNL+SSY++S   ASE+APMLD S LKAGLV
Sbjct: 160 LPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLV 219

Query: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRI 272
           YHDGSFNDSRMN+ LA++AIE GATVLNY++VTQL+K+  + ++EGA+V D+ETG+++++
Sbjct: 220 YHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQV 279

Query: 273 KAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGV 332
           KAKV VN+TGP+SD +LQMD  K+G P     Q AN    SI + +AV+ P MVVPSAGV
Sbjct: 280 KAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANV---SIATEVAVNKPNMVVPSAGV 336

Query: 333 HIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 392
           HI+LP++YCPK +GLLD KT+DGRVMFFLPWQGKVLAGTTDIPMK VP+NPTATEADIQD
Sbjct: 337 HIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQD 396

Query: 393 ILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGL 452
           IL+ELQHYIKFPV+R DVLSAWAGIRPL+ DPR  K  D   ST+GLVRNH ++TS+ GL
Sbjct: 397 ILRELQHYIKFPVRREDVLSAWAGIRPLVMDPR--KRKDTGGSTEGLVRNHLIFTSETGL 454

Query: 453 VTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512
           +T+AGGKWTTYREMAE+TIDEVVK+G F  KPCIT+KIKLAG E W PN  A+LAQ Y L
Sbjct: 455 ITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKL 514

Query: 513 SSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGE 572
           S  M++HL+NNYGTR+PIICE+FK DE+NQLPV FGGRENVTV  +VNFDSFRYPFTIGE
Sbjct: 515 SQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGE 574

Query: 573 LKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQA 632
             YS+++EY+R A DFLMRRTR+ FLDA  AL AV+GTV VMGDEL W   RRQ E ++ 
Sbjct: 575 FLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEEC 634

Query: 633 SEFIKTFGL 641
           +EFIKTFG+
Sbjct: 635 TEFIKTFGV 643

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/619 (67%), Positives = 501/619 (80%), Gaps = 17/619 (2%)

Query: 37  RVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMN 96
           ++  PL   +  LPTR++L+ K+ KT QFDVL+I               RGLNVALVE  
Sbjct: 45  KLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKY 104

Query: 97  DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIM 156
           DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER H+LNTAPHLCK+LPIM
Sbjct: 105 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIM 164

Query: 157 IPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDG 216
           IPVYNYWQ+PYFY GCKMYDLFAGSQNLKSSY++S + A++VAPMLD + LKAGLVYHDG
Sbjct: 165 IPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDG 224

Query: 217 SFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKV 276
           +FNDSRMN+ LAVTAIE G+TVLNYMEV QL+K   SG+IEGA+V D ETG+++ IKAKV
Sbjct: 225 TFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKV 284

Query: 277 VVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVL 336
           V+N+TGP+SD +LQMD    G P  D +    + ++ I ++++VSNP+MVVPSAGVHI+L
Sbjct: 285 VINATGPYSDAILQMDQNPTGLP--DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIIL 342

Query: 337 PAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKE 396
           P+FYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKE
Sbjct: 343 PSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKE 402

Query: 397 LQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIA 456
           LQHYI+FPVKR DVLSAWAGIRPL++DPRT+ +  D  STQGLVR+HF++TSD+GLVTIA
Sbjct: 403 LQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD-GSTQGLVRSHFIFTSDHGLVTIA 461

Query: 457 GGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSK 515
           GGKWTTYR MAEET+DE +K GKF   KPCIT+ IKLAG E W+PN  A+LAQ YHLSSK
Sbjct: 462 GGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSK 521

Query: 516 MAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGG----------RENVTVYKNVN---FD 562
           +++HLA+NYGTR+PIICEM+ +D KN+LP+                N  +Y N     F+
Sbjct: 522 LSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFE 581

Query: 563 SFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSD 622
            FRYPFT+GE+KYS+ YEY  TALDFLMRR+RF FLDA++A+ AV+GTV +MGDEL W +
Sbjct: 582 CFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDE 641

Query: 623 DRRQAERQQASEFIKTFGL 641
            RR  E +   ++IKTFG+
Sbjct: 642 SRRHKEIENTIKYIKTFGV 660

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/615 (68%), Positives = 498/615 (80%), Gaps = 9/615 (1%)

Query: 28  NDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRG 87
           N  I ++E  +  P+ +    +PTRSEL+  +  T+QFDVLII               RG
Sbjct: 40  NASIIQNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRG 99

Query: 88  LNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAP 147
           LNVALVE +DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAP
Sbjct: 100 LNVALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAP 159

Query: 148 HLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASIL 207
           HLCK+LPIMIPVY YWQVPYFY G KMYD+FAGSQNLKSSY++S   A E+APMLD S L
Sbjct: 160 HLCKILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKL 219

Query: 208 KAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETG 267
           KAGLVYHDG+FNDSRMN+ LA+TAIE GATVLNYMEV QL+K+  S ++ GA+V D ETG
Sbjct: 220 KAGLVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETG 279

Query: 268 EEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVV 327
           E+ +I AKV+VN+TGP+SD++LQMD  K+GKP     +F      SI +++AV NP MVV
Sbjct: 280 EKIQINAKVIVNATGPYSDKILQMDNNKNGKPD----EFTQSAETSIATKVAVQNPHMVV 335

Query: 328 PSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATE 387
           PSAGVHI+LP+FYCP+E+GLLDA TSDGRVMFFLPWQGKVLAGTTDIPMK VPENPTATE
Sbjct: 336 PSAGVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATE 395

Query: 388 ADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPR-TIKEGDDVSSTQGLVRNHFLY 446
           ADIQDILKELQHYIKFPVKR DVLSAWAGIRPL++DPR T KEG    +TQ LVR+HF++
Sbjct: 396 ADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEG----ATQELVRSHFIF 451

Query: 447 TSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAML 506
           TSD+GLVTIAGGKWTTYREMAEETID VVK GKF  KPC T+K+KLAG E +DPN  A+L
Sbjct: 452 TSDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAALL 511

Query: 507 AQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRY 566
           AQ+YHL SK++EHLANNYGTRSP+IC+MF  D+ N+LP+   G+E   VY  V+FDSFRY
Sbjct: 512 AQKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRY 571

Query: 567 PFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQ 626
           P++I E+KY + +EY RT LDFLMRR+RF FLDA+QAL +V+GTV +MGDEL W ++RR+
Sbjct: 572 PYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRK 631

Query: 627 AERQQASEFIKTFGL 641
            E   + E+IKTFG+
Sbjct: 632 QETDYSIEYIKTFGV 646

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/617 (67%), Positives = 508/617 (82%), Gaps = 10/617 (1%)

Query: 26  VQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXX 85
           + N     +E+     L+  APA P+R++LLEK+ KT+QFDVL+I               
Sbjct: 37  ISNTGFVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAAT 96

Query: 86  RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNT 145
           RGLNVAL+EMND+ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HML+T
Sbjct: 97  RGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHT 156

Query: 146 APHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDAS 205
           APHLCK+LPIMIPVY +WQVPYFYVG KMYD FAG QNLKSSY++SA  AS+VAPMLDAS
Sbjct: 157 APHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDAS 216

Query: 206 ILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRE 265
            LKAGLVYHDGSFNDSRMN+ LAVTAIE GAT+LNYMEV QL+KN ++G++EGA+  DRE
Sbjct: 217 KLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRE 276

Query: 266 TGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRM 325
           TG+++ +KAKVVV++TGPFSDR+LQM+    G P +  +  ANEG  +I +++AV++P+M
Sbjct: 277 TGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGA-TITTKVAVADPKM 335

Query: 326 VVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTA 385
           VVPS+GVHI+LP+FYCPK++GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTA
Sbjct: 336 VVPSSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTA 395

Query: 386 TEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFL 445
           TEADIQDILKELQHYIKFPVKR DV SAWAGIRPL++DPR      D S TQ LVR+HFL
Sbjct: 396 TEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KDNSDTQDLVRSHFL 450

Query: 446 YTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVA 504
           +TSD+GLVTI+GGKWTTYREMA+ETIDEVVK G F  AKPCIT+KIKL G+E WDPN  A
Sbjct: 451 FTSDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPA 510

Query: 505 MLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSF 564
           +L+Q+Y+L   ++E+L+ NYGT++  ICE+F+ D++NQLPV+    +      NV++D+F
Sbjct: 511 ILSQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYDAF 567

Query: 565 RYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDR 624
           RYPFT+GELKY+++ EY R  LDFLMRRTR+ FLDA+QA+ AV GTV +MGDELGW   +
Sbjct: 568 RYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAK 627

Query: 625 RQAERQQASEFIKTFGL 641
           R+ E + A EFIKTFG+
Sbjct: 628 REMETKYAIEFIKTFGV 644

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/605 (70%), Positives = 501/605 (82%), Gaps = 18/605 (2%)

Query: 49  LPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTK 108
           LP+R++LL K+ KT QFDVLII               RGLNVALVE ND+ASGTSSKSTK
Sbjct: 59  LPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSSKSTK 118

Query: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168
           MAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPHLCK+LPIMIPVY YWQVPYF
Sbjct: 119 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYF 178

Query: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228
           YVG KMYDLFAGSQNLKSSY++S   A E+APMLD+S LKAGLVYHDGSFNDSRMNA LA
Sbjct: 179 YVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLA 238

Query: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288
           ++AIE+GATVLNYMEV QLVK++++ ++ GA+V D ETGE ++IKAKV+VN+TGP+SD +
Sbjct: 239 ISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTI 298

Query: 289 LQMDAAKDGKPRNDLVQFANEGH-----------DSIGSRIAVSNPRMVVPSAGVHIVLP 337
           LQMD  K+G P  D+ +   E             +SI   +AV NP MVVPSAGVHI+LP
Sbjct: 299 LQMDNNKNGLP--DMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILP 356

Query: 338 AFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKEL 397
           ++YCP E+GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQDILKEL
Sbjct: 357 SYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKEL 416

Query: 398 QHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAG 457
           QHYIKFPVKR DVLSAWAGIRPL++DPR  K G    +TQ +VR+HF++TSDNGLVTIAG
Sbjct: 417 QHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGG----ATQEVVRSHFIFTSDNGLVTIAG 472

Query: 458 GKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMA 517
           GKWTTYREMAEETIDEVVKQGKF AKPCIT+K+KLAGAE WD N  A+L+Q+Y++S+ MA
Sbjct: 473 GKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMA 532

Query: 518 EHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYK-NVNFDSFRYPFTIGELKYS 576
           EHLANNYGTRSPIICEM K  ++N+LPV   GREN ++   +V +DSFRYP+TI ELKYS
Sbjct: 533 EHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYS 592

Query: 577 MQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFI 636
           M YEYTRTALDFLMRRTR+ FLDA++AL AV+GTV +MGD L W +DRR+ E+  A+++I
Sbjct: 593 MDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYI 652

Query: 637 KTFGL 641
           KTFG+
Sbjct: 653 KTFGV 657

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/609 (68%), Positives = 497/609 (81%), Gaps = 11/609 (1%)

Query: 34  SEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALV 93
           +EV     L+  APA P+RSELLEK+ KT QFDVL+I               RGLNVAL+
Sbjct: 33  NEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALL 92

Query: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153
           EMNDFASGTSSKSTKMAHGGVRYLEKA WELSKAQLDLVIEALNER H+L TAPHLCKVL
Sbjct: 93  EMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVL 152

Query: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVY 213
           PIMIPVY +WQVPYFYVG KMYD FAGSQNLKSSY++SA  A EVAPMLDAS LKAGLVY
Sbjct: 153 PIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVY 212

Query: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIK 273
           HDGSFNDSRMNA +AVTAIE GATVLNYMEV +L+KN + G++EGA+  DRETG+E+ ++
Sbjct: 213 HDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVR 272

Query: 274 AKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVH 333
           AKVVVN+TGPFSDRLLQMD   +G P + ++   N+   +I + +AV+NP+MVVPS+GVH
Sbjct: 273 AKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKD-STIATEVAVANPKMVVPSSGVH 331

Query: 334 IVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 393
           I+LP++YCPK +GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVP NPTATEADIQDI
Sbjct: 332 IILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDI 391

Query: 394 LKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLV 453
           LKELQHYIKFPVKR DV SAWAGIRPL++DPR      ++S TQGLVR+H ++TS NG+V
Sbjct: 392 LKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KNLSDTQGLVRSHLVFTSKNGMV 446

Query: 454 TIAGGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512
           TI+GGKWTTYREMAEET++EVVK GKF  AKPCIT+K+KL+GAE WD N  A+L+ +Y++
Sbjct: 447 TISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNI 506

Query: 513 SSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGE 572
              +AEHL+ NYGT++  +CE+F+ D  N LPV+    +  +    +++++FRYP+TIGE
Sbjct: 507 PPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGE 562

Query: 573 LKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQA 632
           LK++M +EY RT LDFLMRRTR+ FLDA+QAL AVDGTV VMGD LGW   +R AE + A
Sbjct: 563 LKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYA 622

Query: 633 SEFIKTFGL 641
            E+IKTFG+
Sbjct: 623 IEYIKTFGV 631

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/607 (67%), Positives = 491/607 (80%), Gaps = 3/607 (0%)

Query: 38  VTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMND 97
           +  P+     +LPTRS+LL+++ +  QFDVLII               RGL VALVE ND
Sbjct: 48  LVSPVDTLQVSLPTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQND 107

Query: 98  FASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMI 157
           FASGTSSKSTKMAHGGVRYLEKAF++LSK+QLDLVIEALNER H+LNTAPHLCK+LPI+I
Sbjct: 108 FASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILI 167

Query: 158 PVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGS 217
           PVY YWQVPYFY GCK+YDLFAG+QNLK+SY++S   A E+APML+A+ LKA LVYHDGS
Sbjct: 168 PVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGS 227

Query: 218 FNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVV 277
           FNDSR+NA LA+TAIERGATVLNY+EV +L+K+ ++G I G  VRD ETG+   + +KVV
Sbjct: 228 FNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVV 287

Query: 278 VNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLP 337
           VN+TGPFSD++LQMD    G P +  +       + I S+IAV NP MVVPS+GVHI+LP
Sbjct: 288 VNATGPFSDKILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILP 347

Query: 338 AFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKEL 397
           ++YCPK++GLLD +TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EADIQDILKEL
Sbjct: 348 SYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKEL 407

Query: 398 QHYIKFPVKRGDVLSAWAGIRPLIRDPRTIK--EGDDVSSTQGLVRNHFLYTSDNGLVTI 455
           QHYIKFPVKR DVLSAWAGIRPL+RDPR +   E   + STQGLVR+HF++TSDNGLVTI
Sbjct: 408 QHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTI 467

Query: 456 AGGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSS 514
           AGGKWTTYREMAEETIDEVVK G F  AKPCIT+++KLAGAE WDPN  A+L+Q+Y+L S
Sbjct: 468 AGGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPS 527

Query: 515 KMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELK 574
            MA +L++NYGTRSPIICE+F  DE N+LPV   G E   +  N +F++FRYP TIGELK
Sbjct: 528 MMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELK 587

Query: 575 YSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASE 634
           YSM+YEY RTALDFLMRRTRF FLDA++AL AV GTV +MGDE  WS +RRQ E+++  +
Sbjct: 588 YSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQ 647

Query: 635 FIKTFGL 641
           FIK+FG+
Sbjct: 648 FIKSFGV 654

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/601 (65%), Positives = 487/601 (81%), Gaps = 12/601 (1%)

Query: 50  PTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKM 109
           P+RSELL  + KT++FDVLII               RGLNVAL+EMNDFAS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169
           AHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK+LPIMIPVYNYW+VPYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 170 VGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229
            GCKMYD FAGSQNLKS+Y++S   A ++APMLD   LKA LVYHDGSFND+RMN +LAV
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 230 TAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLL 289
           TAIE GATVLNYMEV +L+K+ ++G+I+GA VRDRET +++ + AKVVVNSTGPFSD +L
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 290 QMDAAKDGKP------RNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPK 343
           QMD  K G P        D  +  +  HD++ SRIAV NP+MVVPSAGVHI+LP++YCPK
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNL-SRIAVDNPKMVVPSAGVHIILPSYYCPK 366

Query: 344 EIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 403
           ++G+LD KT+DGRVMFFLPWQ KVLAGTTDIPMK+VPENP ATEADI+DIL ELQHY KF
Sbjct: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426

Query: 404 PVKRGDVLSAWAGIRPLIRDPRTI---KEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKW 460
           PVKR DVLSAWAGIRPL+RDPR +    +GDD  STQGLVR+HF++TS+N LVTIAGGKW
Sbjct: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDD--STQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 461 TTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHL 520
           TTYR MAEETIDE +K G+   KP +TK + L+G E W PN  A+L+Q+YH+ S ++++L
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYL 544

Query: 521 ANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYE 580
           + NYGTR+PIICE+ K+D+KN+LPVT  G+E+  +  NV+F + RYP+T+ E+KY +  E
Sbjct: 545 SENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNE 604

Query: 581 YTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFG 640
           Y+RTALDFL+RRTRFGFLDA++A+ AV+GTVS+MGDEL W  ++R  E +++ E+IKT G
Sbjct: 605 YSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLG 664

Query: 641 L 641
           +
Sbjct: 665 V 665

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/619 (65%), Positives = 481/619 (77%), Gaps = 9/619 (1%)

Query: 30  KIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLN 89
           ++ R++     P    AP   +R +LL+++AKT QFDVLII               RGLN
Sbjct: 33  RLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLN 92

Query: 90  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHL 149
           VALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHL
Sbjct: 93  VALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHL 152

Query: 150 CKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKA 209
           C VLPI+IP+YN WQVPY Y+GCK YD FAGSQNLK SY++S     E APML    LKA
Sbjct: 153 CTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKA 212

Query: 210 GLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEE 269
            LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E 
Sbjct: 213 SLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNEL 272

Query: 270 FRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPS 329
            +I AK VVN+TGP+SD +LQMD    G+P + L    N    S  ++IAV++P+MV+PS
Sbjct: 273 VKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLND--NSLIKSTFNQIAVTDPKMVIPS 330

Query: 330 AGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEAD 389
            GVHIVLP+FYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEAD
Sbjct: 331 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 390

Query: 390 IQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTI-KEGDDVSSTQGLVRNHFLYTS 448
           IQDILKELQHYI+FPVKR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+VR+HFL+TS
Sbjct: 391 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 450

Query: 449 DNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLA 507
           DNGL+TIAGGKWTTYR+MAEET+D+VV+ G+F   KPC T+ IKLAGAE W  N+VA+LA
Sbjct: 451 DNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLA 510

Query: 508 QEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFD 562
           Q YHLSSKM+ +L  NYGTRS IICE FK   +N+LP++   +EN  +Y +     VNFD
Sbjct: 511 QNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD 570

Query: 563 SFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSD 622
           +FRYPFTIGELKYSMQYEY RT LDFL+RRTRF FLDA++AL +   TV VMGDE  WS+
Sbjct: 571 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSE 630

Query: 623 DRRQAERQQASEFIKTFGL 641
            +RQ E ++   FIKTFG+
Sbjct: 631 KKRQWELEKTINFIKTFGV 649

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/600 (66%), Positives = 484/600 (80%), Gaps = 9/600 (1%)

Query: 49  LPTRSELLEKMA-KTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKST 107
           LP+RS+L  ++  K  QFD+LII               RGLNVALVE +DFASGTSSKST
Sbjct: 56  LPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKST 115

Query: 108 KMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPY 167
           KMAHGGVRYLEKAF + SK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVYNYWQ+PY
Sbjct: 116 KMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPY 175

Query: 168 FYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAAL 227
           FY GCK YD FAG QNLKSSY++S K A E+APMLDA+ LKA LVYHDGSFNDSR+N+++
Sbjct: 176 FYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSI 235

Query: 228 AVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDR 287
           A+TAIE GATVLNY+EV +L+K+  S +I G  V+D+ETGE   +K+KV+VN+TGP+SD 
Sbjct: 236 AITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDT 295

Query: 288 LLQMDAAKDGKPRNDLVQFANEGHD--SIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEI 345
           +LQMD    G P  DL     + +D   I S+IAVSNP+MVVPS+GVHI+LP++YCPK++
Sbjct: 296 ILQMDKNLSGLP--DLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQM 353

Query: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405
           GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV
Sbjct: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413

Query: 406 KRGDVLSAWAGIRPLIRDPRTIKEG--DDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTY 463
           +R DVLSAWAGIRPL+RDPR I +     + +TQGLVR+HFL+TSDNGL+TIAGGKWTTY
Sbjct: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473

Query: 464 REMAEETIDEVVKQGKFQ--AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLA 521
           REMAEETIDEVVK G F   AKPC TK +KL GAE WDPN VA+L+Q+++LSS MA++L+
Sbjct: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533

Query: 522 NNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEY 581
            NYGTRS IIC++F+R+E N+LPV   G E+  +  NV+F++FRYP TI ELKY+M+YEY
Sbjct: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEY 593

Query: 582 TRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
            RT LDFLMRRTRF +LDA QAL AV GTV VMGDE GW   RR+ E + A+ FI++FG+
Sbjct: 594 ARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/603 (66%), Positives = 473/603 (78%), Gaps = 9/603 (1%)

Query: 46  APALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSK 105
           AP   +R +LL+++AKT QFDVLII               RGLNVALVE  DFASGTSSK
Sbjct: 49  APPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSK 108

Query: 106 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQV 165
           STKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+Y+ WQV
Sbjct: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQV 168

Query: 166 PYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNA 225
           PY Y+GCK YD FAGSQNLK SY++S     E APML    LKA LVYHDGSFNDSR+NA
Sbjct: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228

Query: 226 ALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFS 285
            LA+TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E  RI AK VVN+TGP+S
Sbjct: 229 TLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYS 288

Query: 286 DRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEI 345
           D +LQMD    G P + L    N    S  ++IAV +P+MV+PS GVHIVLP+FYCPK++
Sbjct: 289 DAILQMDRNPSGLPDSPLND--NSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDM 346

Query: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405
           GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPV
Sbjct: 347 GLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPV 406

Query: 406 KRGDVLSAWAGIRPLIRDPRTI-KEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYR 464
           KR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+VR+HFL+TSDNGL+TIAGGKWTTYR
Sbjct: 407 KREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYR 466

Query: 465 EMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANN 523
           +MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  N
Sbjct: 467 QMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQN 526

Query: 524 YGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIGELKYSMQ 578
           YGTRS IICE FK   +N+LP++   +EN  +Y +     VNFD+FRYPFTIGELKYSMQ
Sbjct: 527 YGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQ 586

Query: 579 YEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKT 638
           YEY RT LDFL+RRTRF FLDA++AL AV  TV VMGDE  WS+ +RQ E ++   FIKT
Sbjct: 587 YEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKT 646

Query: 639 FGL 641
           FG+
Sbjct: 647 FGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/603 (66%), Positives = 471/603 (78%), Gaps = 9/603 (1%)

Query: 46  APALPTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSK 105
           AP   +R +LLE++ KT QFDVLII               RGLNVALVE  DFASGTSSK
Sbjct: 52  APPQVSRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSK 111

Query: 106 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQV 165
           STKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+Y+  QV
Sbjct: 112 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQV 171

Query: 166 PYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNA 225
           PY Y+GCK YD FAGSQNLK SY++S     E APML    LKA LVYHDGSFNDSR+NA
Sbjct: 172 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 231

Query: 226 ALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFS 285
            LA+TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E  RIKAK VVN+TGP+S
Sbjct: 232 TLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYS 291

Query: 286 DRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEI 345
           D +LQMD    G+P + L    N    S  ++IAV +P+MV+PS GVHIVLP+FYCPK++
Sbjct: 292 DAILQMDRNPSGQPDSPLND--NSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDM 349

Query: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405
           GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPV
Sbjct: 350 GLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPV 409

Query: 406 KRGDVLSAWAGIRPLIRDPRTI-KEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYR 464
           KR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+VR+HFL+TSDN L+TIAGGKWTTYR
Sbjct: 410 KREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYR 469

Query: 465 EMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANN 523
           +MAEETID+VV+ G F    PC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  N
Sbjct: 470 QMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQN 529

Query: 524 YGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIGELKYSMQ 578
           YGTRS IICE FK   +N+LP++   +EN  +Y +     VNFD+FRYPFTIGELKYSMQ
Sbjct: 530 YGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQ 589

Query: 579 YEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKT 638
           YEY RT LDFL+RRTRF FLDA++AL +V  TV VMGDE  WS+ +RQ E ++   FIKT
Sbjct: 590 YEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKT 649

Query: 639 FGL 641
           FG+
Sbjct: 650 FGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/540 (68%), Positives = 431/540 (79%), Gaps = 9/540 (1%)

Query: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+YN WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228
           Y GCK YD FAG QNLKSSY++S     E APML    LKA LVYHDGSFNDSR+NA LA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288
           +TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E  RI AK VVN+TGP+SD +
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 289 LQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLL 348
           LQMD    G+P + L    N    S  +++AV +P MV+PS GVHIVLP+FYCPK+IGLL
Sbjct: 181 LQMDRNASGQPNSPLND--NSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLL 238

Query: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRG 408
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVKR 
Sbjct: 239 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 298

Query: 409 DVLSAWAGIRPLIRDPRTIKEGDDV-SSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMA 467
           DVLSAWAG+RPL+RDPR+I  G    S+TQG+VR+HFL+TSDNGL+TIAGGKWTTYR+MA
Sbjct: 299 DVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 358

Query: 468 EETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGT 526
           EETID+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  NYGT
Sbjct: 359 EETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGT 418

Query: 527 RSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIGELKYSMQYEY 581
           RS IICE FK   +N+LP++   +EN T+Y N     VNFD+FRYPFTIGELKYSMQYEY
Sbjct: 419 RSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEY 478

Query: 582 TRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
            RT LDFL+RRTRF FLDA++AL +V  TV VMGDE  WSD +RQ E ++   FIKTFG+
Sbjct: 479 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/594 (62%), Positives = 457/594 (76%), Gaps = 9/594 (1%)

Query: 50  PTRSELLEKMAKTEQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKM 109
           P R+++L+++  T +FDVL++               RGL VALVE  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169
           AHGGVRYLEKA +ELSK QLDLV+EALNER H+L  APHL K+LPI+IPVY YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 170 VGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229
            GCKMYD FAG+QNLKSSY++S +  S +APMLD   LK GLVYHDG FNDSR+ A LA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 230 TAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLL 289
           +A+ERGATV NY+ V QL+K+  +G I GA V D+ETG  F + AK+VVN+TGP+SD++L
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 290 QMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLD 349
           QMDA   G P  +  +   E      + IAV NP+MVVPS GVHI LP+FYCP E+GLLD
Sbjct: 298 QMDANPQGLPEKEPEKATPE-----NALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352

Query: 350 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGD 409
           A TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+R D
Sbjct: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412

Query: 410 VLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEE 469
           VLSAWAGIRPL+RDPR  +       T+GLVR+HF++TS   LVTIAGGKWTTYREMAEE
Sbjct: 413 VLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472

Query: 470 TIDEVVKQGKFQA-KPCITKKIKLAGAEGWDPNFVAMLAQEYH-LSSKMAEHLANNYGTR 527
           T+DEV+K GKFQ  KPC T+K KL GA+ W+ NF A L Q Y  L   +AEHLANNYG R
Sbjct: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532

Query: 528 SPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALD 587
           +PIICEMF+ D+ ++LPV   G  +  V KN++ ++F YPFTI ELKY +++EY RTALD
Sbjct: 533 APIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALD 591

Query: 588 FLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641
           FL+RR+RF FLDAR+AL AVD TV+++GDELGW  ++R AE  +   +IKTFG+
Sbjct: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 335 VLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVP 380
           VL  F CPKE G+LDA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

>TBLA0A10680 Chr1 (2640996..2641781) [786 bp, 261 aa] {ON} Anc_4.380
           YJR144W
          Length = 261

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%)

Query: 436 TQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGA 495
           T  LV   +       +V+IA G+   + E    T  E  K      + C    I   G+
Sbjct: 161 TPKLVTREYALVCHGQIVSIARGEQDYFNETGIPTATEGCKSNALM-RCCKDLGI---GS 216

Query: 496 EGWDPNFVAMLAQEYHLSSKMAEHLA 521
           E WDP F+    +EY +  K  EH+A
Sbjct: 217 ELWDPTFIKTFKKEYCV-DKFVEHIA 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,080,096
Number of extensions: 2467100
Number of successful extensions: 5575
Number of sequences better than 10.0: 24
Number of HSP's gapped: 5662
Number of HSP's successfully gapped: 24
Length of query: 641
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 525
Effective length of database: 40,180,143
Effective search space: 21094575075
Effective search space used: 21094575075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)