Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.192723.569ON70470437230.0
KLTH0G00682g3.569ON70470432870.0
NDAI0I032503.569ON70970430720.0
NCAS0E002503.569ON70870630630.0
KAFR0J028903.569ON70670530440.0
SAKL0F00748g3.569ON70770530360.0
KNAG0I002203.569ON70770430270.0
TDEL0D063703.569ON70670730130.0
KLLA0A00682g3.569ON70870630110.0
Kpol_507.83.569ON70770530030.0
Suva_7.163.569ON70870630000.0
CAGL0C01947g3.569ON70570429930.0
YGL245W (GUS1)3.569ON70870629810.0
Smik_7.163.569ON70870629720.0
Skud_7.223.569ON70870629670.0
TPHA0A060203.569ON70770529230.0
AFR264W3.569ON70770529200.0
ZYRO0E09570g3.569ON70670928540.0
TBLA0E001903.569ON70770527710.0
ZYRO0C07018g6.51ON8034496265e-70
KNAG0M011006.51ON7995416152e-68
YOR168W (GLN4)6.51ON8093726055e-67
TDEL0G041906.51ON8093726002e-66
KLTH0C10340g6.51ON8003725968e-66
Skud_15.3326.51ON8093375951e-65
Kwal_56.225596.51ON8003725941e-65
Kpol_1037.386.51ON8083725905e-65
SAKL0E02134g6.51ON8013725897e-65
Smik_15.3486.51ON8103725897e-65
AGR259C6.51ON7983725852e-64
CAGL0L04532g6.51ON7953385843e-64
NCAS0F002406.51ON8114435845e-64
Suva_8.2236.51ON8213725845e-64
TBLA0G004506.51ON8083725802e-63
KAFR0G026106.51ON7943715792e-63
NDAI0K028606.51ON8143825782e-63
TPHA0J005506.51ON8083755704e-62
KLLA0F20449g6.51ON8043215562e-60
Ecym_31356.51ON8043755563e-60
KNAG0L006207.100ON5172321861e-13
NCAS0I005607.100ON5272151805e-13
NDAI0A084607.100ON5292671771e-12
Suva_15.1347.100ON5353451733e-12
TPHA0L005907.100ON5582751734e-12
YOL033W (MSE1)7.100ON5362341734e-12
CAGL0F01133g7.100ON5322201653e-11
TBLA0E021807.100ON5312351573e-10
Kpol_1044.127.100ON5362321573e-10
KAFR0D013207.100ON5142281573e-10
Skud_15.1227.100ON5322631564e-10
Smik_15.1327.100ON5353971441e-08
ZYRO0D05808g7.100ON5332421431e-08
AEL338C7.100ON5332321431e-08
TDEL0H035007.100ON5342301422e-08
KLLA0F07975g7.100ON5422471412e-08
Ecym_26267.100ON5733441332e-07
SAKL0B09548g7.100ON5542541305e-07
KLTH0D02794g7.100ON5462321305e-07
Kwal_26.72027.100ON5672501298e-07
NDAI0J017304.136ON154688781.2
Suva_12.1777.461ON1148132761.8
Smik_12.4694.236ON89554752.4
Smik_6.3358.648ON127867708.1
Skud_5.2388.160aON17837688.5
Skud_16.1448.648ON127666708.6
TDEL0B008708.810ON55256699.5
Kwal_23.50648.72ON586107699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19272
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1438   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1270   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1187   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1184   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1177   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1174   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1170   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1165   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1164   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1161   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1160   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1157   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1152   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1149   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1147   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1130   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1129   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1103   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1071   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   245   5e-70
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   241   2e-68
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   237   5e-67
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   235   2e-66
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   234   8e-66
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   233   1e-65
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   233   1e-65
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   231   5e-65
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   231   7e-65
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   231   7e-65
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   229   2e-64
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   229   3e-64
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   229   5e-64
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   229   5e-64
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   228   2e-63
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   227   2e-63
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   227   2e-63
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   224   4e-62
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   218   2e-60
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   218   3e-60
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    76   1e-13
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    74   5e-13
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    73   1e-12
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    71   3e-12
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    71   4e-12
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    71   4e-12
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    68   3e-11
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    65   3e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    65   3e-10
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    65   3e-10
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    65   4e-10
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    60   1e-08
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    60   1e-08
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    60   1e-08
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    59   2e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    59   2e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    56   2e-07
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    55   5e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    55   5e-07
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    54   8e-07
NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa] ...    35   1.2  
Suva_12.177 Chr12 complement(269120..272566) [3447 bp, 1148 aa] ...    34   1.8  
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    33   2.4  
Smik_6.335 Chr6 (527564..531400) [3837 bp, 1278 aa] {ON} YPL137C...    32   8.1  
Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C (...    31   8.5  
Skud_16.144 Chr16 complement(264503..268333) [3831 bp, 1276 aa] ...    32   8.6  
TDEL0B00870 Chr2 (165444..167102) [1659 bp, 552 aa] {ON} Anc_8.8...    31   9.5  
Kwal_23.5064 s23 (994170..995930) [1761 bp, 586 aa] {ON} YPL020C...    31   9.6  

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1438 bits (3723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/704 (98%), Positives = 696/704 (98%)

Query: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE
Sbjct: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60

Query: 61  SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI
Sbjct: 61  SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK
Sbjct: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540

Query: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600
           AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK
Sbjct: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600

Query: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660
           TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM
Sbjct: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660

Query: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1270 bits (3287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/704 (87%), Positives = 658/704 (93%)

Query: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           MAKL +ASKAPVVAYSELIAARL N+ K   IEI+FVEDKK+SPATFE + +DVLK IV+
Sbjct: 1   MAKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQ 60

Query: 61  SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           ++PE FK GF+ C++W++ ASEEL VKNFQKLSVSL KLDA LN RTF+LGGT++S ADI
Sbjct: 61  TYPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADI 120

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWGSLRSNGMVGSIIKN+VYVNVSRWYTLLEQ+PEFGSAHEFL K +QELKKAST NKK
Sbjct: 121 ACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKK 180

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMY+LCVKMIEEG AYCDDT T++
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDK 300

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDG+ASARRDRSVEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 301 MREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 360

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY WML+ALHLRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V PVKFH++GAPQTPDVQ+KLKHKKNP
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEGAPQTPDVQIKLKHKKNP 540

Query: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600
           AVGEKKVIYY D+LID+DDA  + EGEELTLMDWGN IVTKKNADGSLTGKLHLEGDFKK
Sbjct: 541 AVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFKK 600

Query: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660
           TKLK+TWLADT DKV+VDLVDFDHLI+KDKLEEGEDFAD+LTP+TEFHV A+ADLNVKDM
Sbjct: 601 TKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKDM 660

Query: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           KKGDIIQFERKGYYRLD+ A  DKPYVFF+IPDGKSVNKYGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/704 (80%), Positives = 621/704 (88%), Gaps = 3/704 (0%)

Query: 4   LTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVESFP 63
           L +  KAPVVAY +LIAAR+ N  KP +I+I FV+DKK++P+ F G+S+     I+E FP
Sbjct: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65

Query: 64  EAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIAC 122
           E F +   D   +W++ A+EELVVKNFQKLS SL KLDAQLNLRTF+LGG  YS ADIAC
Sbjct: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125

Query: 123 WGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKKE 182
           WG+LRSNGM GSI+KN+V VNVSRWY+LLE  P FGS HE LTK++QELKK S   KKKE
Sbjct: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185

Query: 183 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTN 242
           THKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ YKGKLIIRFDDTN
Sbjct: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245

Query: 243 PSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMR 302
           PSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQ+MYELCVKMI+EGKAYCDDT TE+MR
Sbjct: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305

Query: 303 EERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRC 362
           EERMDGIASARRDRSVEENLRIF  EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365

Query: 363 NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVH 422
           NLTPHHRTG+TWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYDWML+A++LRKVH
Sbjct: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425

Query: 423 IWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 482
           IWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQG
Sbjct: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 485

Query: 483 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKNP 540
           PSRNVINLEWNLIWAFNKKVIDPVA RHTA+V+PVK H++G   PQTP  +MK KHKKNP
Sbjct: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545

Query: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600
           AVGEKKVIYY D++ID+ DA LIEE EE+T+MDWGNVI+TKKNADGS+ GKLHL+GDFKK
Sbjct: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605

Query: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660
           TK K+TWLADT D V VDLVDFDHLISKDKLEE E F DFLTP TEFH  AIADLNVKDM
Sbjct: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665

Query: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           K GDIIQFERKGYYRLDAVA   KPYVFF+IPDGKSVNKYGAKK
Sbjct: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/706 (80%), Positives = 620/706 (87%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  KAPVVAY+ELIAAR+ N  KP +I I+FV+DKKA+PATF G++ D    IV  
Sbjct: 3   ATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIVAQ 62

Query: 62  FPEAFKGGFD-GCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           F + F    +    +W + ASEELV+KNFQKLS SL KLDA LNLRTF+LGG  YS ADI
Sbjct: 63  FSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAADI 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FGS HEFLTK++QELKK +   KK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAGKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDLELLGIKGDR+T+SSDYFQEMY+ C++MI+EGKAYCDDT TE+
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEK 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARRDRSVEENL+IFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL+LRK
Sbjct: 363 RCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+VNPVK H++G   PQTP ++MK KHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPAVGEKKVIY+ D++ID+DDA L+E  EE+T+MDWGNVI+T+KNADGSL GKLHLEGDF
Sbjct: 543 NPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           KKTK K+TWLADT D V VDLVDFDHLI+KDKLEE E F DFLTP TEFH  AIADLNVK
Sbjct: 603 KKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1177 bits (3044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/705 (79%), Positives = 619/705 (87%), Gaps = 3/705 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  KAPVVAY  LIAARL NA +P  I+I+FV+DKK++PATF G+S      IV +
Sbjct: 3   ATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAA 62

Query: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
           FP+AF+      E W   ASEE +VKNFQKL+ SL+KLDA LNLRTF+ GG  YS ADIA
Sbjct: 63  FPDAFRNANVASE-WINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADIA 121

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
            WG+LRSNGMVGSIIKN+VYVNVSRWY+LLE  P FG+ HEFLTK++QELKK ++  KKK
Sbjct: 122 AWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKK 181

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 241

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKEK EFQDSILEDLELLGIKGDRVTYSSDYFQEMY+LCV++I+EG AYCDDT TE+M
Sbjct: 242 NPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKM 301

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           REERMDGIASARRDR+VEENLRIFT EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIYR
Sbjct: 302 REERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYR 361

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLNALHLRKV
Sbjct: 362 CNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKV 421

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539
           GPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVVNPVK H+ G  AP+TP ++MK KHKKN
Sbjct: 482 GPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKKN 541

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           PAVGEKKVIYY D+++D++DA +IE  EE+TLMDWGN+I+TKKNADGS+  K+HLEGDFK
Sbjct: 542 PAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDFK 601

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KT  K+TWLADT D V VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNVK+
Sbjct: 602 KTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKE 661

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GD+IQFERKGY+RLD++    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 662 MKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/705 (79%), Positives = 627/705 (88%), Gaps = 2/705 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  KAPVVAY+ELIAAR+ NA K   I+I+FV+DKKA+PATF G ++     I+ +
Sbjct: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62

Query: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
           + + F  G  G  +WS+ ASEE ++KNFQKLS SL KLD++LNLRT++L   + +PADIA
Sbjct: 63  YQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
           CWG+LRSNGMVGSIIKN+VYVNVSRWYT+LE  P F  AHEFLTK++QELKKAS  NKKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKK 182

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           ETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 183 ETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKEK EFQDSILEDL+LLGIKGD++TYSSDYF+EMY+LCV++I+EGKAYCDDT TE+M
Sbjct: 243 NPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKM 302

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           REERMDGIASARRDRSVEENLRIF  EMKNGTEEGLKNCVRAKIDY+A NK LRDPVI+R
Sbjct: 303 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFR 362

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML+ALHLRKV
Sbjct: 363 CNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKV 422

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 482

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539
           GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV PVK H++G   PQ P ++MKLKHKKN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKN 542

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           P VGEKKVIYY DVLID++DA ++ EGEELTLMDWGNVI+TKKN+DGSL GKLHLEGDFK
Sbjct: 543 PDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDFK 602

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KTKLK+TWLADT DKV+VDLVDFDHLISKDKLEEG++F DFLTP+TEFH PAIADLNVKD
Sbjct: 603 KTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVKD 662

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GD+IQFERKGYYRLD++A   KPYVFF+IPDGK+VNKYGAKK
Sbjct: 663 MKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1170 bits (3027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/704 (78%), Positives = 614/704 (87%), Gaps = 1/704 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  KAP+VAY  LIAAR+ N+ K  ++ I+FV+DK A+PA F G+S DVL  I   
Sbjct: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63

Query: 62  FPEAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           FPE F +        W + A++E VVKNF KL+ SL KLDA LNLRTF+LGG  YS ADI
Sbjct: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGMVGSIIKN+VYVNVSRWYTL E  P+F +AHEFLTK++QELKKAST  KK
Sbjct: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDL LLGIKGDRVTYSSDYFQ+MY++C+++I+EG AYCDDT TE+
Sbjct: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARRDRSVEENL+IFT EMKNGTEEGLKNCVRAKIDY APNKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWMLNALHLRK
Sbjct: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV+PVK HI+GAP+TP  +MK KHKKNP
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNP 543

Query: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600
           AVGEKKVI+Y +V+ID++DA  +E  EE+TLMDWGNVI+TK++ DGSL GKLHLEGDFKK
Sbjct: 544 AVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDFKK 603

Query: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660
           TK K+TWLADT D V VDLVDFDHLI+KD+LEEGE F DFLTP+TEF   AIADLNVK M
Sbjct: 604 TKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVKHM 663

Query: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           K GDIIQFERKGYYRLD++    KPY+FF+IPDGKSVN+YGAKK
Sbjct: 664 KVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/707 (79%), Positives = 624/707 (88%), Gaps = 4/707 (0%)

Query: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           MAKL +  KAPVVAY+ELIAAR+ N V P +I ++FV+DKKA+PA  +G S  V   I+E
Sbjct: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60

Query: 61  SFPEAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPAD 119
           +FP+ F +G  +    W + AS + V+KNFQKLS SL+KLDA LNLRT++LGG  YS AD
Sbjct: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120

Query: 120 IACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNK 179
           IACWG+LRSNGMVGSIIKN+V VNVSRWYTLLE    FG AHEFLTK++Q+LKKAS   K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFD 239
           KKE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+EYKGKLIIRFD
Sbjct: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240

Query: 240 DTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATE 299
           DTNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMY+LCVKMI+EGKAYCDDT TE
Sbjct: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300

Query: 300 RMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVI 359
           +MREERMDGIASARRDR VEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVI
Sbjct: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360

Query: 360 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLR 419
           YRCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWMLNA++LR
Sbjct: 361 YRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHK 537
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVVNPVK H+DG  APQ+P  +MK KHK
Sbjct: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539

Query: 538 KNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGD 597
           KNP VGEKKVI+Y DV+ID+DDA ++E+ EE+TLMDWGNVI+TKKNADGSL GKL+L+GD
Sbjct: 540 KNPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599

Query: 598 FKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNV 657
           FKKTK K+TWLADT D   VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNV
Sbjct: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659

Query: 658 KDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           KD+K GDIIQFERKGYYRLDA+A   KPYVFF+IPDGKSVN+YGAKK
Sbjct: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/706 (78%), Positives = 615/706 (87%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVK-PGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           A L + +KAPV+AY ELIAAR  NA K   TIEI FVEDKKA+ A+F G + DVL  +  
Sbjct: 3   ASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKLSA 62

Query: 61  SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           ++P+      D   +W +F +++LV+KNFQ+L+ SL KL+A LNLRT++L     S ADI
Sbjct: 63  AYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLADI 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           A WG LRSNGMVGSIIKN+VY+NVSRWY+  E +PEFG AHEFLTK++QELKKAS  NKK
Sbjct: 123 AVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVNKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQEMY+ CV+MI+EGKAYCDDT TER
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPTER 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREER +GI S+RR+R+VEENL+IFT EMKNGTEEGLKNCVRAKIDYEA NK +RDPVIY
Sbjct: 303 MREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTG+ WKIYPTYDFCVPIVD+LEGVTHALRTIEYRDRN QYDWMLNALHLRK
Sbjct: 363 RCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQW+VDKD+VSNWDDPRFPT        MT+EGLRNFVLS
Sbjct: 423 VHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIW+FNKKVIDPVAPRHTA+V+PVK H++G   PQTP+V+MKLKHKK
Sbjct: 483 QGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPA+GEKKVIYY D++IDE+DAKL+ EGEE+TLMDWGN I+TKKN DGS   KLHLEGDF
Sbjct: 543 NPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           K TK K+TWLADT DKV  DLVDFDHLISKDKLEEGE+F DFLTPKTEFH  A ADLNVK
Sbjct: 603 KTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDIIQFERKGY+RLD++    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 DMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/705 (79%), Positives = 619/705 (87%), Gaps = 2/705 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  KAPVVAY+ELIAAR+ N+ KP +I+I+FVEDKKASPAT  G+S DVL  IV +
Sbjct: 3   ATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIVTA 62

Query: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
             + F  G     +W + ASEELVVKNFQ+L+ SL+KLDA LNLRT++ GG +++ ADIA
Sbjct: 63  NSDVFPEGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVADIA 122

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
           CWG+LRSNGMVGSIIKN+V VNVSRWYTLLE+   FG  HEFLTK++QELKKAST  KKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGKKK 182

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           ETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 183 ETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKE  EFQDSILEDLELLGIKGDR+T+SSDYFQEMY+ CV++I++GKAYCDDT TE+M
Sbjct: 243 NPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTEKM 302

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           R+ERM+GIAS RRDRSVEENL+IFT EMKNGTEEGLKNCVRAKIDYEA NKTLRDPVI+R
Sbjct: 303 RDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIFR 362

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNLTPHHRTGS WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLNAL LRKV
Sbjct: 363 CNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKV 422

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK+LVSNW+DPRFPT        MTVEGLRNFVLSQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVLSQ 482

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539
           GPSRNVINLEWNLIW+FNKKVIDPV PR TAVV+PVK H++G  APQ+  V+MK KH KN
Sbjct: 483 GPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHPKN 542

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           P VGEKKV++Y D++ID +DA  IE+GEE+TLM+WGN I+TKKNADGSL  KLHLEGDFK
Sbjct: 543 PVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGDFK 602

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KTK KVTWLADT D V VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNVKD
Sbjct: 603 KTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKD 662

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GDIIQFERKGYYRLD++A   KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 MKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/706 (78%), Positives = 612/706 (86%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           + LT+  KAP VAY+ELIAAR+ NA+ P +I ++FV+DKKA  A  +  + DV   I   
Sbjct: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKITGK 62

Query: 62  FPEAFKGGF-DGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           F   F  G  +   KW + A EELVVKNF KLS SL+ LD QLNLRTF+LGG  YS AD+
Sbjct: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AHEFLTK++QE+KK +   KK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGK+IIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQEMY+ CV+MI++GKAYCDDT TE+
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARRDRSVEENLRIFT EMKNGTE GLKNCVRAKIDYEA NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVVNPVK H++G  APQ P ++MK KHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPAVGEKKVIYY D+++D+DDA +I+  EE+TLMDWGNV++TKKNADGS+  KLHLEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           KKTK K+TWLADT D V VDLVDFDHL++KDKLEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDI+QFERKGY+RLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/704 (79%), Positives = 620/704 (88%), Gaps = 2/704 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKP-GTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           + L +  KAPVVAY+ELIAARL N  K   ++ ++FV+DKK++ ATF+G S++ L+ IV 
Sbjct: 3   STLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAIVA 62

Query: 61  SFPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
            FPE   G  +  + W + A+EELV+KNFQKL+ SL+KLDAQLN RT++ GG  +  ADI
Sbjct: 63  KFPEIL-GANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSADI 121

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGMVGSIIKN+VYVNVSRWY LLE  P FG +HEFLTK++QELKKA+   KK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAGKK 181

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 182 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQEMYELCVK+I+EGKAYCDDT TE+
Sbjct: 242 TNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPTEK 301

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARR+RSVEENL+IFT +MKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY 361

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGS WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDW L+ L+LRK
Sbjct: 362 RCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNLRK 421

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 481

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+VNPVK HI+GAP++P  +MK KHKKNP
Sbjct: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEGAPESPKTEMKPKHKKNP 541

Query: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600
           AVGEKKVIYY +V+ID++DA  IE+ EE+TLMDWGN+I+TKKNADGS+  KLHLEGDFKK
Sbjct: 542 AVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEGDFKK 601

Query: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660
           TK K+TWLADT D V VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNVKDM
Sbjct: 602 TKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLNVKDM 661

Query: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
             GDIIQFERKGYYRLDA A   KPYVFF+IPDGKSVNKYGAKK
Sbjct: 662 IVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/706 (78%), Positives = 610/706 (86%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           + LT+  KAP+VAY+ELIAAR+ NA+ P +I I  V+DKKA  A  +  + DV   I   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKITSK 62

Query: 62  FPEAFKGG-FDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           F   F  G  +   KW   A +ELV+KNF KLS SL+ LD+QLNLRTF+LGG  YS AD+
Sbjct: 63  FAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADV 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AH+FL+K++ ELKK++   KK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVGKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDL+LLGIKGDR+TYSSDYFQEMY+ CV+MI++GKAYCDDT TE+
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDG+ASARRDRSVEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+VNPVK H++G  APQ P ++MK KHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPAVGEKKVIYY D+++D+DDA +I   EE+TLMDWGNVI+TKKN DGS+  KL+LEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           KKTK K+TWLADT D V VDLVDFDHLI+KD+LEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1149 bits (2972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/706 (77%), Positives = 610/706 (86%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           + LT+  KAP+VAY+ELIAAR+ NA+ P +I I FV+DKKA  A  +  + DV   I   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62

Query: 62  FPEAFKGG-FDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           F   F  G  +   KW   A +ELVVKNF KLS SL+ LD+QLNLRTF+LGG  YS AD+
Sbjct: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AH+FL+K++QELKK++   KK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEMY+ C++MI++GKAYCDDT TE+
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIAS+RRDRSVEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+VNPVK H++G  APQ P  + K KHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPAVGEKKVIYY D+++D+DDA +I   EE+TLMDWGNVI+TKKN DGS+  KL+LEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           KKTK K+TWLADT D V VDLVDFDHLI+KD+LEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1147 bits (2967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/706 (77%), Positives = 609/706 (86%), Gaps = 3/706 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           + LT+  KAP VAY+ELIAAR+ NA+ P +I I FV+DKKA  A  +  +  V   I   
Sbjct: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKITGK 62

Query: 62  FPEAFKGG-FDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120
           F   F  G  +   +W+  A +ELVVKNF KLS SL+ LD+QLN+RTF+LGG  YS AD+
Sbjct: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122

Query: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AH+FLTK++QELKK++   KK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEM++ CV+MI++GKAYCDDT TER
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302

Query: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360
           MREERMDGIASARR+RSVEENLR+FT EMKNGTEEGLKNCVRAKIDYEA NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+VNPVK H++G  APQ P V+MK KHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542

Query: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598
           NPAVGEKK+IYY D+++D +DA +I   EE+TLMDWGNVI+TKKN DGS+  KLHLEGDF
Sbjct: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602

Query: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658
           KKTK K+TWLADT D V VDLVDFDHLI+KD+LEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVN+YGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/705 (76%), Positives = 613/705 (86%), Gaps = 2/705 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           A L +  K+ VVAYSELIAAR+ N+VKP +I I+FVEDKKA+ A+  G ++DVL  IV +
Sbjct: 3   ATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIVSA 62

Query: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
             + F  G  G E+W + A  ELV+KNFQKL+ SLDKLDA LNLRTF+ GG SYS ADIA
Sbjct: 63  NADVFPEGVTGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIADIA 122

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
           CWG+LRSNGMVGSIIKN+V VNVSRWYTL E  P FG A+EFLTK++QELKKAS+  KKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGKKK 182

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           ETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFA  YKGKLIIRFDDT
Sbjct: 183 ETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFDDT 242

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKEK EFQ+SILEDL LLGIKGDR+T+SSDYFQEMY+ C+++I+EGKAYCDDT  ++M
Sbjct: 243 NPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVDKM 302

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           REERMDGIASARR+RSVEENL+IFT EM+NGTEEGL+NCVRAKIDYEA NKTLRDPVIYR
Sbjct: 303 REERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVIYR 362

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNL PHHRTG+ WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WMLNA++LRKV
Sbjct: 363 CNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLRKV 422

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MT+EGLRNFV+SQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVISQ 482

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539
           GPSRNVINLEWNLIWAFNKKVIDPVAPR T V+NP+K H+ G  AP+TP V+MK KH KN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHPKN 542

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           PAVGEK+VI+  D++ID+DDA +IEEGEE+TLM+WGN I+ KKNADGS+   LHLEGDFK
Sbjct: 543 PAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGDFK 602

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KTK K+TWLA+T D   VDLVDFDHLI+KDKLEE E F +FLTP TEFH  AIAD+NVKD
Sbjct: 603 KTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNVKD 662

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GDIIQFERKGYYRLDA+    KPY+FF+IPDGK+VNKYGAKK
Sbjct: 663 MKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/705 (76%), Positives = 603/705 (85%), Gaps = 2/705 (0%)

Query: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61
           + L +A+K+P VAY+ELIAAR  N  K   + I F E K+A+ A+F+G S + L+ +VE 
Sbjct: 3   STLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEK 62

Query: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
           +P+      +    W  +A  +LVVK+F+KLS SL+KLDA LNLRTF+LGG   + AD+A
Sbjct: 63  YPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADVA 122

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
            WG+LRSNG VGSIIKN+VYVNVSRWYT LE +P FG AHEFL K+++ELK A   NKKK
Sbjct: 123 VWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKK 182

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 183 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKE+ EFQDSILEDLELLGIKGDR+T+SSDYFQEMY+ CV+MI+EGKAYCDDT TERM
Sbjct: 243 NPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTERM 302

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           REERM+GIASARR+RSVEENL+IFT EMKNGTEEGLKNCVRAK DY A NKTL+DPV+YR
Sbjct: 303 REERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYR 362

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNLTPHHRTG+ WKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLNAL LRKV
Sbjct: 363 CNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKV 422

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRNFVLSQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQ 482

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGA--PQTPDVQMKLKHKKN 539
           GPSRNVINLEWNLIWAFNKKVIDP+APRHT V NPVK H++GA  PQTP  +MK KHKKN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKN 542

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           PAVGEKKVIYY DVLI  +DA ++  GEE+TLMDWGN I+  KN DGSLT  L+LEGDFK
Sbjct: 543 PAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFK 602

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KTK K+TWLADTSD V VDLVDFDHLISKD+LEE ++F DFLTP+TEFH  AIADLNVKD
Sbjct: 603 KTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKD 662

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GD+IQFER GYYRLD V  GDKP+VFF+IPDGK+VNKYGAKK
Sbjct: 663 MKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/709 (73%), Positives = 605/709 (85%), Gaps = 8/709 (1%)

Query: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60
           M  L +  KAPVVAY+ELIA+R+ NA     I ++FV++K A+P  F G+S+D    I+ 
Sbjct: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60

Query: 61  SFPEAFKGGFDGCEK---WSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSP 117
           ++P+ F  G +  E+   W + A E+LVVKNFQ+LS SL++LDA LNLRTF+LGG   S 
Sbjct: 61  TYPDVF--GHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISA 118

Query: 118 ADIACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTG 177
           ADI CWG+LRSNGMVGSIIKN+VYVNVSRWYTLLE  P FG AHE+LTK++Q +KKA T 
Sbjct: 119 ADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTA 178

Query: 178 NKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIR 237
            KKKE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILN+YFA  YKGKLIIR
Sbjct: 179 GKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIR 238

Query: 238 FDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTA 297
           FDDTNPSKE+ EFQD+ILEDLEL+GIKGD++TYSSDYFQEMY+LCV++I+EGKAYCDDT 
Sbjct: 239 FDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTD 298

Query: 298 TERMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDP 357
            E+MREERM+GI SA+RD SVEENLRIFT EMKNGTE G KNCVRAKIDY+A NKTLRDP
Sbjct: 299 VEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDP 358

Query: 358 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALH 417
           VIYRCNLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML AL 
Sbjct: 359 VIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALR 418

Query: 418 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 477
           LRKVHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 478 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHI--DGAPQTPDVQMKLK 535
           V+SQGPS+NVINLEWNLIWA NKK+IDPVAPRHTAVV+PV+  +  +GAP+TP V++K K
Sbjct: 479 VISQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPK 538

Query: 536 HKKNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLE 595
           HKKNPAVGEKKVIY   ++ID++DA ++E GEELTLMDWGN+I+T KNADGSL  K +L 
Sbjct: 539 HKKNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLG 598

Query: 596 GDFKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADL 655
           GDFKKTK KVTWLA+T D V V++VDFDHLI+KDKLEE E+F DF+TP+TEFH  A+ D+
Sbjct: 599 GDFKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDV 657

Query: 656 NVKDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           NVKDMK GDIIQFERKGY RLD+ A+GDKPY+FF+IPDGKSVN+YGAKK
Sbjct: 658 NVKDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/705 (74%), Positives = 606/705 (85%), Gaps = 4/705 (0%)

Query: 3   KLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVESF 62
           KL L+ KA  VAY ELIAAR+ N      ++I FVEDKKA+PAT +G+S+DVL  IV   
Sbjct: 4   KLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIVALS 63

Query: 63  PEAFKGGF-DGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121
           P +F     +    W++ A E+LVVKNFQ+L+ +L+ LDAQLNLR+F+LGG ++S AD+A
Sbjct: 64  PSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAADVA 123

Query: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181
            WG+LRSNGMVGSIIKN+VYVNVSRWY+ LE  P FG +HEFLTK++QELKKA+   KKK
Sbjct: 124 VWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAGKKK 183

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241
           E+HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ YKGKLIIRFDDT
Sbjct: 184 ESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDT 243

Query: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301
           NPSKEKEEF++SI+EDL LLGIKGDRVT+SSDYFQEMY+ C++MI+EGKAYCDDT TE+M
Sbjct: 244 NPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEKM 303

Query: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
           REERM+G  SARR+RSVEENL+IFT +M NGTEEGLKNCVRAKIDY+A NKTLRDPVIYR
Sbjct: 304 REERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 363

Query: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421
           CNLTPHH TG  WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+AL LR V
Sbjct: 364 CNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKLRHV 423

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        M++EGLRNFVLSQ
Sbjct: 424 HIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFVLSQ 483

Query: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGA--PQTPDVQMKLKHKKN 539
           GPSRNVINLEWNLIWAFNKKVIDP APRHTAVVNP K H++G+  PQT  ++MK KHKKN
Sbjct: 484 GPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKHKKN 543

Query: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599
           P VGEKKV++  +++ID++DA ++EEGEE TLMDWGN I+TKK+A+ S+T KLHLEGDFK
Sbjct: 544 PDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEGDFK 602

Query: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659
           KTK K+TWLADT D V+VDLVDFDHL++KD++EEGE F DFLT KTEFH  AIADLNVKD
Sbjct: 603 KTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLNVKD 662

Query: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704
           MK GD IQFERKGYYRLD++     PYVFF+IPDGK+VNKYGAKK
Sbjct: 663 MKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  245 bits (626), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 242/449 (53%), Gaps = 31/449 (6%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSI 254
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMREER---MDGI-- 309
           +  +  LG    ++TYSSDYF ++YEL  ++I +GK Y  + A E ++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 310 ----ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLT 365
               A   R RSVEENL  F  +MK+G  +  +  +R K D  +P+  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEF-RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 366 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWD 425
           PH RTG+ W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+ + + + +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 426 FARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQT-PDVQMKLKHKKNPAVGE 544
           +V N++     +  +K ++   PR   +++PV+  +D  P +  DV         P  GE
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVPDSFEDVVSIPFRPGTPEFGE 604

Query: 545 KKVIYYTDVLIDEDD----------AKLIEEGEELTLMDWGNVIVTK---KNADGSLTGK 591
           ++V +   V ID  D           +L  E + + L+   + ++ K   K++DG +T K
Sbjct: 605 REVPFTKRVFIDRSDFSENASDKEFFRLTPE-QPVGLIKVPHALIYKSLEKDSDGKIT-K 662

Query: 592 LHL----EGDFKKTKLKVTWLADTSDKVN 616
           +H+    EG  KK K  + W+   S+K N
Sbjct: 663 IHVHYDTEGKIKKPKTYIQWVP-LSEKFN 690

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  241 bits (615), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 169/541 (31%), Positives = 277/541 (51%), Gaps = 53/541 (9%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSI 254
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG--- 308
              +  LG +  ++TYSSDYF ++YEL   +I+ GK Y C  TA E  R R  + DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 309 ---IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLT 365
                   R+ S+E+NL  F + MK G  +  +  +R K D+ +P+  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEFEN-MKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 366 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWD 425
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 426 FARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNPA-VGE 544
           +V N++     +  +K ++   PR   V++P++  +D  P+  +  +++ +K   A  G 
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVDNLPEDHEELVEVPYKAGSAEFGS 604

Query: 545 KKVIYYTDVLIDEDD-AKLIEEGEELTLMDWGNVIVTK-----------KNADGSLTGKL 592
           + + +     ID  D ++ +++ E   L    +V + K           K+A+G +T +L
Sbjct: 605 RTLPFTNRFYIDRSDFSETVDDKEFFRLTPSQSVGLVKVPRTVTFVSVEKDANGHIT-RL 663

Query: 593 HLEGDFKKTKLK--VTWL---ADTSDKVNVDLVD-FDHLI-SKDKLEEGEDFADFLTPKT 645
           H+  D +K K K  + W+   A  +  V ++    ++ L  S++       F   + P++
Sbjct: 664 HVNYDSEKKKPKTYIQWVPVSAKYNSPVRIEETRVYNQLFNSENPSAVAGGFLKDINPES 723

Query: 646 E-----------FH--------VPAIADLNVKDMKKG---DIIQFERKGYYRLDAVADGD 683
           E           FH        VP   +  VK+   G      Q  R GY+ LD  +  D
Sbjct: 724 EVCHKGSVVEHNFHSVMENKLEVPHTGEFYVKEDPNGKETHRFQGMRVGYFTLDKESTAD 783

Query: 684 K 684
           K
Sbjct: 784 K 784

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  237 bits (605), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/372 (35%), Positives = 210/372 (56%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG K  ++TYSSDYF E+Y L   +I+ GKAY C  TA E  R R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RD+S+E+NL+ F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ W+IYPTYDF   +VD++E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++PV+  +D      +    + ++   P  GE+ V
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRPGTPEFGERTV 608

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 609 PFTNKFYIERSD 620

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  235 bits (600), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/372 (35%), Positives = 209/372 (56%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMREER---MDG------ 308
           +  LG K  ++TYSSDYF ++YEL   +I+ GK Y     +E ++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RDRS+EE L  F  +M+NG  +  +  +R K D  +P+  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++PV+  +D  P+  +  +K+  +  +P  GE++V
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRPGSPEFGEREV 610

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 611 PFTKRFFIERSD 622

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  234 bits (596), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 135/372 (36%), Positives = 209/372 (56%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++YEL  K+I  GKAY C  TA E  R R  + DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   R RSVEENL  F  +M++G  +  +  +R K D E+P+  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++PV+  +D  P+  +  + + ++   P  GE++V
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTVPYRPGTPEFGERQV 603

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 604 PFTGKFYIERSD 615

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  233 bits (595), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 124/337 (36%), Positives = 193/337 (57%), Gaps = 10/337 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY---CDDTATERMREERMDG------ 308
           +  LG K  ++TYSSDYF E+Y L   +I  GK Y   C     +R R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RD+S+E NL+ F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAP 525
           N++     +  +K ++   PR   V++P++  +D  P
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVVDNLP 585

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  233 bits (594), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 132/372 (35%), Positives = 205/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKNM 304

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY---CDDTATERMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++YEL   +I   KAY   C     +R R  + DG      
Sbjct: 305 VAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPGGER 364

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   R RSVEENL  F  +M++G  +  +  +R K D E+P+  + D + YR    PH 
Sbjct: 365 RACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNAPHP 423

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   +++PV+  +D  P   +  +K+ ++   P  GE+ V
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRPGTPEFGERSV 603

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 604 PFTKKFYIERSD 615

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  231 bits (590), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 131/372 (35%), Positives = 208/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++YEL   +I+  + Y C  TA E  R R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RDR VEE+L+ F + M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEFRN-MRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++P++  +D  P+  +    + ++   P  GE+ V
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYEEIASIPYRPGTPEFGERNV 609

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 610 PFTKKFYIERSD 621

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  231 bits (589), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 129/372 (34%), Positives = 210/372 (56%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG------ 308
           +  LG +  ++TYSSDYF ++Y+L   +I+ GKAY C  TA E  R R  + DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
           +A   RDR +EENL  F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++    R   V++PV+  +D  P+  +  + + ++   P  G++ V
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTIPYRPGTPEFGDRTV 604

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 605 PFTKKFFIERSD 616

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  231 bits (589), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 132/372 (35%), Positives = 206/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG------ 308
           +  LG    ++TYSSDYF E+Y L   +I+ GK Y C  TA E  R R  + DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RD+S+E NL+ F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++PV+  +D      +    +  +   P  GE+ V
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRPGTPEFGERTV 609

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 610 PFTNRFYIERSD 621

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  229 bits (585), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/372 (35%), Positives = 207/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESIERM 304

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG------ 308
           +  LG    ++TYSSDYF ++YEL   +I+ GK Y C  TA E  R R  + DG      
Sbjct: 305 VAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPGGER 364

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
           +  A R+R +EENL  F + M++G     +  +R K D  +P+  + D V YR    PH 
Sbjct: 365 LPCAHRERPIEENLAEFRN-MRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNAPHP 423

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTGS W+IYPTYDF   +VD+LE +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++    R   V++P++  +D  P+  +  + + ++   P  GE+ V
Sbjct: 544 NIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSIPYRPGTPEFGERTV 603

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 604 PFSKRFYIERSD 615

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  229 bits (584), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/338 (37%), Positives = 196/338 (57%), Gaps = 10/338 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG K  +VTYSSDYF ++YEL   +I+ GK Y C  TA E  R R  + DG      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RD+SVE+NL  F   M++G  +  +  +R K + E+P+  + D + YR    PH 
Sbjct: 361 HACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQ 526
           N++     +  +K ++   PR   +++P++  ++  P+
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVENLPE 577

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  229 bits (584), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 144/443 (32%), Positives = 236/443 (53%), Gaps = 31/443 (6%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSI 254
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI-- 309
              +  LG    ++TYSSDYF ++Y+L   +I   + Y C  TA E  R R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 310 ----ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLT 365
               A   R  S+E NL+ F + M++G  +  +  +R K D  +P+  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEFRN-MRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 366 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWD 425
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+R     Y+W+ + +H+ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 426 FARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGE 544
           +  N++        +K ++   PR   +++P++  +D  P+  +  + + ++   P  G+
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVDNLPEDYEEILSIPYRAGTPEFGD 609

Query: 545 KKVIYYTDVLIDEDD-AKLIEEGEELTLMDWGNVIVTK-----------KNADGSLTGKL 592
           + V +     I+  D +++ ++ E   L    NV + K           K+++G +T K+
Sbjct: 610 RTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQNVGLIKVPHTVSFKSVEKDSNGKIT-KI 668

Query: 593 HL-------EGDFKKTKLKVTWL 608
           H+       EG  KK K  + W+
Sbjct: 669 HVHYNNEAQEGKPKKPKTYIQWV 691

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  229 bits (584), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 130/372 (34%), Positives = 206/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG------ 308
           +  LG +  ++TYSSDYF E+Y L   +I   K Y C  TA E  R R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RD+ +E NL+ F + M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEFRN-MRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   V++P++  +D      +    + ++   PA GE+ V
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYRPGTPAFGERTV 608

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 609 PFTNKFYIERSD 620

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  228 bits (580), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 205/372 (55%), Gaps = 11/372 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDG------ 308
           +  LG K  ++TYSSDYF ++YEL   +I   K Y C  TA E  R R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 309 IASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   R+R +EENL+ F   M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHK-KNPAVGEKKV 547
           N++     +  +K ++   PR   +++P++  +D      +  + + ++   P  GE+ V
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYRPATPEFGERNV 609

Query: 548 IYYTDVLIDEDD 559
            +     I+  D
Sbjct: 610 PFTNKFYIERSD 621

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  227 bits (579), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 206/371 (55%), Gaps = 12/371 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++Y+L   +I+  K Y C  TA E  R R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A A R R +EE+L  F  +MK+G  E  K  +R K D ++PN  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG  W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNPAVGEKKVI 548
           N++        +K ++   PR   +++P++  +D   +  +  + + + K    G++ V 
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNLAEDYEEIVSIPYSK--KFGDRTVP 603

Query: 549 YYTDVLIDEDD 559
           +   + I+  D
Sbjct: 604 FTKRIYIERKD 614

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  227 bits (578), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/382 (33%), Positives = 209/382 (54%), Gaps = 11/382 (2%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI----- 309
           +  LG    ++TYSSDYF ++Y+L   +I  GK Y C  TA E  R R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   RDR +EENL+ F + M++G  +  +  +R K D  +P+  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEFRN-MRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 489 NLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGEKKV 547
           N++     +  +K ++   PR   +++P++  +D      +  + + ++   P  GE+ V
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTIPYRAGTPEFGERTV 613

Query: 548 IYYTDVLIDEDDAKLIEEGEEL 569
            +     I+  D   + + +E 
Sbjct: 614 PFTNKFFIERSDFSEVTDDKEF 635

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  224 bits (570), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 207/375 (55%), Gaps = 11/375 (2%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSI 254
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY-CDDTATE--RMREERMDGI-- 309
              +  LG K  +VTYSSDYF ++YEL   +I+  K Y C  TA E  R R  + DG   
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 310 ----ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLT 365
               A   RDR +EE+L+ F + M+ G  +  +  +R K D  +P+  + D + YR   +
Sbjct: 368 GERSACKHRDRPIEESLQEFRN-MREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 366 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWD 425
           PH RTG  WKIYPTYDF   +VD+ E ++H+L T E+      Y+W+ + +H+ +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 426 FARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNPA-VGE 544
           +  N++     +  +K ++   PR   +++P++  ++   +  +  + + ++   A  G+
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVENLSENYEELVTIPYRAGSAEFGD 606

Query: 545 KKVIYYTDVLIDEDD 559
           ++V +     I+  D
Sbjct: 607 RQVPFTNRFYIERSD 621

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  218 bits (556), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 182/321 (56%), Gaps = 10/321 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 249 GKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESIKSM 308

Query: 258 LELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY---CDDTATERMREERMDGI----- 309
           +  LG K  + TYSSDYF E+Y+L   +I+ GKAY   C     +R R  + DG      
Sbjct: 309 VSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPGGER 368

Query: 310 -ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHH 368
            A   R+R +EE+L  F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 369 KACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHP 427

Query: 369 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFAR 428
           RTG  WKIYPTYDF   +VD+LE +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 428 RTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 487

Query: 429 VNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V    VS W+DPR  T        +    + +F+ + G + +  
Sbjct: 488 LNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 547

Query: 489 NLEWNLIWAFNKKVIDPVAPR 509
           N++     +  +K ++   PR
Sbjct: 548 NIQVVRFESAIRKYLEDTTPR 568

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  218 bits (556), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 123/375 (32%), Positives = 204/375 (54%), Gaps = 11/375 (2%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSI 254
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAY---CDDTATERMREERMDGI-- 309
              +  LG K  ++TYSSDYF ++Y+L   +I+  K Y   C     +R R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 310 ----ASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLT 365
               + + R+RS+ ENL  F  +M++G  +  +  +R K D  +P+  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 366 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWD 425
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+ + +H+ +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 426 FARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 486 NVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKK-NPAVGE 544
              N++     +  +K ++    R   +++P++  ++  P+     + + ++   P  G+
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVVNNLPEDYQELVTIPYRPGTPEFGD 606

Query: 545 KKVIYYTDVLIDEDD 559
           + V +     I+  D
Sbjct: 607 RTVPFTKRFYIERTD 621

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 100/232 (43%), Gaps = 26/232 (11%)

Query: 197 IGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILE 256
           +  VVTRF P P+G LH+G  + A+ N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 257 DLELLGIKGDRVTY-SSDYFQE-MYELCVKMIEEG----KAYCDDTATERMREERMDGIA 310
            L+   IK D   Y  SD  +E +Y    + + +G    K +C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 311 SARRDRSVEE------NLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNL 364
           +   D+ V         +R    E+ +  ++ L   VR  I          DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSDR 215

Query: 365 TPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNAL 416
                       +PTY     + D L GVTH +R  E+     ++  M  A 
Sbjct: 216 ------------FPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 98/215 (45%), Gaps = 18/215 (8%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V+TRF P P+G LH+G  + A+ N   A+   GK I+R +DT+ ++   E   +I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 260 LLGIKGDRVTYSSDYFQEMY-ELCVKMIEEGKAYCDDTATERMREERMDGIA--SARRDR 316
              ++ D           +Y E   K+++ G AY    + ER+ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 317 SVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHHRTGSTW-- 374
                + +    +K   ++G+   +R K     P   + D +    N+ P++R G  W  
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMKSPERYP--LIHDLLHGELNIQPNNREG-MWFD 219

Query: 375 -------KIYPTYDFCVPIVDALEGVTHALRTIEY 402
                    +PTY F   + D L  VTH +R  E+
Sbjct: 220 DPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 113/267 (42%), Gaps = 45/267 (16%)

Query: 201 VTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLEL 260
           +TRF P P+G LH+G  + A+ N   A+   GK I+R +DT+ S+   E   +I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 261 LGIKGDR-VTYSSDYFQEMYELCVKMIEEGKAY---CDDTATERMREERMDGIASARRDR 316
            GI  D      SD     ++    +++ G AY   C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 317 S--------VEENLRI---FTHEMKNGTE-EGLKNCVRAKIDYEAPNKT----LRDPVIY 360
           +        VE NL     +T  +K+        + +  ++D +   K       DP++ 
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLNQKERGVWFDDPILI 222

Query: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420
           + +             YPTY F   + D L G+TH +R  E+     ++      + L +
Sbjct: 223 KSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQ 264

Query: 421 VHIWDFARVNFVRTL-------LSKRK 440
           +  WD  +   +  L       LSKRK
Sbjct: 265 LFGWDMPKFIHIPLLTSIDDKKLSKRK 291

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/345 (23%), Positives = 139/345 (40%), Gaps = 48/345 (13%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G+LH+G  + A+ N   A+  KG+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYELCVK-MIEEGKAYCDDTATERMREERMDGIASARRDRSV 318
              I  D         + +Y+  VK ++  G AY    + ER+ + R    A   +  S+
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRS--AMELKPPSM 162

Query: 319 EENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNK--TLRDPVIYRCNLTPH-----HRTG 371
               R   H  K   E  L   +   + +++P +  T  D +    NL P       R  
Sbjct: 163 ASYDRCCAHLAKEEIESKLAQDMPFTVRFKSPEQYPTFTDVLHGEINLQPQVNYNDRRYD 222

Query: 372 STWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFA 427
               +     PTY     + D L G+TH +R  E+     ++  + NA        WD+ 
Sbjct: 223 DLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------WDYP 276

Query: 428 RVNFVRTL-------LSKR---------KLQWMVDKDLVS-----NWDDPRFPTXXXXXX 466
           +   +  L       LSKR         K Q ++ + LV+      W  PR         
Sbjct: 277 KFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLASKKH 334

Query: 467 XXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPV 506
              ++E L       G ++    ++   +W FNK     ++ DPV
Sbjct: 335 ECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 123/275 (44%), Gaps = 48/275 (17%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G++H+G  + A+ N   A+   G+ ++R +DT+  +  E  ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 260 LLGIKGDR-VTYSSDYF--------QEMYELCVK-MIEEGKAY---CDDTATERMRE--E 304
             GI+ D     +S+ +         ++Y   +K ++E G AY   C     + M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 305 RMDGIASARRDRSV----EE------------NLRIFTHEMKNGTEEGLKNCVRAKIDYE 348
           +++  +SA  DR      EE             +R+ + E     E+ L   +  +I Y 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQYN 225

Query: 349 APNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQ 408
              KT  DP++ + +              PTY F   + D L  +TH +R  E+     +
Sbjct: 226 PHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPK 273

Query: 409 YDWMLNALHLRK---VHIWDFARVNFVRTLLSKRK 440
           +  M NAL  +    +HI     +N  +  LSKRK
Sbjct: 274 HISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 103/234 (44%), Gaps = 24/234 (10%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +  E  +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYELCVK-MIEEGKAYCDDTATERMREERMDGI-----ASAR 313
              I  D         + +Y+  VK ++  GKAY    + ER+ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 314 RDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHHRTGST 373
            DR       +   E+K+   +G+   VR K     P  T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERYP--TFTDLLHGQINLQP--QVNFN 217

Query: 374 WKIY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNAL 416
            K Y           PTY     + D L G+TH +R  E+     ++  + NA 
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAF 271

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 96/220 (43%), Gaps = 24/220 (10%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
            VTRF P P+G LH+G  + A+ N   A++  GK I+R +DT+ S+ K+   D+I   L+
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 260 LLGIKGDRVTYSSDYFQEMYELCVK-MIEEGKAYCDDTATERMREERMDGI-----ASAR 313
              +K D   Y      ++Y   +  +IE G+AY      ER+ + R   +      +  
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVS 165

Query: 314 RDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNK--TLRDPVIYRCNLTPHHRTG 371
            DR       +   E+K+  ++G+   VR    ++AP K     D +  + +L P     
Sbjct: 166 YDRHCA---HLSEGEIKSKLDQGIPFTVR----FKAPEKYPPFEDLLHGKIDLQPQQNPS 218

Query: 372 STW---------KIYPTYDFCVPIVDALEGVTHALRTIEY 402
                         YPTY     I D    ++H +R  E+
Sbjct: 219 DIRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEW 258

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 103/235 (43%), Gaps = 45/235 (19%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G LH+G  + A+ N   A+   G+ I+R +DT+  +  +  +++I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 260 LL---------GIKGDRVTYSSDYFQEMYELCV-KMIEEGKAYCDDTATERM-----REE 304
            L         GI G    Y       +Y+  + ++++ GKAY    + ER+       +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 305 RMDGIASARRDR--------SVEENL--------RIFTHEMKNGTEEGLKNCVRAKIDYE 348
           ++    +A  DR         +EENL        R+ + ++    E+ L   +  +  Y 
Sbjct: 164 KLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQPQYN 223

Query: 349 APNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 402
           + ++   DPV+ +  NL             PTY F   + D L  ++H +R  E+
Sbjct: 224 SIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGEEW 265

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 105/232 (45%), Gaps = 33/232 (14%)

Query: 197 IGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILE 256
           I  V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 257 DLELLGIKGDRVTYSSD-----YFQ----EMYELCV-KMIEEGKAY---CDDTATERMRE 303
            L+  GI  D    S +     Y Q    ++Y+  + K+++ G AY   C     + +R+
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 304 --ERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361
             +++    +   DR+    L +   E++N    G+   VR K     P     D +   
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYP--PFDDLLHGH 212

Query: 362 CNLTPHHRTGSTWKIY-----------PTYDFCVPIVDALEGVTHALRTIEY 402
            N+ P  +  S  + Y           PTY F   I D L  +TH +R  E+
Sbjct: 213 INIQP--QINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 99/228 (43%), Gaps = 21/228 (9%)

Query: 199 EVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDL 258
            VVTRF P P+G LHIG  + A+ N   A+   GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 259 ELLGIKGD-RVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMREERMDGIASARRDRS 317
               +K D      SD      E   K++E G AY      +R+   R  G      DR 
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGY-----DRH 153

Query: 318 VEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNK--TLRDPVIYRCNLTPHH-RTGSTW 374
               L +  ++++   + G     R  +  ++PNK  + +D +    N+     R G   
Sbjct: 154 C---LHLSDNDVRRLFDAG---HTRPVLRLKSPNKYDSFQDMLHGTVNIQERKDRVGFDD 207

Query: 375 KI------YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNAL 416
            I      +PTY F   + D L  VTH +R  E+     ++  +  AL
Sbjct: 208 PILMKSDGFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 110/263 (41%), Gaps = 33/263 (12%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +     +++I + L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYELCVK-MIEEGKAYCDDTATERMREERMDGI-----ASAR 313
              I  D         + +Y+  VK ++  G AY    + ER+ E R   +     + A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 314 RDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPH-----H 368
            DR       +   E+ +   +G+   VR K   + P     D +    NL P       
Sbjct: 165 YDRCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYP--LFADLLHGEINLQPQVNFNDR 219

Query: 369 RTGSTWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIW 424
           R      +     PTY     + D L G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 425 D---FARVNFVRTL----LSKRK 440
           D   F  +  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 158/397 (39%), Gaps = 70/397 (17%)

Query: 150 LLEQVP--EFGSAHEFLTKAV--QELKKASTGNK-KKETHKANFEIDLPDAKIGEVVTRF 204
           +L ++P   + S+ + LTK V    LKK+    + KK+ H +     LP      V TRF
Sbjct: 2   ILSRIPTRSYCSSSQ-LTKGVGLSPLKKSLLSKRIKKDIHPS-----LP------VRTRF 49

Query: 205 PPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIK 264
            P P+G LH+G  + A+ N   A+   G+ ++R +DT+  +     +  I + L    I+
Sbjct: 50  APSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLNWCKIE 109

Query: 265 GDRVTYSSDYFQEMYELCVK-MIEEGKAYCDDTATERMREERMDGI-----ASARRDRSV 318
            D         + +Y+  VK ++  G AY    + ER+ + R   +     + A  DR  
Sbjct: 110 YDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMASYDRCC 169

Query: 319 EENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRCNLTPHHRTGSTWKIY- 377
                +   E+ +   +G+   VR K   + P     D +    NL P  +     K Y 
Sbjct: 170 AH---LKEEEINSNLTQGIPFTVRFKSPEQYP--VFTDLLHGEVNLQP--QVNFNDKRYD 222

Query: 378 ----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIW--- 424
                     PTY     + D L G+TH +R  E+     ++  + NA        W   
Sbjct: 223 DLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------WVCP 276

Query: 425 DFARVNFVRTL----LSKR---------KLQWMVDKDLVS-----NWDDPRFPTXXXXXX 466
            F  +  + T+    LSKR         K Q ++ + L++      W  PR         
Sbjct: 277 KFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR--DLASKRH 334

Query: 467 XXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 503
              ++E L N     G ++    ++   +W FNK  +
Sbjct: 335 ECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 100/242 (41%), Gaps = 32/242 (13%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDL- 258
           V TRF P P+G LH+G  + A+ N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 259 -------ELLGIKGDRVTYSSDYFQEMYELCV-KMIEEGKAY---CDDTATERMRE--ER 305
                  E   + G    Y      E+Y   +  ++E G AY   C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 306 MDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNK--TLRDPVIYRCN 363
           +    +A  DR       +  HE+K    + L N V   I   AP K   ++D +    +
Sbjct: 160 LQPPTTASYDRHCAH---MSPHEIK----QNLDNDVAYTIRLRAPEKYPIIQDLLHGTLD 212

Query: 364 LTPHHRTGSTW---------KIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLN 414
           + P                    PTY F   I D L  +TH +R  E+     ++  + N
Sbjct: 213 IQPQVNANDVRYDDPILVKSDNLPTYHFANVIDDHLMEITHVIRGEEWLPSTQKHLAIYN 272

Query: 415 AL 416
           A 
Sbjct: 273 AF 274

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 97/232 (41%), Gaps = 44/232 (18%)

Query: 202 TRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 261
           TRF P P+GYLH+G  + A+ N   A+   G+ ++R +DT+  +   + + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 262 GIKGDR--------VTYSSDYFQEMYELCV-KMIEEGKAY---CDDTATERMREERM--- 306
           GI+ D           Y       +Y+    K++  G AY   C     E +R   M   
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 307 -----------DGIASARRDRSVEENLRIFTHEMKN-GTEEGLKNCVRAKIDYEA---PN 351
                        ++    D  +++N+  FT   K+    E  ++ +  ++D +    PN
Sbjct: 165 PPTNVSYDRECANLSQEHIDHKLDQNVP-FTLRFKSPAVYEPFEDLLHGRVDLQPQTNPN 223

Query: 352 KT-LRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 402
                DPV+ + +              PTY F   + D L  +TH +R  E+
Sbjct: 224 DIRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 98/230 (42%), Gaps = 35/230 (15%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G LHIG  + A+ N   A+  +G+ ++R +DT+ ++  +  +++I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 260 LLGIKGD-------------RVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMRE--E 304
             GI+ D             R +  ++ +Q+  +  +K     + +C     + +RE  +
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK 160

Query: 305 RMDGIASARRDRSVEENLRIFTHEMKNG-TEEGLKNCVRAKIDYEAPNK--TLRDPVIYR 361
           R+    +   DR  E         +  G  EE L   +   I  +AP +     D +   
Sbjct: 161 RLKPPTTVTYDRKCE--------SLSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGT 212

Query: 362 CNLTPH-----HRTGSTWKI----YPTYDFCVPIVDALEGVTHALRTIEY 402
            ++ P       R      I     PTY F   I D L  +TH +R  E+
Sbjct: 213 VDIQPQVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 101/247 (40%), Gaps = 44/247 (17%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +     + S+ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 260 LLGIKGD------------RVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMREE--- 304
              IK D            R +  +  +QE     V+  +  K +C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 305 -------RMDGIASARRDRSVEENLRI---FTHEMKNGTE-EGLKNCVRAKIDYEAPNKT 353
                    D   S   D+ VE NL+    FT   K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 354 L----RDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQ 408
           L     DP++ +  NL             PTY F   I D L  +TH +R  E+     +
Sbjct: 231 LDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLPSTPK 277

Query: 409 YDWMLNA 415
           +  +  A
Sbjct: 278 HTALYEA 284

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 134/344 (38%), Gaps = 57/344 (16%)

Query: 202 TRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 261
           TRF P P+G+LH+G  + A+ N   A++  G+ ++R +DT+ ++     + ++ +  + L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 262 GIK-----GDRVTY----SSDYFQEMYELCVKMIEEGKAYCDDTATERMREERMDGIASA 312
           GI+     G   TY     SD  +   +   ++I  G AY    + ER++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMA-- 179

Query: 313 RRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKT-LRDPVIY---------RC 362
                   N+    H  K   E+     +R+KI    P    L+ P IY           
Sbjct: 180 ---LKPPTNVTYDRHCAKLSKED-----IRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEI 231

Query: 363 NLTPH-----HRTGSTWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWML 413
           NL P       R      I     PTY F   I D L  +TH +R  E+     ++  + 
Sbjct: 232 NLQPQINPIDVRYDDPILIKSSGLPTYHFAHVIDDHLMEITHVIRGQEWLPATPKHIVLY 291

Query: 414 NALHLRK---VHIWDFARVNFVRTLLSKRK----LQWMVDKDLVS----------NWDDP 456
            A        +H+   A  N  +  LSKRK    +Q + +K ++            W  P
Sbjct: 292 KAFGWNPPQFIHLPLLASTNNKK--LSKRKGDTNIQQLREKGILPEALINFCVLFGWAPP 349

Query: 457 RFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 500
                        ++  L N       ++    L+ + +W FNK
Sbjct: 350 SPEDPDRKQSYRFSLAELENLFNLNHLTKGNAKLDESRLWNFNK 393

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 99/254 (38%), Gaps = 55/254 (21%)

Query: 200 VVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 259
           V TRF P P+G LH+G  + A+ N   A+   G+ ++R +DT+  +     + +I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 260 LLGIKGDR---------VTYSSDYFQEMYELCVK-MIEEGKAY-CDDTATERMREERMDG 308
             G++ D            Y      E+Y+  +K ++  G AY C         +ER+DG
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRC------FCSKERLDG 174

Query: 309 IASARRDRSVEENL---RIFTHEMKNGTEEGLKNCVRAKIDYEAPNK------------- 352
           + S+ +           R  T   ++   E LK  V   +  +AP K             
Sbjct: 175 LRSSAQQLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLD 234

Query: 353 ----------TLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 402
                        DP++ + +              PTY F   + D L  +TH +R  E+
Sbjct: 235 MQIQINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEW 282

Query: 403 RDRNAQYDWMLNAL 416
                ++  + NA 
Sbjct: 283 LPSTPKHIALYNAF 296

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 96/232 (41%), Gaps = 43/232 (18%)

Query: 202 TRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 261
           TRF P P+G LHIG  + A+ N   A+   G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 262 GIKGDRVT----------YSSDYFQEMYELCVKMIEEGKAY---CDDTATERMRE--ERM 306
           GI  D               SD  +   +   K+++ G AY   C     + +RE  +++
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLRESAQKL 166

Query: 307 DGIASARRDRSV----EENLR-------IFTHEMKNGTE-EGLKNCVRAKIDYEA---PN 351
               +A  DR      E  +R        FT  +K+       ++ +  K+D +    PN
Sbjct: 167 QPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQVNPN 226

Query: 352 -KTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 402
            +   DP++ + +              PTY F   + D L  +TH +R  E+
Sbjct: 227 DRRYDDPILVKSD------------ALPTYHFANVVDDHLMDITHVVRGEEW 266

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 103/250 (41%), Gaps = 51/250 (20%)

Query: 202 TRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 261
           TRF P P+G LHIG  + A+ N   A+   G+ ++R +DT+  +     ++SI E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 262 GI-----------------KGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMRE- 303
           G+                 + DR      Y  ++ +L V      + +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 304 -ERMDGIASARRDR--------SVEENL--RI-FTHEMKNGTE-EGLKNCVRAKIDYEA- 349
            +++    +   DR         ++E L  +I FT  +K+  +    ++ +   ID +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHHSTEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQ 229

Query: 350 --PNKT-LRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRN 406
             PN     DP++ + +              PTY F   + D L  +TH +R  E+    
Sbjct: 230 VNPNDMRYDDPILMKSD------------GLPTYHFANVVDDHLMKITHVVRGEEWLPST 277

Query: 407 AQYDWMLNAL 416
            ++  + NA 
Sbjct: 278 PKHIALYNAF 287

>NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa]
           {ON} Anc_4.136 YLR320W
          Length = 1546

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 376 IYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVHIWDFARV--NFVR 433
           ++ +Y   V IV  L+   H    +E +  ++Q   ++  L   +  IW   R+  +F+ 
Sbjct: 786 LFESYHILVTIVQLLDRKQHLWEALEKQSYSSQIALIILNLFPTRKTIWSLLRIEPSFIS 845

Query: 434 TLL-------SKRKLQWMVDKDLVSNWD 454
            +        S  +  W+VDKDL+ N D
Sbjct: 846 LVYTFKFIGYSTSQCNWIVDKDLIINLD 873

>Suva_12.177 Chr12 complement(269120..272566) [3447 bp, 1148 aa]
           {ON} YJR090C (REAL)
          Length = 1148

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 13/132 (9%)

Query: 87  KNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIACWGSLRSNGMVGSIIKNRVYVNVSR 146
            N Q+ ++SL+    QLN R      +++ P       S      V + + N V V + +
Sbjct: 81  NNAQRETLSLNNNGQQLNQRF----SSTFQPQQQTTALSGIDINTVNTNLMNGVNVQIDQ 136

Query: 147 WYTLLEQVPEFG--SAHEF---LTKAVQELKKASTGNKKKETHKANFEIDLPDAKIGEVV 201
              LL  +PE      HEF   + K +QE        +KK  +    EIDL + K+ E+ 
Sbjct: 137 LNRLLPNLPEEERIQIHEFKLIVGKKIQEFLAVIEKRRKKILN----EIDLDNLKLKELR 192

Query: 202 TRFPPEPSGYLH 213
               P+   YLH
Sbjct: 193 IDNSPQAISYLH 204

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGK 233
           K++T +   E D P      ++ +FP  PSG LHIGH +  +++    + YK +
Sbjct: 32  KQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNRFYKQR 84

>Smik_6.335 Chr6 (527564..531400) [3837 bp, 1278 aa] {ON} YPL137C
           (REAL)
          Length = 1278

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 567 EELTLMDWGNVIVTKKNADG---SLTGKLHLEGDFKKTKLKVTWLADTSDKVNVDLVDFD 623
           E   LM+ G+  V + N DG   SL+  L ++G F K  L  T  A   D  N+  +DFD
Sbjct: 817 ENFYLMNSGDSTVQQTNTDGESDSLS-VLEVKGQFAKNSLSSTLYAFARDSPNLIGLDFD 875

Query: 624 H-LISKD 629
           + L+S++
Sbjct: 876 YDLVSEE 882

>Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C
           (REAL)
          Length = 178

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 214 IGHAKAAILNQYFAQEYKGKLIIRFDDTNPSKEKEEF 250
           IGH K  + N Y   + K K I  FDD N ++E E++
Sbjct: 115 IGHLKDGLKNLYNISDLKSKRICLFDDENRNREVEKY 151

>Skud_16.144 Chr16 complement(264503..268333) [3831 bp, 1276 aa]
           {ON} YPL137C (REAL)
          Length = 1276

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 567 EELTLMDWGNVIVTKKNADGS--LTGKLHLEGDFKKTKLKVTWLADTSDKVNVDLVDFDH 624
           E L LM+  ++ V + + DG    +  L + G F K  L  T  A   D  N+  +DFD+
Sbjct: 814 ENLYLMNGSDLTVQQTSTDGESDTSSVLEVRGQFAKNSLSSTLYAFARDSSNLIGLDFDY 873

Query: 625 -LISKD 629
            LIS++
Sbjct: 874 DLISEE 879

>TDEL0B00870 Chr2 (165444..167102) [1659 bp, 552 aa] {ON} Anc_8.810
           YMR258C
          Length = 552

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 400 IEYRDR---NAQYDWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSN 452
           +E RD+   +  YD +LN  HL K+ I D   +   ++L S   L+W+ D   +S+
Sbjct: 137 LEIRDKTLFDEFYDEILNLSHLTKIKILDLKSLEKTKSLSSLETLEWVCDSREISH 192

>Kwal_23.5064 s23 (994170..995930) [1761 bp, 586 aa] {ON} YPL020C
           (ULP1) - Smt3-processing enzyme [contig 7] FULL
          Length = 586

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 45/107 (42%), Gaps = 6/107 (5%)

Query: 135 IIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQ--ELKKASTGNKKKETHKANFEIDL 192
           +  NR     S +YT L Q    G       K VQ  +L+K        ++H A   ID+
Sbjct: 428 VTTNRCVAFNSYFYTTLSQRGYQGVRRWMKKKKVQIEDLEKVFAPINLSQSHWALGVIDI 487

Query: 193 PDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFD 239
              +I  V +      SG L IGHA    L  Y  +E KG+L   FD
Sbjct: 488 SKKEISYVDSL----SSGPLAIGHAILKDLQAYLVEESKGQLGKDFD 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,218,741
Number of extensions: 3676647
Number of successful extensions: 10660
Number of sequences better than 10.0: 76
Number of HSP's gapped: 10872
Number of HSP's successfully gapped: 76
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)