Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.189053.501ON2362368791e-120
KLTH0G02332g3.501ON2332366112e-79
Skud_16.4483.501ON2082364832e-60
NDAI0B059203.501ON2352394801e-59
Smik_16.4063.501ON2121574711e-58
SAKL0F02486g3.501ON2302434634e-57
KNAG0A079903.501ON2212454581e-56
NCAS0F036003.501ON2372494574e-56
YPR154W (PIN3)3.501ON2152364545e-56
TDEL0D056903.501ON2012364466e-55
Suva_16.4823.501ON2352364313e-52
AFR320W3.501ON2571604082e-48
Kpol_480.83.501ON2391304044e-48
TPHA0A057203.501ON2201253963e-47
TBLA0C045303.501ON2221323895e-46
KAFR0G037403.501ON2342653871e-45
CAGL0F04829g3.501ON2021403562e-41
YGR136W (LSB1)3.501ON2411413593e-41
Smik_6.2323.501ON2411523565e-41
Skud_7.4473.501ON2381513444e-39
Suva_7.4243.501ON2491413314e-37
KLLA0E03873g3.501ON2201053154e-35
Ecym_12283.501ON2531543123e-34
ZYRO0D09702g3.501ON158893044e-34
KNAG0B007503.501ON2171232772e-29
TBLA0D029103.501ON2691612296e-22
ZYRO0G20372gsingletonON150632085e-20
Smik_7.3351.356ON460651492e-10
YFR024C-A (LSB3)1.356ON459651482e-10
Ecym_27471.356ON452601482e-10
NCAS0A089901.356ON434651473e-10
NCAS0B072501.356ON441731473e-10
TPHA0C040202.502ON485921448e-10
NDAI0B045801.356ON424711421e-09
Suva_6.961.356ON455651421e-09
Skud_6.1081.356ON459651421e-09
KLTH0F15114g5.470ON435701412e-09
Smik_8.811.356ON468891402e-09
Kwal_55.212875.470ON461711394e-09
Suva_15.1991.356ON457631385e-09
KNAG0C020401.356ON464711375e-09
SAKL0E02200g2.502ON511941376e-09
Kpol_1056.372.502ON501631367e-09
SAKL0G03454g5.470ON468551368e-09
TBLA0A025705.470ON493861368e-09
TBLA0D049501.356ON468511351e-08
CAGL0I08965g1.356ON437691351e-08
SAKL0D09702g1.356ON428681351e-08
KAFR0C044001.356ON459711351e-08
AFR140C5.470ON388491341e-08
TPHA0O012801.356ON454511341e-08
TDEL0D022401.356ON433511322e-08
Skud_8.681.356ON475511322e-08
NDAI0A043505.470ON459551322e-08
NDAI0G059601.356ON423651323e-08
YHR016C (YSC84)1.356ON468511323e-08
Smik_8.472.502ON4471171313e-08
Kwal_0.3711.356ON217511284e-08
NCAS0A119205.470ON463591305e-08
TDEL0A033405.470ON473651305e-08
KLTH0H12980g1.356ON399511295e-08
KNAG0C046305.470ON516551305e-08
Skud_4.6615.470ON460551296e-08
Kpol_440.105.470ON470571296e-08
KAFR0E036405.470ON441551297e-08
AEL017W1.356ON416501289e-08
KLTH0D06138g2.502ON489531289e-08
KLLA0A08360g1.356ON423511289e-08
YDR388W (RVS167)5.470ON482551271e-07
CAGL0M01650g5.470ON466551261e-07
CAGL0K02761g2.502ON450861261e-07
Smik_4.6585.470ON472551261e-07
TBLA0B054702.502ON539521262e-07
KAFR0D033602.502ON455841252e-07
TBLA0F034901.356ON511511252e-07
Ecym_24402.502ON459571252e-07
ZYRO0D11110g5.470ON459551233e-07
Kpol_1008.251.356ON449691233e-07
Suva_8.512.502ON456521234e-07
Ecym_23165.470ON421761224e-07
ZYRO0G00792g1.356ON469511225e-07
TDEL0A027802.502ON451621217e-07
Skud_8.1752.159ON633521218e-07
TPHA0A022101.356ON397511209e-07
ABR008C2.502ON443771209e-07
Smik_8.1922.159ON633671201e-06
KLLA0B13475g2.502ON508891191e-06
Kwal_47.178942.159ON621821182e-06
NDAI0K021302.502ON459941163e-06
YHL002W (HSE1)2.502ON452521163e-06
KAFR0A009701.356ON396511153e-06
KLTH0E09790g2.159ON622851154e-06
TPHA0E015005.470ON457641137e-06
Ecym_23082.591ON678561138e-06
Suva_15.3102.159ON634671139e-06
YHR114W (BZZ1)2.159ON633671129e-06
ZYRO0B01298g2.502ON411531121e-05
Kwal_26.79022.502ON532531111e-05
SAKL0E10780g2.159ON625851102e-05
Skud_8.432.502ON454521102e-05
NCAS0A050802.502ON450941102e-05
ACR266W2.159ON626511102e-05
AGR306C5.170ON923581102e-05
TPHA0B028902.159ON634671083e-05
TPHA0G009302.319ON8241111083e-05
KAFR0F007502.159ON602831066e-05
CAGL0A02145g1.356ON391521057e-05
KLLA0F23848g2.159ON649491058e-05
KNAG0I015801.356ON581741041e-04
TDEL0E055204.45ON1589731041e-04
Kpol_1072.562.159ON637521013e-04
KLLA0E03059g5.470ON42869994e-04
Ecym_25266.366ON52451994e-04
ABR082W2.591ON68356994e-04
KNAG0A067102.502ON41952978e-04
KAFR0J026506.366ON55350960.001
Smik_10.2515.170ON112298950.001
TDEL0A078106.366ON55868950.002
TBLA0C055602.159ON67350940.002
NDAI0I002206.366ON61567940.002
ADL288C2.319ON92565940.002
KNAG0H035002.159ON63452920.003
NDAI0B043202.159ON63267920.003
Kpol_325.126.366ON57050920.003
Kpol_538.255.170ON70756920.003
Suva_2.564singletonON4339820.004
NCAS0A145707.419ON35595910.004
KLLA0E23365g8.539ON57557910.004
SAKL0E06820g2.319ON90564910.004
TBLA0F002806.366ON57651910.005
KAFR0L015807.365ON34463900.005
SAKL0A00594g6.366ON63653900.006
CAGL0C03597g6.366ON58053900.006
KLLA0E06953g7.419ON35779900.006
Smik_3.1866.366ON59163900.006
YCR088W (ABP1)6.366ON59263890.007
Ecym_11678.539ON550138890.008
AGL286C7.419ON330104880.009
SAKL0H10098g8.539ON55570880.009
NCAS0D047406.366ON59468880.009
YLR191W (PEX13)7.365ON38663880.009
ZYRO0D17358g6.366ON66850880.010
KLLA0E09043g2.319ON81476880.011
Smik_12.2517.365ON38863870.011
AGL237C6.366ON57851880.011
Skud_3.1606.366ON58653880.011
Ecym_71347.419ON33284870.012
KLTH0C06028g7.419ON34284870.012
ZYRO0B16214g2.159ON65948880.012
TPHA0K006807.419ON35552870.013
Suva_3.1246.366ON60053870.014
Skud_12.2567.365ON40363860.016
Smik_13.2022.591ON66368860.019
TPHA0F031007.365ON38166850.020
Suva_10.2877.365ON39263850.023
NDAI0A014707.419ON36784840.027
NCAS0B069802.159ON63966850.027
TDEL0B052202.159ON61367850.028
Ecym_54262.159ON67251840.031
Kwal_27.107077.419ON34384830.033
TPHA0H023806.366ON52867840.033
KNAG0I027006.366ON57550840.035
ZYRO0G10098g4.108ON139261840.044
YBL007C (SLA1)4.108ON124452830.056
YLL017WsingletonOFF10338770.057
Smik_2.1134.108ON123052820.058
KNAG0B050005.170ON85553820.070
NCAS0D019505.170ON93951820.073
Ecym_33662.319ON90653810.076
Suva_2.1184.108ON116652820.076
NDAI0C028305.170ON97785810.079
KLLA0A04983g4.108ON125160810.083
Skud_2.1044.108ON121452810.084
TBLA0D004507.413ON100554810.087
KLTH0A07348g6.366ON62651800.098
ZYRO0B04004g7.419ON37152800.10
SAKL0H21912g4.108ON125396810.10
Kwal_33.148357.365ON38460790.11
Ecym_47107.365ON39960790.12
Kwal_23.64376.366ON63151790.13
KAFR0K020007.419ON33259780.14
KLLA0F10175g6.366ON57650790.15
YMR032W (HOF1)2.591ON66967790.16
NCAS0A034904.108ON123556790.18
TDEL0G024902.319ON85084780.18
KAFR0J005805.170ON90267780.19
TBLA0A006108.539ON59747780.20
TDEL0F023804.108ON1255114780.21
KLTH0B04818g7.365ON38060770.22
TBLA0C064405.170ON131458780.24
TPHA0E007307.413ON97850770.24
Kwal_33.153395.170ON118456770.25
CAGL0E02783g4.108ON120361770.28
Kpol_1045.217.419ON358105760.28
KLLA0F14575g5.170ON85189760.32
Smik_12.474.45ON125181760.36
Ecym_72314.108ON114660760.38
AGR170C4.108ON112155760.41
Suva_10.4064.45ON158764760.42
KLTH0B02354g5.170ON121458750.45
Skud_13.1882.591ON66967750.46
KNAG0C033907.419ON34252740.50
KNAG0B022307.413ON90454750.52
TDEL0C028107.419ON33753740.53
Suva_5.2397.419ON36855740.53
Kpol_1024.458.539ON55456740.57
Kpol_2000.28.344ON22592730.62
Suva_13.2012.591ON66867740.62
Kwal_14.23134.45ON151767740.69
KAFR0I010404.108ON120380730.77
TPHA0F003804.45ON161845730.83
CAGL0C01881g7.413ON99955730.90
SAKL0G17600g4.335ON44140720.93
Smik_2.357.413ON98567721.0
KLTH0E07744g4.108ON124980721.1
TBLA0C041004.108ON1302117721.1
Smik_2.3408.539ON558102721.1
YBR200W (BEM1)8.539ON551102711.3
Ecym_82195.170ON102455721.3
Kwal_47.169434.335ON46044711.3
Skud_2.3268.539ON553102711.3
NDAI0A015007.413ON104749711.4
YJL020C (BBC1)5.170ON115785711.4
TDEL0B030708.539ON541106711.5
TBLA0I010507.419ON37151701.5
KNAG0C029104.108ON124454711.6
AEL241W8.539ON54952701.7
NDAI0A033304.108ON122660711.7
TPHA0L016608.539ON547108702.0
CAGL0G06842g5.170ON103955702.1
CAGL0E03476g4.45ON156444702.4
Skud_10.2005.170ON110186692.5
CAGL0F05885g2.591ON71277692.5
AGL293C7.413ON98454692.5
TBLA0H035908.539ON60067692.5
Kpol_1025.404.108ON120260692.5
ZYRO0D04004g8.539ON572137682.9
Kwal_27.120278.539ON499104683.0
NCAS0B022208.539ON55462674.4
Smik_5.2637.419ON36852674.4
Suva_12.605.170ON114153675.1
Suva_2.337.413ON98255665.8
Skud_12.514.45ON125455666.0
KLLA0E20879g7.413ON101590657.4
YER118C (SHO1)7.419ON36731657.6
Scer_YGOB_SDC25 (SDC25)4.45ON125238657.8
Smik_12.2381.55ON61651658.0
Kpol_1060.485.170ON104769658.3
Skud_5.2617.419ON37231648.4
KLLA0F27181g8.81ON807115658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18905
         (236 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   343   e-120
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   239   2e-79
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   190   2e-60
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   189   1e-59
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   186   1e-58
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   182   4e-57
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   181   1e-56
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   180   4e-56
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   179   5e-56
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   176   6e-55
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   170   3e-52
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   161   2e-48
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   160   4e-48
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   157   3e-47
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   154   5e-46
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   153   1e-45
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   141   2e-41
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   142   3e-41
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   141   5e-41
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   137   4e-39
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   132   4e-37
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   125   4e-35
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   124   3e-34
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   121   4e-34
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   111   2e-29
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    93   6e-22
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    85   5e-20
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    62   2e-10
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    62   2e-10
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    62   2e-10
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    61   3e-10
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    61   3e-10
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    60   8e-10
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    59   1e-09
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    59   1e-09
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    59   1e-09
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    59   2e-09
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    59   2e-09
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    58   4e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    58   5e-09
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    57   5e-09
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    57   6e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    57   7e-09
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    57   8e-09
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    57   8e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    57   1e-08
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    57   1e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    57   1e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    57   1e-08
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    56   1e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    56   1e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    55   2e-08
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    55   2e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    55   2e-08
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    55   3e-08
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    55   3e-08
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    55   3e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    54   4e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    55   5e-08
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    55   5e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    54   5e-08
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    55   5e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    54   6e-08
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    54   6e-08
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    54   7e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    54   9e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    54   9e-08
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    54   9e-08
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    54   1e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    53   1e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    53   1e-07
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    53   1e-07
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    53   2e-07
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    53   2e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    53   2e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    53   2e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    52   3e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    52   3e-07
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    52   4e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    52   4e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    52   5e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    51   7e-07
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    51   8e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    51   9e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    51   9e-07
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    51   1e-06
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    50   1e-06
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    50   2e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    49   3e-06
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    49   3e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    49   3e-06
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    49   4e-06
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    48   7e-06
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    48   8e-06
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    48   9e-06
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    48   9e-06
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    48   1e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    47   1e-05
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    47   2e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    47   2e-05
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    47   2e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    47   2e-05
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    47   2e-05
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    46   3e-05
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    46   3e-05
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    45   6e-05
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    45   7e-05
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    45   8e-05
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    45   1e-04
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    45   1e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    44   3e-04
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    43   4e-04
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    43   4e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    43   4e-04
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    42   8e-04
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    42   0.001
Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa] ...    41   0.001
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    41   0.002
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    41   0.002
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    41   0.002
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    41   0.002
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    40   0.003
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    40   0.003
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    40   0.003
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    40   0.003
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    36   0.004
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    40   0.004
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    40   0.004
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    40   0.004
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    40   0.005
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    39   0.005
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    39   0.006
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    39   0.006
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    39   0.006
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    39   0.006
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    39   0.007
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    39   0.008
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    39   0.009
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    39   0.009
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    39   0.009
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    39   0.009
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    39   0.010
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    39   0.011
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    38   0.011
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    39   0.011
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    39   0.011
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    38   0.012
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    38   0.012
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    39   0.012
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    38   0.013
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    38   0.014
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    38   0.016
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    38   0.019
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    37   0.020
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    37   0.023
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    37   0.027
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    37   0.027
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    37   0.028
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    37   0.031
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    37   0.033
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    37   0.033
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    37   0.035
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    37   0.044
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    37   0.056
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    34   0.057
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    36   0.058
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    36   0.070
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     36   0.073
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    36   0.076
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    36   0.076
NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {O...    36   0.079
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    36   0.083
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    36   0.084
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    36   0.087
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    35   0.098
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    35   0.10 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    36   0.10 
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    35   0.11 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    35   0.12 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    35   0.13 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    35   0.14 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    35   0.15 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    35   0.16 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    35   0.18 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    35   0.18 
KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.1...    35   0.19 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    35   0.20 
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    35   0.21 
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    34   0.22 
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    35   0.24 
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    34   0.24 
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    34   0.25 
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    34   0.28 
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    34   0.28 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    34   0.32 
Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W...    34   0.36 
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    34   0.38 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    34   0.41 
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    34   0.42 
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    33   0.45 
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    33   0.46 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    33   0.50 
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    33   0.52 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    33   0.53 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    33   0.53 
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    33   0.57 
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    33   0.62 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    33   0.62 
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    33   0.69 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    33   0.77 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.83 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    33   0.90 
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    32   0.93 
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    32   1.0  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    32   1.1  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    32   1.1  
Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W ...    32   1.1  
YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protei...    32   1.3  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    32   1.3  
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    32   1.3  
Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W ...    32   1.3  
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    32   1.4  
YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}...    32   1.4  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    32   1.5  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    32   1.5  
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    32   1.6  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    32   1.7  
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    32   1.7  
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    32   2.0  
CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa] ...    32   2.1  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   2.4  
Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa] ...    31   2.5  
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    31   2.5  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    31   2.5  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    31   2.5  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    31   2.5  
ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 ...    31   2.9  
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    31   3.0  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     30   4.4  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    30   4.4  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    30   5.1  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    30   5.8  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    30   6.0  
KLLA0E20879g Chr5 complement(1862894..1865941) [3048 bp, 1015 aa...    30   7.4  
YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}  ...    30   7.6  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    30   7.8  
Smik_12.238 Chr12 (458166..460016) [1851 bp, 616 aa] {ON} YLR177...    30   8.0  
Kpol_1060.48 s1060 (115796..118939) [3144 bp, 1047 aa] {ON} (115...    30   8.3  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    29   8.4  
KLLA0F27181g Chr6 complement(2510636..2513059) [2424 bp, 807 aa]...    30   8.4  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...    30   8.6  
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    30   8.8  
Kpol_1076.4 s1076 (7022..8185) [1164 bp, 387 aa] {ON} (7022..818...    29   8.9  

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  343 bits (879), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 179/236 (75%), Positives = 179/236 (75%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
           RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPS                       
Sbjct: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQYQPQQQYQQQYYQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                              GSSHT               IFGAGATIGSDIVNSIF
Sbjct: 181 GQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  239 bits (611), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 143/236 (60%), Positives = 154/236 (65%), Gaps = 3/236 (1%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSASSINRSLSTVRTELEFLRES+VI E SYRDIL  LPERY+P R      ++Q EFVE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           AIYAFQAQQDGDLNLQVGDK+EVLEKPSPEW+KG+CNGRVGMFPSNYVKPAFSGS  + E
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTTT-E 119

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
           RP VP PP+YQSQQ+VPQ TN SA S YSQPPFPP S                       
Sbjct: 120 RPVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTNYYQPPPQQYPQQYPQQQYYQA 179

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                               SS                 +FGAGATIGSDIVNSIF
Sbjct: 180 QQAPVAAPVAAPAAQQGH--SSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  190 bits (483), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/236 (46%), Positives = 135/236 (57%), Gaps = 28/236 (11%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+T+RTEL+FL+ESNVI+   +  I   LP R+ P  +     S+  E+VE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y F  QQDGDL L+ GDK+++LEK SPEWYKG CNGRVG+FP+NYVKPAFSGSN S  
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGS-- 118

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
             N+P PP+Y++Q++    T  SA S+Y Q PFPPPS                       
Sbjct: 119 -SNLPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTNYYQQPQQQPQQAPPQQQP--- 174

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                               SSH                IFGAGA+IGSDIVNSIF
Sbjct: 175 --------------------SSHN--HLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  189 bits (480), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 143/239 (59%), Gaps = 7/239 (2%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQS---E 57
           MSAS INRSL+ +RTEL+FL+ESNVI+E ++  I   LP+RY+P  S  +V SSQ+   E
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESV-SSQAPTLE 59

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNA 117
           +VEAIY F+ QQ+GDL L+ GDKI+V+EKPSPEW+KG+CNG+VG+FPSNYV+PAFSG++ 
Sbjct: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119

Query: 118 SLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXX 177
             +    P PP+YQ+  +  Q+ ++S+N +Y QPPFPP S                    
Sbjct: 120 PSKTRLTPGPPQYQA-SVETQSIHSSSNVSY-QPPFPPASTNYYQQPAQQPQAQYIPPPQ 177

Query: 178 XXXXXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                                    HT               IFGAGATIGSDIVNSIF
Sbjct: 178 PVQQVQQQVQQQPQQQQPQQQH-HHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  186 bits (471), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 91/157 (57%), Positives = 117/157 (74%), Gaps = 3/157 (1%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+ +RTEL+FL+ESNVI+   +  I   LP R++PP ++    S+  E+VE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y F  QQDGDL L+ GDKI++LEK SPEWYKG CNGR G+FP+NYVKPAFSGSN    
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG--- 117

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPS 157
           + N+P PP+Y++Q++ P  T  SA S+Y Q PFPPPS
Sbjct: 118 QSNLPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPS 154

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGA+IGSDIVNSIF
Sbjct: 196 IFGAGASIGSDIVNSIF 212

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  182 bits (463), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 114/243 (46%), Positives = 131/243 (53%), Gaps = 20/243 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+T+RTEL+FLRES VI+E +++ I   LP+RY+P  +     S   E+VE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           AIYAFQAQQDGDLNL+ GDKI+VLEKPS EWYKG+CNG VGMFPSNYVKPAFSGSN    
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTR 120

Query: 121 RPNVPAPPEYQSQQ-------IVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXX 173
                       Q        + PQ T++S     SQP FPPPS                
Sbjct: 121 EEPARPNLPPPPQYQSSPTVALQPQQTSSSTQL-ASQPQFPPPSTGFYQQPPQQYYQQPP 179

Query: 174 XXXXXXXXXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVN 233
                                     GS                  IFGAGATIGSDIVN
Sbjct: 180 VQQSPVQQPAPEQHAGHNGSQAFKKFGSK------------LGNAAIFGAGATIGSDIVN 227

Query: 234 SIF 236
           SIF
Sbjct: 228 SIF 230

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  181 bits (458), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 136/245 (55%), Gaps = 33/245 (13%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTP--TVPSSQS-- 56
           MSAS INRSL+ VRTEL+FLRES VI+E ++  I+  LP++Y+P +     +  SS+S  
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 57  --EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSG 114
             E+VEA+YAFQ QQDGDL L+ GDKI+VLEKPS EWYKG+C G+VGMFPSNYVKPAFSG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 115 SNASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQ---PPFPPPSXXXXXXXXXXXXXX 171
            +++ +RP  P P + Q Q +         N+ YSQ   PPFPP S              
Sbjct: 121 ESSAPKRPAGP-PYQPQQQHLAAPMYQQPQNTGYSQSSNPPFPPQSANYYPPQQQQQPQQ 179

Query: 172 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDI 231
                                          H                IFGAGATIGSDI
Sbjct: 180 VVVEQQ-----------------------QPHKHNAFKKFGSQLGNAAIFGAGATIGSDI 216

Query: 232 VNSIF 236
           VNSIF
Sbjct: 217 VNSIF 221

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  180 bits (457), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 138/249 (55%), Gaps = 25/249 (10%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRS-TPTVPSSQS--- 56
           MSASSINRSL+T+RTEL+FL+ESNVI++ ++  I   LP +Y+P  S  P++ SS +   
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 57  -----EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111
                EFVEAIY F+ QQ GDL L+ GDKIEV+EKPSPEW+KGRCNG+ GMFPSNYVKPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 112 FSGSNASLE---RPNVPAPPEYQSQQIVPQATNTSANSNYSQP-PFPPPSXXXXXXXXXX 167
           FSGS+ S+    RPN   PP+YQ+       T  S   ++ QP PFPP            
Sbjct: 121 FSGSSGSVNKVARPN--GPPQYQNS----LQTQNSHTPSFQQPAPFPP------ALTNYY 168

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATI 227
                                              H+               IFGAGATI
Sbjct: 169 QQQQPQFIQTPQQQQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATI 228

Query: 228 GSDIVNSIF 236
           GSDIVNSIF
Sbjct: 229 GSDIVNSIF 237

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  179 bits (454), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 132/236 (55%), Gaps = 21/236 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+ +RTEL+FL+ SNVI+   Y  I   LP +++P  +      +  E+VE
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y F  QQDGDL L+ GDK+++LEK SPEWYKG CNGR G+FP+NYVKPAFSGSN    
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGP-- 118

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
             N+P PP+Y++Q++    T  SA S+Y Q PFPPPS                       
Sbjct: 119 -SNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQ 177

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                               SSH+               IFGAGA+IGSDIVN+IF
Sbjct: 178 QQHQ----------------SSHS--HLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  176 bits (446), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 106/236 (44%), Positives = 127/236 (53%), Gaps = 35/236 (14%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+TVRTEL+FLRESNVI++  Y  +   LP+            +   E++E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ---------NASNKGGEYME 51

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y F  QQDGDL L  GDKIEVLEKPS EW+KGRCNGRVGMFP+NYVK A+SGS    +
Sbjct: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS----D 107

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
           RP+VP PP+Y+      Q TNT  +S   Q PFPPPS                       
Sbjct: 108 RPSVPPPPQYEQ----AQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQ 163

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                                 H+               IFGAGAT+GSD+VNSIF
Sbjct: 164 QQ------------------QHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  170 bits (431), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 130/236 (55%), Gaps = 19/236 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS +NRSL+ +RTEL+FL+ESNVI++  +  I   LP +++P  +     S+  E+VE
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y F  QQDGDL L+ GDK+++LEK SPEWYKG CNGR G+FP+NYVKP FS S+    
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDG--- 135

Query: 121 RPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSXXXXXXXXXXXXXXXXXXXXXXX 180
           +  +P PP+Y++Q++    T  S  S+Y   PFPPPS                       
Sbjct: 136 QHRLPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQ 195

Query: 181 XXXXXXXXXXXXXXXXXXXGSSHTXXXXXXXXXXXXXXXIFGAGATIGSDIVNSIF 236
                              G++                 IFGAGA+IGSDIVNSIF
Sbjct: 196 QQQQQSSSNNHLKSFGSKLGNA----------------AIFGAGASIGSDIVNSIF 235

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  161 bits (408), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 104/160 (65%), Gaps = 9/160 (5%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MS++ INRSL+T+RTEL FL +S VI       I   LP   E  R  P   +   E+VE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+YAFQAQQ GDL+ +VG+KIEVLEKPSPEWYKGRCNG+VGMFPSNYVKPAFSG +   E
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120

Query: 121 RPNVPAPPEYQSQQIVPQA-----TNTSANSNYSQPPFPP 155
                +PP Y +Q   PQ       +    + +SQ PFPP
Sbjct: 121 A----SPPRYPAQASAPQVQSPTPQSPPPPAGFSQSPFPP 156

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGAT+GSD+V+SIF
Sbjct: 241 IFGAGATLGSDLVHSIF 257

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  160 bits (404), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 101/130 (77%), Gaps = 2/130 (1%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSS--QSEF 58
           MS++SINRSL++V+TELEFLR+SNVI+  ++  I  +LP+R++P R +    +S    E+
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           VEAIY F  QQDGDL +Q GDKI+VLEK SPEWYKG+CNG+VG+FPSNYVKPAFSG +  
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGSNE 120

Query: 119 LERPNVPAPP 128
             R ++ +PP
Sbjct: 121 KSRSHLTSPP 130

 Score = 36.6 bits (83), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGAT+GSD+VNSIF
Sbjct: 223 IFGAGATLGSDLVNSIF 239

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  157 bits (396), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (76%), Gaps = 7/125 (5%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRS------TPTVPSS 54
           MS S INRSL+T+RTELEFL+ES VI+++ +++I   LPERY+P  +      T T  S+
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 55  QSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSG 114
             E+VEAIY F  QQDGDL +Q GDKI+VLEK SPEWYKG CNG+VG+FPSNY KPAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 115 S-NAS 118
           S NAS
Sbjct: 121 STNAS 125

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/17 (100%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGATIGSDIVNSIF
Sbjct: 204 IFGAGATIGSDIVNSIF 220

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  154 bits (389), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (71%), Gaps = 2/132 (1%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERY-EPPRSTPTVPSSQSEFV 59
           MS+S IN+SLST+ TEL+FL +SN I++ +Y  I  +LP R  E P    +  S   E+V
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASL 119
           EAIY F  QQDGDL L  GDKI V EKPSPEW+KG+CNG+VG+FPSNYV+PAFSGSN   
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120

Query: 120 ERPNVPAPPEYQ 131
            R +  APP+YQ
Sbjct: 121 SRSDA-APPQYQ 131

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGAT+GSD+VNSIF
Sbjct: 206 IFGAGATLGSDLVNSIF 222

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  153 bits (387), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 128/265 (48%), Gaps = 60/265 (22%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEP---------------- 44
           MS++ INR+++ ++TEL+FLRES +I +    +IL  LPE+Y+P                
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 45  -------------PRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEW 91
                          +TP  P++Q E+VEA+YAF+ QQ+GDL L  GDK+++LEKPS EW
Sbjct: 61  NAAANSSSASVDHASATPP-PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEW 119

Query: 92  YKGRCNGRVGMFPSNYVKPAFSGSNASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQP 151
           YKG CNG++GMFP+NYVKP    S A       P PP+YQ      Q +N     +YSQP
Sbjct: 120 YKGTCNGQIGMFPANYVKPVTKDSFA-------PPPPQYQ------QYSNNYQQPSYSQP 166

Query: 152 PFPPPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSHTXXXXXXX 211
            +PP S                                            S T       
Sbjct: 167 AYPPASTGYYQQPQQVQVQQPQQVQVQQQPQQ-----------------QSQTNEQLKRF 209

Query: 212 XXXXXXXXIFGAGATIGSDIVNSIF 236
                   IFGAGAT+GSD+VNSIF
Sbjct: 210 GSKLGNAAIFGAGATLGSDLVNSIF 234

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  141 bits (356), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 98/140 (70%), Gaps = 11/140 (7%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MS S+INRSL+ +R EL+FLRESNVI+E  +++I+  LP       ++P  P    E+VE
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN----GASPVPPPMSLEYVE 56

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120
           A+Y FQ QQDGDL ++ GDKI+VLEKPS EWY+G  NGR GMFPSNYV+PA +  +A+L 
Sbjct: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPA-AAPSANL- 114

Query: 121 RPNVPAPPEYQSQQIVPQAT 140
                APP Y + ++ PQ T
Sbjct: 115 -----APPAYDNPKLSPQPT 129

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGAT+GSD+VNSIF
Sbjct: 186 IFGAGATLGSDLVNSIF 202

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  142 bits (359), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 70/141 (49%), Positives = 102/141 (72%), Gaps = 12/141 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS +NRSL  +R ELEFL+ESNVI+   +  I   LPE+++  + +P    ++ E+VE
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFS------- 113
           A+Y F+AQQDGDL+L+ GDKI+VLEK SP+WY+G+ N ++G+FP+NYVKPAF+       
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPKS 119

Query: 114 ---GSNASLERPNVPAPPEYQ 131
               S++++ RP+VP PP Y+
Sbjct: 120 AEAASSSTVSRPSVP-PPSYE 139

 Score = 35.4 bits (80), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAG+ IGSDIVNSIF
Sbjct: 225 IFGAGSAIGSDIVNSIF 241

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  141 bits (356), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/152 (50%), Positives = 103/152 (67%), Gaps = 14/152 (9%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSA+ +NRSL  +R ELEFLRESNVI+   +  I   LPE++     +P    ++ E+VE
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS----- 115
           A+Y F+AQQDGDL+L+ GDKI+VLEK SP+WYKG+ N RVG+FP+NYVKPAF+ S     
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKP 119

Query: 116 -----NASLERPNVPAPPEYQ--SQQIVPQAT 140
                ++ + RP+VP PP Y+    Q  PQ T
Sbjct: 120 EEGDLSSKVSRPSVP-PPSYEPAVSQYPPQQT 150

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 16/17 (94%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAG+ IGSDIVNSIF
Sbjct: 225 IFGAGSAIGSDIVNSIF 241

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  137 bits (344), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 101/151 (66%), Gaps = 17/151 (11%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL+ +R ELEFL+ESNVI+   +  I   LP +++   S     +S  E+VE
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDE-NSKSANNASTEEYVE 59

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS----- 115
           A+Y F+AQQDGDL+L+ GDKI++LEK S +WYKG+ N  +G+FP+NYVKPAF+ S     
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPDF 119

Query: 116 -----NASLERPNVPAP------PEYQSQQI 135
                ++ + RP+VP P      PEY SQQ+
Sbjct: 120 EKTPLSSRVSRPSVPPPSYEPAVPEYSSQQV 150

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAG+TIGSDI+NSIF
Sbjct: 222 IFGAGSTIGSDIINSIF 238

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  132 bits (331), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 96/141 (68%), Gaps = 12/141 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60
           MSAS INRSL  +R EL+FL+ES VI++  +  I   LPE+++     P   +S  EFVE
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDV-NLRPVPNASVEEFVE 59

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS----- 115
           A+Y F+ QQ+GDL L+ GDKI++LEK SP+WY+G+ N RVG+FP+NYVKPAF+ S     
Sbjct: 60  ALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPEN 119

Query: 116 -----NASLERPNVPAPPEYQ 131
                ++ + RP+ P PP Y+
Sbjct: 120 EGASLSSKVSRPSAP-PPSYE 139

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAG+TIGSDIV+SIF
Sbjct: 233 IFGAGSTIGSDIVHSIF 249

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  125 bits (315), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 1/105 (0%)

Query: 5   SINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYA 64
           S+  S++T+++EL++L+E   + E +Y+DI  +LP R  P           +E VEA+YA
Sbjct: 3   SVEESVATIKSELKYLKEQGALAELAYKDIESLLP-RVRPQPPVADTMGQNNEIVEALYA 61

Query: 65  FQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           FQ QQDGDL L+ GDKIE+LEK SPEWYKG+CNG+VG+FPSNYVK
Sbjct: 62  FQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGATIGSD+VNSIF
Sbjct: 204 IFGAGATIGSDLVNSIF 220

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  124 bits (312), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 103/154 (66%), Gaps = 13/154 (8%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQ---SE 57
           MS+S INRSL+ ++TELEFL ESNVI+++  + IL ML      PR      +SQ    E
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSN----PREGTMKAASQQVLKE 56

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNA 117
           +VEA+YAF  QQ GDL  +VGDKIEVLEKPS +WYKG+ NGRVGMFPSNYVK   +  N 
Sbjct: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116

Query: 118 SLERPNVPAPPEYQSQQIVPQATNTSANSNYSQP 151
              R + P PP+Y    ++ Q T  S++SN+SQ 
Sbjct: 117 G--RFDEP-PPQYS---LMVQDTAHSSSSNHSQL 144

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  121 bits (304), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 3/89 (3%)

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS 115
            EFVEAIY F  QQ+GDL L  GDKIEVLEKPSPEW++GRCNGRVGMFPSNYVKPAFSG 
Sbjct: 3   GEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG- 61

Query: 116 NASLERPNVPAPPEYQSQQIVPQATNTSA 144
               +RP  P PP+Y  + +  Q +  +A
Sbjct: 62  --GFDRPAAPPPPQYDQKAMASQPSGGNA 88

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFGAGAT+GSD++NSIF
Sbjct: 142 IFGAGATLGSDLINSIF 158

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  111 bits (277), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 83/123 (67%), Gaps = 4/123 (3%)

Query: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPP---RSTPTVPSSQSE 57
           MS  S+NRS++ +RTELE+L ES VI+  ++ +    LP+ ++      +    P  + E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA-FSGSN 116
           +VEAI+ ++ Q+  DL LQVGDK+E+LEK S +WY+G+  G+VG+FPSNYVK   FSG +
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 117 ASL 119
            ++
Sbjct: 121 DAM 123

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 92.8 bits (229), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 88/161 (54%), Gaps = 9/161 (5%)

Query: 4   SSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPR----STPTV----PSSQ 55
           ++I  + + +R  LE L ++  I+E  Y +I  +L  +   P     S PT     P + 
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS 115
            ++VEAIYA+  +Q GDL L  GD IEV+ K SP+WY+GR NG+VG+FP+NYVK   S  
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDD 127

Query: 116 -NASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPP 155
            +++ +R  +  P    +    P +    ++ +Y   P PP
Sbjct: 128 RDSNYQRTGIKTPVPTSAPHSAPHSAPPPSHEDYDYTPPPP 168

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 47/63 (74%)

Query: 53  SSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAF 112
            SQ E+VE +Y F+ Q   DL+++ GDK+EV+EK S +WYKG+CNG+ GMFP+NYVKP  
Sbjct: 11  KSQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPVG 70

Query: 113 SGS 115
            G 
Sbjct: 71  GGD 73

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 16/17 (94%)

Query: 220 IFGAGATIGSDIVNSIF 236
           IFG GAT+G+D+V+SIF
Sbjct: 134 IFGVGATLGNDLVDSIF 150

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           + PT PS+ S    A+Y+F  ++ GDL  + GD I +L+K     +W+ GR NGR G+FP
Sbjct: 394 TAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFP 453

Query: 105 SNYVK 109
           +NYV+
Sbjct: 454 ANYVE 458

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           + PT PS+ S    A+Y+F  ++ GDL  + GD I +L+K     +W+ GR NGR G+FP
Sbjct: 393 TAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFP 452

Query: 105 SNYVK 109
           +NYV+
Sbjct: 453 ANYVE 457

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 2/60 (3%)

Query: 52  PSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           PSS +    A+Y F+ +QDGDL  + GD I +L+K +   +W+ GR NG+ G+FP+NYV+
Sbjct: 391 PSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           + PT   + +E V A+Y F  +Q GDL+ Q GDKI +L++     +W+ GR NG+ G+FP
Sbjct: 369 TDPTSGHASNEAV-ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFP 427

Query: 105 SNYVK 109
           +NYV+
Sbjct: 428 ANYVE 432

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 40  ERYEPPRST-PTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRC 96
           +RY  P+S     PSS +    A+Y+F  ++ GDL  + GD I +L+K     +W+ GR 
Sbjct: 367 DRYSRPKSDLQAAPSSTAPKAVALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRV 426

Query: 97  NGRVGMFPSNYVK 109
           NGR G+FP+NYV+
Sbjct: 427 NGREGIFPANYVE 439

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 6/92 (6%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y   +Q++ +L+ + GD I VLE+   +W++G  +G++G+FP NYV P    SN  
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELSNED 293

Query: 119 LERPNVPAPPEYQSQQIVPQATNTSANSNYSQ 150
           + + N       Q   I+ Q  N     +Y Q
Sbjct: 294 IIKEN------QQENNILSQKANIDQLQDYLQ 319

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 41  RYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNG 98
           RY   R+   VPSS  + V A+Y+F  ++  DL  + GD I +L+K     +W+ GR NG
Sbjct: 353 RYARTRNDSAVPSSAPKAV-ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNG 411

Query: 99  RVGMFPSNYVK 109
           R G+FP+NYV+
Sbjct: 412 REGIFPANYVE 422

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           + PT PS+ S    A+++F  ++ GDL  + GD + +L+K     +W+ GR NGR G+FP
Sbjct: 389 AAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFP 448

Query: 105 SNYVK 109
           +NYV+
Sbjct: 449 ANYVE 453

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           + PT PS+ S    A+Y F  ++ GDL  + GD I +L+K     +W+ GR +GR G+FP
Sbjct: 393 TAPTSPSTSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFP 452

Query: 105 SNYVK 109
           +NYV+
Sbjct: 453 ANYVE 457

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 42  YEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE--WYKGRCNGR 99
           Y PP    T P+S  E V A+Y +QAQ +GDL    G  IEV+E+ +    W+ GR NG 
Sbjct: 366 YTPP---TTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGY 422

Query: 100 VGMFPSNYVK 109
            G+FP NYV+
Sbjct: 423 QGVFPGNYVQ 432

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 10/89 (11%)

Query: 23  SNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIE 82
           SNV + +    + G+  E      STPT          A+Y F  +Q GDL  + GD I 
Sbjct: 386 SNVDDLSHKMTMTGIDDESSGAKSSTPTAV--------ALYNFAGEQSGDLAFKKGDVIS 437

Query: 83  VLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 438 ILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 7/71 (9%)

Query: 42  YEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE---WYKGRCNG 98
           Y PP    T P S  E V A+Y +QAQ +GDL    G  IEV+E+ +P+   W+ GR NG
Sbjct: 392 YTPPT---TAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNG 447

Query: 99  RVGMFPSNYVK 109
             G+FP NYV+
Sbjct: 448 YQGVFPGNYVQ 458

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 49  PTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSN 106
           PT   S ++   A+Y F  +Q GDL  + GD I +L+K     +W+ GR NG+ G+FP+N
Sbjct: 393 PTSLQSPTQTAVALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPAN 452

Query: 107 YVK 109
           YV+
Sbjct: 453 YVR 455

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 41  RYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNG 98
           R   P S+P++  S +    A+Y+F  ++ GDL  + GD I VL+K     +W+ GR NG
Sbjct: 394 RSTKPSSSPSI--SGAPKAVALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNG 451

Query: 99  RVGMFPSNYVK 109
           R G+FP+NYV+
Sbjct: 452 REGIFPANYVE 462

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 28  ETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKP 87
           +TSY  +   +P     P  TP    +  + V A+Y   A +  +L+ + GD I V+E+ 
Sbjct: 204 QTSYGVLASFVPT--SEPAPTPAPAQTVIKRVRAMYDLTATESDELSFKKGDVITVVEQV 261

Query: 88  SPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLER 121
             +W++G   GRVG+FP NYV P    +   LER
Sbjct: 262 YRDWWRGNIRGRVGIFPLNYVTPITEPTKEELER 295

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y   + +  +L+ + GD I VLE+   +W+KG   G +G+FP NYV P    SNA 
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNAE 299

Query: 119 LER 121
           LE+
Sbjct: 300 LEQ 302

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE--WYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ +GDL   VG  IEV+E+ +    W+ GR NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 7/86 (8%)

Query: 28  ETSYRDILGMLPERYEPPRSTPTVPSSQSEF--VEAIYAFQAQQDGDLNLQVGDKIEVLE 85
           + S   + G +P  Y    S   VP S   F  V A+Y +QAQ +GDL+   G  IE+++
Sbjct: 407 QNSNHSLAGSVPPSY---TSATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQ 463

Query: 86  KPSP--EWYKGRCNGRVGMFPSNYVK 109
           + +   EW+ G+ NG+ G+FP NYVK
Sbjct: 464 RTADINEWWTGKYNGQQGVFPGNYVK 489

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F  ++ GDL+ + GD I +++K     +W+ GRCNG  G+FP+NYV+
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query: 43  EPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRV 100
           EPPR      SS +    A+Y+F  ++ GDL+ + GD I +++K     +W+ G+ NGR 
Sbjct: 370 EPPRRDA---SSGAPKAVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGRE 426

Query: 101 GMFPSNYVK 109
           G+FP+NYV+
Sbjct: 427 GIFPANYVE 435

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVG 101
           PP S  +  SS +    A+Y F+ +Q GDL  + GD + +L+K     +W+ GR NG+ G
Sbjct: 359 PPVSRRSPASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEG 418

Query: 102 MFPSNYVK 109
           +FP+NYV+
Sbjct: 419 IFPANYVE 426

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 41  RYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNG 98
           R + P S+   P +      A+Y+F  ++ GDL  + GD I +L+K     +W+ GR NG
Sbjct: 392 RVDAPSSSSNAPKAV-----ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNG 446

Query: 99  RVGMFPSNYVK 109
           R G+FP+NYV+
Sbjct: 447 REGIFPANYVE 457

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYKGRCNGRVGMFPSNYV 108
           A+Y F AQ DGDL+  V   IE+L++     W+ GR NGR G+FP+NYV
Sbjct: 336 ALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F  ++ GDL+ + GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y+F  ++ GDL  + GD I +L+K     +W+ GR NGR G+FP+NYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           A+Y F  +Q GDL  + GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++E+ S   EW+ G+ NG+ G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFP 104
           S+P++   ++E V A+Y F  +Q GDL  + GD I V++K     +W+ G+   + G+FP
Sbjct: 357 SSPSIGLEKAEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFP 416

Query: 105 SNYVK 109
           +NYV+
Sbjct: 417 ANYVE 421

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           A+Y F  +Q GDL  + GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 37  MLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC 96
           +LP++   P +  T   +  + V A+Y     +  +L+ + GD I VLE+   +W+KG  
Sbjct: 195 VLPQQRNQPSAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGAL 254

Query: 97  NGRVGMFPSNYVKPAFSGSNASLERPNVPAPPEYQSQQIVPQ------ATNTSANSN 147
            G++G+FP NYV P    S   +E+        +  +  V Q      A + + NSN
Sbjct: 255 RGKMGIFPLNYVTPISEPSKEEIEKERTKEAMVFTQKATVDQLHKSLSAASKTGNSN 311

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F  +Q GDL  + GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 53  SSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           ++  E V A+Y +QAQ  GDL+   G  IE++E+     EW+ GR NG+ G+FP NYV+
Sbjct: 401 TAGGETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFP 104
           ST T     +  V A+Y +QAQ  GDL+   G  IEV+++     EW+ GR NG+ G+FP
Sbjct: 405 STATTAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFP 464

Query: 105 SNYVK 109
            NYV+
Sbjct: 465 GNYVQ 469

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F+ +Q GDL  + GD I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++++ +   EW+ GR NG+ G+FP NYV+
Sbjct: 459 ETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEK--PSPEWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 55  QSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           Q+E   ++Y +QAQ  GDL+   G  IE++E+ +   EW+ GR NG+ G+FP NYV+
Sbjct: 411 QAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE--WYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++++ + E  W+ GR NG+ G+FP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYV 108
           A+Y F+ +Q GDL  + GD I +L++     +W+ GR NG+ G+FP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111
           V A++    ++  +L+ + GD I V+E+   +W++GR  GRVG+FP NYV P 
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F+ ++ GDL  + GD I +++K     +W+ GR NG+ G+FP+NYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++++     EW+ GR NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IEV+++     EW+ GR NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 11/86 (12%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y   A +  +L+ + GD I VLE+   +W++G  +G++G+FP NYV P        
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPITE----- 271

Query: 119 LERPNVPAPPEYQSQQIVPQATNTSA 144
                 P+P E Q +Q + +   + A
Sbjct: 272 ------PSPVESQREQQIEEGVLSQA 291

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  IE++++     EW+ GR NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKP 110
           V A+Y   A + G+L+ + GD I+V+E+   +W++G   G VG+FP NYV P
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y F + +  +L+ + GD I VLE+   +W++G   GR+G+FP NYV P    +   
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPIMDPTPHE 275

Query: 119 LERPNVPAPPEYQSQQIVPQATNT 142
           L+         +  ++IV Q   T
Sbjct: 276 LQMAKQKESEIFGQREIVNQLHQT 299

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           A+Y+F  ++ GDL+ + GD I +++K     +W+ GR +GR G+FP+NYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%)

Query: 55  QSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111
           Q + V A+Y+  A +  +L+   GD I V+E+   +W++G   G+VG+FP NYV P 
Sbjct: 227 QVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEK--PSPEWYKGRCNGRVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+      IE++++   + EW+ GR +G+VG+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 43  EPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRV 100
           E P    T  SS +    A+Y+F  ++ GDL  + GD I +L+K     +W+ GR N   
Sbjct: 379 EKPSFGGTRQSSSTPKAIALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSE 438

Query: 101 GMFPSNYVK 109
           G+FP+NYV+
Sbjct: 439 GIFPANYVE 447

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKP 110
           V A+Y     +  +L+ + GD I VLE+   +W+KG   GR+G+FP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 38  LPERYEP-PRSTPTVPSSQS--EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKP-SPEWYK 93
           +P  Y P P +  T PS+    E   ++YAF AQ   DL       IE+L++  S  W+ 
Sbjct: 342 MPPAYSPSPYTAYTTPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWT 401

Query: 94  GRCNGRVGMFPSNYVK 109
           GR NG+ G+FP NYV+
Sbjct: 402 GRYNGQEGLFPGNYVR 417

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS--PEWYKGRCNGRVGMFPSNYVK 109
           A+Y F  ++ GDL  + GD I +L+K     +W+ GR  GR G+FP+NYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y   +++  +L+ + GD I VLE+   +W++G   G+VG+FP NYV P    S   
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTPIEEPSAEE 287

Query: 119 LE 120
           LE
Sbjct: 288 LE 289

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGMFPSNYVK 109
           +EA+YA++AQ D ++++ VGD+I V+       W  G C+G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYK--GRCNGRVGMFPSNYVKPAFSGS 115
           + +YA+  Q D ++++  GDKI ++ + +   W K      G  G+ P+ Y++ + + S
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAAS 557

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           A++ F+ +Q GDL+   GD + +L+K     +W+ GR N + G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 11/77 (14%)

Query: 43  EPPRSTPTVPSSQSEF-----------VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEW 91
           +PP+  P   +S++             V+AI+   A +  +L+ + GD I V+E+   +W
Sbjct: 188 QPPQQAPAALASETSLPEQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDW 247

Query: 92  YKGRCNGRVGMFPSNYV 108
           ++G   G+VG+FP NYV
Sbjct: 248 WRGLLRGKVGIFPVNYV 264

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PPR + T+P      +EA+YA++AQ D ++++ VGD I V+       W  G C+G  G+
Sbjct: 571 PPRRS-TLPIRT---LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGL 626

Query: 103 FPSNYVK 109
           FP++Y K
Sbjct: 627 FPTSYCK 633

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYK--GRCNGRVGMFPSNYVKPAFSGSN 116
           + +YA+  Q D ++++  GD+I ++ + +   W K      G  G+ P+ Y++ + + + 
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 117 ASLER---PNVPAP 127
            +  R   P VP P
Sbjct: 559 TANNRGPAPEVPPP 572

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y F + +  +L+ + GD I V+E+   +W++G   G VG+FP NYV P    S   
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPVTEPSQQE 286

Query: 119 LERPNVPAPPEYQSQQIVPQATNTSANSN 147
           L      A    + +Q+  Q  N     N
Sbjct: 287 L------AAERAKDEQVFAQKDNVDRLQN 309

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 29  TSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS 88
           T+Y DI      R   PR+ P      +  VEA+Y++QAQ + + +L  GD I VL+   
Sbjct: 542 TTYVDIKE--KARSSAPRAPPPRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADD 599

Query: 89  PE-WYKGRCNGRVGMFPSNYVK 109
              W  G  NG  G+FP++Y K
Sbjct: 600 GSGWTYGEVNGEKGLFPTSYCK 621

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y        +L+ + GD I VLE+   +W+KG+   + G+FP NYV P    ++  
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPVPEPTSEE 292

Query: 119 LERPNVPAPPEYQSQQIVPQATNTSANSNYSQPP 152
           L   N       Q ++ V Q  +T   +N +  P
Sbjct: 293 LRLGNERIASLLQQKRTVDQLHSTLKMNNSTASP 326

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKP 110
           V A+Y     +  +L+ + GD I VLE+   +W+KG   G +G+FP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYVK 109
           A+Y F  +++GDL  + GD I ++++     +W+ G  NG+ G+FP+NYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 11/85 (12%)

Query: 36  GMLPERY----EPPRST------PTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE 85
           G++P  Y    E PRS+      P    + +  V+A++ ++AQ D +++++ GD I VL+
Sbjct: 538 GLVPTSYIEINEKPRSSAPRAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLK 597

Query: 86  KPSPE-WYKGRCNGRVGMFPSNYVK 109
                 W  G  NG+ G+FP+NY +
Sbjct: 598 ADDGSGWTYGELNGQKGLFPTNYCQ 622

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 49  PTVPSSQS-EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPS 105
           P   ++Q+ E+  ++Y +QAQ  GDL+   G  I+++++ +   +W+ G  NG+ G+FP 
Sbjct: 391 PAYTTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPG 450

Query: 106 NYVK 109
           NYV+
Sbjct: 451 NYVQ 454

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 58  FVEAIYAFQAQQDGD-LNLQVGDKIEVLEKPSPEWYKGRC---NGRVGMFPSNYVK 109
           + +A+Y+F    + D LN Q+GD + + EK + +WY G     NGR G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PPR T  +P      +EA YA++A+ D ++++ VGD I V+       W  G C+G  G+
Sbjct: 572 PPRRTA-LPVRT---LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGL 627

Query: 103 FPSNYVK 109
           FP++Y K
Sbjct: 628 FPTSYCK 634

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYK--GRCNGRVGMFPSNYVKPA-FSGS 115
           + +YA+  Q   ++++  GDKI ++ + S   W K      G  G+ P+ YV+ +   G 
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRISNADGG 558

Query: 116 NASLER---PNVPAP 127
           +A+  R   P VP P
Sbjct: 559 DAANGRGPAPEVPPP 573

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           P RST  V +     +EAIYA++AQ D ++++  GD I V+       W  G C+G  G+
Sbjct: 572 PRRSTLPVRT-----MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGL 626

Query: 103 FPSNYVK 109
           FP++Y K
Sbjct: 627 FPTSYCK 633

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYK--GRCNGRVGMFPSNYVKPAFSGSN 116
           + +YA+  + D ++ +  GDKI ++ + +   W K      G  G+ P+ Y++ + + + 
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 117 ASLER---PNVPAP 127
            + +R   P VP P
Sbjct: 559 KANDRGPAPEVPPP 572

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111
           V+A+Y   + +  +L  + GD I VLE+   +W++G   G +G+FP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA 111
           V A++    +   +L+ + GD I V+E+   +W++G   G++G+FP NYV P 
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 10/85 (11%)

Query: 35  LGMLPERY-EPPRSTPTVPS--------SQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE 85
           +G++P  Y +   ST +VP         S    +EA+Y +QAQ D +L++  G  ++VL+
Sbjct: 541 MGLVPSSYVDIKESTHSVPHAPPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVLK 600

Query: 86  -KPSPEWYKGRCNGRVGMFPSNYVK 109
                 W  G  +G  G+FP++Y K
Sbjct: 601 PDDGSGWTYGELDGAKGLFPTSYCK 625

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKP 110
           V A+Y     +  +L+ +  D I VLE+   +W+KG   G++G+FP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118
           V A+Y   + +  +L+   GD I VLE+   +W++G   G  G+FP NYV P    +   
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTPISDPTPQE 279

Query: 119 LERPNVPAPPEYQSQQIVPQATNT-SANSNYSQP 151
           L+  N       Q +  V Q  +   +NSN + P
Sbjct: 280 LQMENERTTAILQQRNDVDQLHSILKSNSNTNDP 313

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYKGRCNGRVGMFPSNYV 108
           V AIY + AQ D +++++ GD I+VL   +   W  G  NG  G+FPSNY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR-----CNGRVGMFPSNYVKPA 111
           V A Y +++  DGDLN + G +IEV+     +WY G       N + G+FP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PP    T  + +   V+A+Y ++AQ D ++++ VGD I V++      W  G  NG  G+
Sbjct: 571 PPSRRKTTTTRK---VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGL 627

Query: 103 FPSNYVK 109
           FPS+Y K
Sbjct: 628 FPSSYCK 634

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG---RCNGRVGMFPSNYV------ 108
            V+A Y +  Q  GDL    GD + V  K + +WY G   R     G FP N+V      
Sbjct: 6   MVKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFVIELNGK 64

Query: 109 -KPAFSGSNASLERPNVPAPPEYQSQQI---VPQATNTSANSN-YSQPPFP 154
            KP+     A  + PN+P+  +Y++ Q    +P    ++ +SN YSQ   P
Sbjct: 65  TKPSVEAITADAKLPNIPSRSKYEASQSSPNLPSLIKSNGSSNLYSQSSTP 115

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 8/83 (9%)

Query: 35  LGMLPERY----EPPRSTPTVPSSQSEFV---EAIYAFQAQQDGDLNLQVGDKIEVLE-K 86
           +G++P  Y    EP R+ P+VP  + + V   E ++ + AQ D ++++ VGD + V++  
Sbjct: 520 VGVVPTSYIEIGEPVRAKPSVPPPRRKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGD 579

Query: 87  PSPEWYKGRCNGRVGMFPSNYVK 109
               W  G  NG  G+ P++Y K
Sbjct: 580 DGSGWTYGELNGLKGLVPTSYCK 602

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGRCNGRVGMFPSNYV 108
           V A+Y F  QQ GDL+ +  D I V +K     +W+ G  +G  G+FP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRCNGRVGMFPSNYV 108
           A Y +Q+Q   +L+LQVGDKI+VL E     W  G  NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 44  PPRSTPTVPS----SQSEFVEAI--YAFQAQQDGDLNLQVGDKIEVLEKPSP--EWYKGR 95
           PP   P  PS    S+    +A+  + F   + GDL  + GD I ++++     +W+ GR
Sbjct: 506 PPSQDPVSPSLGHPSEPNIAKAVALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGR 565

Query: 96  CNGRVGMFPSNYVK 109
            N R G+FP+NYV+
Sbjct: 566 INEREGLFPANYVE 579

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 46  RSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG---RCNGRV-- 100
           +S+P    S  + V AI+ +  +   +LNLQ GD I V+ K    W+ G     NG+V  
Sbjct: 38  QSSPICNVSPVDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHR 97

Query: 101 GMFPSNYVKPAFS 113
           G FP NY + + S
Sbjct: 98  GWFPQNYCRSSHS 110

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGMFPSNYVK 109
           VEAIY ++A  D +L++  G+ I+V+       W  G  NG  G+FPS+Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 42  YEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYKGRCNGRV 100
           Y PP S         E   A+Y + AQ +GDL    G  I+V+++     W+ G  NG  
Sbjct: 362 YTPPTSAGV------ETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQ 415

Query: 101 GMFPSNYVK 109
           G+FP NYV+
Sbjct: 416 GVFPGNYVE 424

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG--RCNGRVGMFPSNYVK 109
           A Y ++A +D +L  + GD+I  +E    +W+ G  +  G  G+FPSNYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 58  FVEAIYAFQAQQDGD-LNLQVGDKIEVLEKPSPEWYKGRC---NGRVGMFPSNYVK 109
           +  AIY+F    D D L  ++GD + + EK + +WY G     NG+ G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKP 110
           V A+Y  +     +L  +  D I V+E+   +W+ G    RVG+FP NYV P
Sbjct: 219 VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTP 270

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           A Y ++A +D +L  +  DKI  +E    +W+ G    NG  G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa]
           {ON} YJL020C (REAL)
          Length = 1122

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNGRV--G 101
           S P VP      V A + +++  + DLN +   +I V      EWY G     NG V  G
Sbjct: 2   SEPEVPFK----VVAQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGEVIEG 57

Query: 102 MFPSNYVKPAFSGSNASLERPNVPAPPEYQSQQIVPQA 139
           +FP ++V    S S   +E P + AP +  + Q  PQA
Sbjct: 58  IFPKSFVAAQVSESGEKVESPAIAAPTQQDTAQ--PQA 93

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 43  EPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRV 100
           EPP+  P  PS+ +E     Y ++A ++ +L     DKI  ++    +W+ G    NG  
Sbjct: 495 EPPK--PAAPSATAE-----YDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEK 547

Query: 101 GMFPSNYV 108
           G+FPSNYV
Sbjct: 548 GLFPSNYV 555

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGMFPSNYVK 109
           A+Y ++AQ D +++L VGD I+V++      W  G  N +  +FP++Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVIKPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYK--GRCNGRVGMFPSNYVK 109
           + +YA+    D ++++  GD I+V+EK +   W K      G +G+ PS+Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVG 101
           PPR T         +  A Y + A ++ +L     DKI  +E    +W+ G    NG  G
Sbjct: 545 PPRRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKG 604

Query: 102 MFPSNYV 108
           +FPSNYV
Sbjct: 605 LFPSNYV 611

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVKPAFSGSN 116
           V+A+Y++  + + DL     D IEV  K    W  GR   N + G FP NYV+  +   N
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 117 ASLER 121
             +ER
Sbjct: 71  GYIER 75

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGMFPSNYVK 109
           V A YA+ AQ D +L+L+ GD ++V++      W  G  +G  G+ P++Y K
Sbjct: 583 VTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PPR T T+PS     + A Y++ A  D ++++ VGD I V+       W  G  NG  G+
Sbjct: 570 PPRRT-TMPS---RTLTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGL 625

Query: 103 FPSNYVK 109
            P++Y K
Sbjct: 626 VPTSYCK 632

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYKGR--CNGRVGMFPSNYVK----PAF 112
           + +YA+  Q   ++++  GD I +L   +   W K R    G  G+ P+ YVK     A 
Sbjct: 497 KVLYAYAKQDTDEISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVKITENVAV 556

Query: 113 SGSNASLERPNVPAP 127
            G + +   P VP P
Sbjct: 557 DGGHGNGHAPAVPPP 571

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           A Y + A +D +L    GDKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGR-----VGMFPSNYVK 109
           V A+ A++ Q   DL +  GDKI VL      WY GR   +      G+FPS++VK
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 73  LNLQVGDKIEVLEKP--SPEWYKGRCNGRVGMFPSNYVK 109
           L    G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 14/95 (14%)

Query: 19  FLRE-SNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGD---LN 74
           F+ E SN    TS  D LG+  +  E    T TV        +A+Y+++A  D D   L+
Sbjct: 268 FMTETSNGYTATSMGDTLGLYNDL-EDENFTYTV--------KALYSYKAD-DSDAYELS 317

Query: 75  LQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
            + GD ++V +     W   + NG+ G+ PSNYVK
Sbjct: 318 FEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 53  SSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR--CNGRVGMFPSNY 107
           SS  + ++A+Y +QAQ  G+L+   GD   V ++   +WY+     +G+ GM P NY
Sbjct: 62  SSPEKVIKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFP 104
           +TP +P      V+AIY++  +++ DL     D IEV  K    WY GR   N + G FP
Sbjct: 4   TTPKLPFK----VKAIYSWSGEKEYDLGFIEEDIIEV-TKAKGGWYYGRLLRNKKSGSFP 58

Query: 105 SNYV 108
           +NYV
Sbjct: 59  ANYV 62

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVK 109
           A Y ++A +D +L     DKI  +E    +W+ G    +G  G+FPSNYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 54  SQSEFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMFPSN 106
           ++ EF  AIY F  +  + ++NLQ GD + +L K        +W+K R  NG VG  P N
Sbjct: 257 TKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFN 316

Query: 107 YVK 109
           Y++
Sbjct: 317 YIE 319

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVKPA 111
           A Y ++A ++ +L    GDKI  +E    +W+ G     G  G+FPSNYV+ A
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVELA 635

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           +  A Y ++A +D +L  +  DKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 33  DILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDG--DLNLQVGDKIEVLEKPSPE 90
           D LG+  +  E   S P          EA+Y +QA Q    +++ + G+ + V +     
Sbjct: 279 DTLGLYSDIGEELNSFPYTA-------EALYTYQADQTDAYEISFEQGEILRVGDIEGRW 331

Query: 91  WYKGRCNGRVGMFPSNYVK 109
           W   + NG  G+ PSNYVK
Sbjct: 332 WKAKKSNGETGIIPSNYVK 350

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 48  TPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPS 105
           TP     ++ +  A Y + A +D +L     DKI  +E    +W+ G    +G  G+FPS
Sbjct: 525 TPEKKPKENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPS 584

Query: 106 NYV 108
           NYV
Sbjct: 585 NYV 587

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 48  TPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPS 105
           TP     ++ +  A Y + A +D +L     DKI  +E    +W+ G    +G  G+FPS
Sbjct: 526 TPEKKPKENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPS 585

Query: 106 NYV 108
           NYV
Sbjct: 586 NYV 588

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 61/138 (44%), Gaps = 27/138 (19%)

Query: 36  GMLPERYEPPRSTPTVPSSQSEFVE----------------AIYAFQAQQDGDLNLQVGD 79
           GM+P+ Y  P S   V S+QS  V                  +Y F+A++  +L+   G+
Sbjct: 112 GMVPKSYFEPVSRSRVVSTQSILVSPQQAMQSVKAGSLYAIVLYDFKAEKSDELSAFAGE 171

Query: 80  KIEVLEKPSPEWYKGRCNGRV---GMFPSNYVKPA------FSGSNAS--LERPNVPAPP 128
            + +    + EW+  +  GR+   G+ P  +V          +G+N +  +E  N+P   
Sbjct: 172 NLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIIDINTGYATGNNVTDDIESVNLPTVQ 231

Query: 129 EYQSQQIVPQATNTSANS 146
           E++S     +A+N S  S
Sbjct: 232 EWKSNIAKYKASNISLGS 249

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVKPA 111
            ++A+Y + AQ  G+L+   G+ + V+ +   EW++     +GR GM P +Y +P 
Sbjct: 68  ILKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEVSSPDSGRKGMVPKSYFEPV 122

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 9/104 (8%)

Query: 8   RSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQA 67
           R+L T  T       +N   ET+  D LG+  +  +   + P          +A+YA++A
Sbjct: 226 RNLDTHGTSTYVTDTTNGNTETTMGDTLGLYSDMGDELVNFPYTA-------KALYAYEA 278

Query: 68  QQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
                 +++ Q G+ + V +     W   + NG  G+ PSNYV+
Sbjct: 279 DASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVE 322

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 40  ERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR--CN 97
           +R   P+S     SS  + ++A+Y +QAQ  G+L+   GD   VL +   EWY      +
Sbjct: 54  QRLNAPKSKDI--SSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTEDR-EWYDASNPSD 110

Query: 98  GRVGMFPSNY 107
           G+ GM P +Y
Sbjct: 111 GKRGMVPKSY 120

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 44  PPRSTPTVPSSQSE-FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRV 100
           PPR +      + E +  A Y ++A +D +L     DKI  +E    +W+ G    +G  
Sbjct: 523 PPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEK 582

Query: 101 GMFPSNYV 108
           G+FPSNYV
Sbjct: 583 GLFPSNYV 590

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 54  SQSEFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMFPSN 106
           S+ EF  A+Y F  +  + ++ L+ GD + +L K  P     +W+K R  NG +G  P N
Sbjct: 306 SKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYN 365

Query: 107 YVK 109
           Y++
Sbjct: 366 YIE 368

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           A Y + A +D +L  +  DKI  +E    +W+ G     G  G+FPSNYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVKPAFSGSN 116
           V+  +A+  ++  DL    GD IEV  + + +WY G+   N + G FPSNYV       N
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEV-TRVTGDWYFGKLIRNKKQGYFPSNYVSILEEQYN 69

Query: 117 ASL---ERPNVPAPPE 129
             L    + N+P  P+
Sbjct: 70  TYLPTKHQSNLPRSPQ 85

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 54  SQSEFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMFPSN 106
           S+ EF  A+Y F  +  + ++ L+ GD + +L K  P     +W+K R  NG +G  P N
Sbjct: 308 SKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYN 367

Query: 107 YVK 109
           Y++
Sbjct: 368 YIE 370

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCN--GRVGMFPSNYVK 109
           A Y ++A +D +L  + GD I  ++    +W+ G     G+ G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 28  ETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDG--DLNLQVGDKIEVLE 85
           ET+  D LG+  +  +   S P           A+YA++A +    +++ Q G+ + V +
Sbjct: 248 ETTMGDTLGLYSDVGDELISFPYTS-------RALYAYEADESDAYEISFQQGEILRVGD 300

Query: 86  KPSPEWYKGRCNGRVGMFPSNYVK 109
                W   R NG  G+ PSNYV+
Sbjct: 301 IEGRWWKAKRSNGETGIIPSNYVE 324

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 28  ETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDG--DLNLQVGDKIEVLE 85
           ET+  D LG+  +  +   S P V        +A+Y + A  +   +++ + G+ + V +
Sbjct: 259 ETTMGDTLGLYSDAGDELTSFPYV-------AKALYTYTADSNDAYEVSFEQGEMLRVGD 311

Query: 86  KPSPEWYKGRCNGRVGMFPSNYVK 109
                W   R NG  G+ PSNYV+
Sbjct: 312 IEGRWWKAKRANGETGIIPSNYVE 335

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 63  YAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRCNGRVGMFPSNYVK 109
           Y + AQ++ ++ ++VGD + VL E     W     +G  G+ P+NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 62  IYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCN--GRVGMFPSNYVKPAFSGSNAS 118
           +YAF+ + + ++++  GD I+VL       W K R N  G  G+ P++Y++      N+ 
Sbjct: 527 VYAFRGRDNDEVSVNPGDSIKVLAPDTGSGWTKLRNNTTGDQGLAPTSYLEINEKPINSH 586

Query: 119 LER---PNVPAP 127
            ER   P+VP P
Sbjct: 587 AERGVPPSVPPP 598

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQ-DG-DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           +A+Y++QA   DG +++ + G+ ++V +     W   R NG+VG+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  SQSEFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMFPSN 106
           S+ EF  A+Y F  +    ++ L  GD + +L K  P     +W+K R  NG++G  P N
Sbjct: 323 SKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYN 382

Query: 107 YVK 109
           Y++
Sbjct: 383 YIE 385

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 57  EFVEAIYAFQAQQD-GDLNLQVGDKIEVLEKPSPEWYKGRC--------NGRVGMFPSNY 107
           E+ +A+Y     +  G  N   GD I + E  + +WYKG          N RVG+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 108 VKPAFSGS 115
           ++    GS
Sbjct: 656 IQLLHQGS 663

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 51  VPSSQSEFVEAIYAFQ-AQQDGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMF 103
           +  S  EF  A++ F    +  +L L  GD + +L K  P     +W+K R  NG  G  
Sbjct: 301 IDLSNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYV 360

Query: 104 PSNYVK 109
           PSNY++
Sbjct: 361 PSNYIE 366

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  SQSEFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRC-NGRVGMFPSN 106
           S+ EF  A+Y F  +    ++ L+ GD + +L K  P     +W+K R  NG +G  P N
Sbjct: 312 SKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYN 371

Query: 107 YVK 109
           Y++
Sbjct: 372 YIE 374

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 29  TSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPS 88
           TS  D LG+  E  +    T TV        +A+Y++QA  D D      D+ E+L+   
Sbjct: 290 TSMGDTLGLYSEL-DDDNFTYTV--------KALYSYQAD-DADAYEISFDQGEILKVSD 339

Query: 89  PE--WYKG-RCNGRVGMFPSNYVK 109
            E  W+K  R NG+ G+ PSNYV+
Sbjct: 340 IEGRWWKAKRENGQTGIIPSNYVE 363

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PPR + T+P+     + A Y + AQ D ++++  GD I V+       W  G  NG  G+
Sbjct: 577 PPRRS-TLPTRT---MTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGL 632

Query: 103 FPSNYV 108
           FP++Y 
Sbjct: 633 FPTSYC 638

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRCNGRVGM 102
           PPR T  +P+     ++A Y ++AQ D +L+L   D + V+       W  G  NG  G+
Sbjct: 551 PPRRT-NMPTRT---MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGL 606

Query: 103 FPSNYVK 109
           FP++Y +
Sbjct: 607 FPTSYCR 613

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE-WYKGRCNGRVGMFPSNYV 108
           V A+Y + A+   +++++ GD I+V+   +   W  G   G  G+FPSNY 
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 28  ETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDG--DLNLQVGDKIEVLE 85
           ET+  D LG+  +  +   S P +        +A+Y + A  +   +++ + G+ + V +
Sbjct: 260 ETTMGDTLGLYSDAGDELSSFPYLA-------KALYTYTADSNDAYEVSFEQGETLRVGD 312

Query: 86  KPSPEWYKGRCNGRVGMFPSNYVK 109
                W   R NG  G+ PSNYV+
Sbjct: 313 IEGRWWKAKRANGETGIIPSNYVE 336

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 44  PPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR--CNGRVG 101
           PPR   T          A Y + A +D +L    G KI  +E    +W+ G     G  G
Sbjct: 458 PPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKG 517

Query: 102 MFPSNYV 108
           +FP+NYV
Sbjct: 518 LFPANYV 524

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           A Y + A ++ +L     DKI  +E    +W+ G    NG  G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKP 110
           V+A+Y ++ Q D +L ++  D + +LEK    EW+  K R  G       G+ PSNYV+P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 111 A 111
           A
Sbjct: 68  A 68

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRC--NGRVGMFPSNYVKPA 111
           Y F A+   +L ++ GDK+ +L +K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 34.3 bits (77), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 57 EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG 94
          + VE  Y +  +    L+L+VGD I VL K S  W+ G
Sbjct: 29 DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRC--NGRVGMFPSNYVKPA 111
           Y F A+   +L ++ GDK+ +L +K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 5/67 (7%)

Query: 59  VEAIYAFQAQQDGD--LNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPAFSG 114
           V AIY +   Q+ D  L     D  +V +    +W   K   +   G  P NYV+PA  G
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA-DG 132

Query: 115 SNASLER 121
           S    ER
Sbjct: 133 SAPKQER 139

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           AIYA++ Q   +L +Q  D + +L+K    +W+  K R  G      VG+ PS Y++ A
Sbjct: 10  AIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEA 68

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC---NGRV--GMFPSNYV 108
           A +A++++ + DLN + G KI V      EWY G      G V  G+FP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           V+A + ++++ + DLN      I V      EWY G    + G+FP ++VK
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVK 109
           V A+Y++  +Q  DL     D IEV  K   +W  GR   N + G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRC--NGRVGMFPSNYVKPA 111
           Y F A+   +L ++ GDK+ +L +K S +W+  +   +G+ G+ P+ +V+P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {ON}
           Anc_5.170
          Length = 977

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV----GMFPSNYVKPAFSG 114
           V A + +Q+  + DLN +    I V      EWY G  N       G+FP ++V  A   
Sbjct: 10  VVAQFPYQSGYEDDLNFEKDQVITVTSIEDDEWYYGEYNDGTHVLEGIFPKSFVAVALEK 69

Query: 115 SNASLERPNV-PAPPEYQSQQIVPQ 138
                + P V P  PE+   + +PQ
Sbjct: 70  EPTQKQLPTVQPVEPEHVLSKSLPQ 94

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +A+Y + AQ D +L ++ GD + +LEK S  +W+  K R  G      VG+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLQVGDKIEVLE-KPSPEWYKGRC--NGRVGMFPSNYVKPA 111
           Y F A+   +L ++ GDK+ +L+ K S +W+  +   +G+ G+ P+ +++P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS---PEWYKG--RCNGRVGMFPSNYVK 109
           A+  +Q + D +LN+  GDKI+VL   S     WY G        G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVK 109
           A Y  +A++  +L  + GDKI  +     +W+ G     G  G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           + +Y +QA +D   +++ + G+ ++V +     W   R  G  G+ PSNYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 59  VEAIYAFQAQQ--DGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPAFS- 113
            +A+Y +   Q  D +L    GD+ +V +   P+W     + +G +G  P NYV+ + + 
Sbjct: 74  AKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEAT 133

Query: 114 --GSNASLERPNVPAPPEYQSQQIVPQATNTSANSN 147
             GSN+       P PP++ S+Q   +AT   +N N
Sbjct: 134 PVGSNS------FPPPPQHVSKQA--RATTDVSNIN 161

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVK-- 109
           +AIYA+Q Q   +L +   D + +L+K    +W+  K R  G      VG+ P+NY++  
Sbjct: 9   KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIEQA 68

Query: 110 PAFSGSNASLERPNVPAPPE 129
           P  S + A  +   V  P E
Sbjct: 69  PVISHAKALYDYDQVQNPDE 88

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 57  EFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRCN-GRVGMFPSNYVK 109
           EF  AIY F  +    +L L+ GD + V+ K  P     EW++ R   G +G  P NY++
Sbjct: 308 EFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNYLE 367

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 57  EFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRCN-GRVGMFPSNYVK 109
           EF  A+Y F  +    + +L+ GD + ++ K  P     +W+K R   G VG  PSNY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVK 109
           A Y  +A++  +L  + GDKI  +     +W+ G     G  G+FPSNYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 60  EAIYAFQAQQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSN 116
           +A+Y++QA +    +++ + G+ + V +     W   R NG  G+ PSNYV+   S +N
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQLINSETN 331

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYV 108
           A Y ++A +D +L  +  ++I  ++    +W+ G    +G  G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 57  EFVEAIYAFQAQQD-GDLNLQVGDKIEVLEKPSPEWYKGRC--------NGRVGMFPSNY 107
           E+ +A+Y     +  G  N   GD + + E  + +WYKG          N R+G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 108 VKPAFSG 114
           ++    G
Sbjct: 662 IQLLHQG 668

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 59  VEAIYAF-QAQ-QDGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKP 110
           ++A+Y + +AQ Q+ +L     D  +V +   P+W   K R +  VG  P NYV+P
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEP 129

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +AIY ++ Q   +L +   D + +LEK    EW+  K R  G      VG+ PSNY++ A
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 9/84 (10%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRV-GMFPSNYVKPAFSGS 115
           V+A Y +  Q  GDL    GD +EV  + + +W+ G+   N +  G FP+N+V       
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFVNVLEEQL 71

Query: 116 NASL--ERPNVPAPPEYQSQQIVP 137
           N S   E P V   P   S+ I+P
Sbjct: 72  NKSTLAESPEVVNTP---SKVIIP 92

>KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.170
           YJL020C
          Length = 902

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 9/67 (13%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC---NGRV--G 101
           S P+VP      V A YA+Q++ + DLN      I+V      EWY G     +G++  G
Sbjct: 2   SEPSVPFE----VIAQYAYQSEYEDDLNFDKNQIIKVTSVEDDEWYLGEFTDDDGQLLSG 57

Query: 102 MFPSNYV 108
           +FP ++V
Sbjct: 58  IFPKSFV 64

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 55  QSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVG 101
           +S +   +Y F+A ++ +L +  G+ + +      EW+ GR  GR+G
Sbjct: 162 KSLYALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIG 208

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 10  LSTVRTELEFLRESNVINE--TSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAF-- 65
           L+    EL +L E + ++E  T  + ++G   +  EP    P+    Q+  + ++ A   
Sbjct: 22  LAIREDELLYLLEKSDVDEWWTVKKRVIG--SDADEPVGLVPSNYVEQAPVINSVRALYD 79

Query: 66  --QAQQ-DGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPAFSG 114
             QAQ  D +L     ++ +V +   P+W   + +  G  G  P NYV+P   G
Sbjct: 80  YDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPCGQG 133

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 57  EFVEAIYAFQAQQ-DGDLNLQVGDKIEVLEKPSP-----EWYKGRCN-GRVGMFPSNYVK 109
           EF  A+Y F  +    +  L+ GD + V+ K  P     EW++ R   G VG  PSNYV+
Sbjct: 311 EFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYVE 370

>TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON}
           Anc_5.170 YJL020C
          Length = 1314

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNG-----RVGMFPSNYVKPA 111
           V A + + ++ + DLN      I V      EWY G   G     RVG+FP ++V  A
Sbjct: 7   VVATFPYTSEYEDDLNFDKDQTITVTAIEDDEWYSGEYLGPDGVMRVGIFPRSFVAAA 64

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 7/50 (14%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPS---PEWYKGRCNGRV---GMFP 104
           AI  ++ + + +LN+Q+GDKI+V+   S     WY G+ N R    G++P
Sbjct: 38  AINQYEKRMEDELNMQLGDKIQVITDDSEYNDGWYYGK-NLRTQEEGLYP 86

>Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa]
           {ON} YJL020C (BBC1) - 1:1 [contig 290] FULL
          Length = 1184

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNG-----RVGMFPSNYVK 109
           V A + + ++ + DLN + G +I V      EWY G         R G+FP ++VK
Sbjct: 10  VIAQFPYSSEHEDDLNFEKGRRITVQSIEDEEWYFGEYRTEDGEFREGIFPRSFVK 65

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVL-EKPSPEWYKGRC--NGRVGMFPSNYVKPAFSGSNA 117
           A+Y F+A+   +L ++ GD + V+ +K S +W+      NG+ G+ P+ +++  FS S  
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE--FSKSKE 434

Query: 118 S 118
           S
Sbjct: 435 S 435

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 59  VEAIYAFQAQQD--GDLNLQVGDKIEVLEKPSPEW--YKGRCNGRVGMFPSNYVKPA 111
           + A+Y F   Q+   +L  +  D  +V +   P+W   +   +   G  P NYV+PA
Sbjct: 74  MRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGNYVEPA 130

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 16/105 (15%)

Query: 7   NRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQ 66
           N +++T  TE      SN   ET+  D LG+  E      S P           A+Y++Q
Sbjct: 260 NENVNTFVTE-----SSNGNTETTMGDTLGLYSEF--GDESFPYTA-------RALYSYQ 305

Query: 67  AQQ-DG-DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           A   DG +++ + G+ ++V +     W   +  G VG+ PSNYV+
Sbjct: 306 ADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 15/89 (16%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNGRV--GMFPSNYVKPAFS 113
           VEA++ + +  + DL    G  I VLE    EW+ G     +G+   G+FP  +V     
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFVSEPLK 66

Query: 114 GSNAS-------LERPNVPAP---PEYQS 132
            + +         E+PNV  P   PE Q+
Sbjct: 67  ETASEPAQEKQPEEKPNVETPVKIPETQT 95

>Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W
           (REAL)
          Length = 1251

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 51  VPSSQ-SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG----RCNGRVG--MF 103
           VP  Q  + VE I  +   +   L+L++GD I VL K S  W+ G     C    G  M 
Sbjct: 22  VPCLQPIDVVECICEYFINKRNKLSLRIGDLIYVLNKGSSGWWDGVLIRHCANDSGPLML 81

Query: 104 PSNYVKPAFSGSNASLERPNV 124
              +  P+F+ S     R N+
Sbjct: 82  DRGWFPPSFTRSILHETRRNL 102

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +AIY+++ Q D +L ++  D + VLEK    +W+  K R  G      VG+ P+NY++ A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 59  VEAIYAFQAQQ--DGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVK 109
           V ++Y ++  Q  D +L  + GD+ +V +    +W   + R +G VG  P NYV+
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVE 128

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 11/64 (17%)

Query: 58  FVEAIYAFQ--AQQDGD---LNLQVGDKIEVLEKPSPEWYKGRC----NGRV--GMFPSN 106
            V A Y F    ++DG    L++Q GD I +L K S  W+ G      +G+V  G FP N
Sbjct: 65  IVVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQN 124

Query: 107 YVKP 110
           + +P
Sbjct: 125 FGRP 128

>KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakly
           similar to uniprot|P47068 Saccharomyces cerevisiae
           YJL020C BBC1 Protein possibly involved in assembly of
           actin patches interacts with an actin assembly factor
           Las17p and with the SH3 domains of Type I myosins Myo3p
           and Myo5p localized predominantly to cortical actin
           patches
          Length = 1214

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNG-----RVGMFPSNYVKPA 111
           V A + + ++ D DLN + G  I V      EWY G         + G+FP ++VK A
Sbjct: 10  VIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFGEYQDESGTYKEGIFPRSFVKLA 67

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 57  EFVEAIYAFQAQQD-GDLNLQVGDKIEVLEKPSPEWYKGRC--------NGRVGMFPSNY 107
           E+ +A+Y     +  G  N   GD + + E  + +WYKG          + RVG+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 108 VKPAFSG 114
           ++    G
Sbjct: 662 IQLLHQG 668

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           +A+Y++ A  +   +++ + G+ ++V +     W   R NG  G+ PSNYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 62  IYAFQAQQDGDLNLQVGDKIEVLEKP---SPEWYKGRCNGR---VGMFPSNYVK 109
           I  +  + + +L+L  GD+IEVLE        WY G+   R   VG+FP  + K
Sbjct: 25  INRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE--WYKG-RCNGRVGMFPSNYVK 109
           + +Y++QA   GD      D+ E+L+    E  W+K  R NG  G+ PSNYV+
Sbjct: 279 KTLYSYQADA-GDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 59  VEAIYAFQAQQDGDLNLQVG-DKIEVLEKPSPE--WYKGR-CNGRVGMFPSNYVK 109
            +A+Y + A  DGD   ++  ++ E+L+    E  W+K R  NG  G+ PSNYV+
Sbjct: 306 AKALYPYDA--DGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYV 108
           S +   +Y FQA++  +L + VG+ + +    + EW+  +  GR+   G+ P ++V
Sbjct: 154 SLYAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 32.7 bits (73), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 3/92 (3%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGR--VGMFPSNYVKPAFSGSNAS 118
           A+Y F  + D +L L+ GD + +  K    W      GR   G+ P  +V          
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV-SFLEDDEDY 165

Query: 119 LERPNVPAPPEYQSQQIVPQATNTSANSNYSQ 150
            +     A P Y +Q I     +TS N++Y++
Sbjct: 166 EDEDEDKARPFYLTQFITQSINSTSTNTSYNE 197

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 57  EFVEAIYAFQAQQD-GDLNLQVGDKIEVLEKPSPEWYKGRC--------NGRVGMFPSNY 107
           E+ +A+Y     +  G  N   GD I + E  + +W+KG          + RVG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 108 VKPAFSG 114
           ++    G
Sbjct: 661 IQLLHQG 667

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 14/67 (20%)

Query: 57  EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG------------RCNGRVGMFP 104
           + V A   F A +   L L VGD + VL K    W+ G            RC    G FP
Sbjct: 24  DVVIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHRCVR--GWFP 81

Query: 105 SNYVKPA 111
            N+ +PA
Sbjct: 82  QNHTRPA 88

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVK-- 109
           +AIY+++ Q   +L LQ  D + +LEK    +W+  K R  G       G+ PSNY++  
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

Query: 110 PAFSGSNASLERPNVPAPPE 129
           P  S   AS +   V  P E
Sbjct: 69  PVISKVKASYDYEQVQNPDE 88

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 40/102 (39%), Gaps = 14/102 (13%)

Query: 59  VEAIYAFQAQQ--DGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPAFSG 114
           V+A Y ++  Q  D +L     D  EV +    +W   K       G  P NYV+P   G
Sbjct: 74  VKASYDYEQVQNPDEELTFHENDIFEVYDDKDQDWLLVKSLSTNEFGFVPGNYVEPYTEG 133

Query: 115 SNASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPP 156
           + A+        P        +P A  T+A SN     F PP
Sbjct: 134 AMAT------SGPITAN----LPTAQPTTATSNVGAATFMPP 165

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 70  DGDLNLQVGDKIEVLEKPSPEWYKG-RCNGRV---GMFPSNYVKP 110
           D  L    GDKI VL K    W+ G   +G+V   G FP ++VKP
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKP---SPEWYKGRC--NGRVGMFPSNYVKP 110
            +  ++ + + +++++ GDKIEVL         WY+G+     +VG++P+ + +P
Sbjct: 7   CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 72  DLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVK 109
           DL  + GD I V++K    W+ G      R G FP N+V+
Sbjct: 397 DLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKP---SPEWYKGRCNGRV---GMFPSNYVKPAFSG 114
           A+  +  + + +LN++ GDKIEV+      +  WY GR N R    G++P+ + K     
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTKKITLD 78

Query: 115 SNASLER 121
            + SL +
Sbjct: 79  KSESLRK 85

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +A++ ++ Q D +L +  GD + +L+K    +W+  K R  G      VG+ P+NY++ A
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

Query: 112 --FSGSNASLERPNVPAPPE 129
                + A  + P V  P E
Sbjct: 69  DILYTAKAVYDYPEVQNPEE 88

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 17/117 (14%)

Query: 10  LSTVRTELEFLRESNVINE--TSYRDILGMLPERYEPPRSTPTVPSSQSEF------VEA 61
           L+    +L +L E + +++  T  + +LG   +  EP   T  VPS+  E       V+A
Sbjct: 22  LAIEEDDLLYLLEKSDVDDWWTVKKRVLGT--DADEP---TGLVPSNYVEEAPIISQVKA 76

Query: 62  IYAFQAQQDGDLNLQVGDK--IEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPAFSG 114
           IY +   Q+ D  L   +    +V +    +W   K R   +VG  P NYV+P   G
Sbjct: 77  IYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEPISGG 133

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +A+YA++ Q   +L ++  D + +LEK    +W+  K R  G       G+ PSNYV+ A
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVEEA 68

>Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W
           (REAL)
          Length = 558

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYVK--- 109
           S +   +Y F+A++  +L   VG+ + +    + EW+  +  GR+   G+ P  +V    
Sbjct: 158 SLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIID 217

Query: 110 --PAFSGSNASLER---PNVPAPPEYQSQQIVPQATNTSANS 146
               ++  N  +E     N+P   E++S     +A+N S  S
Sbjct: 218 IATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGS 259

>YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protein
           containing SH3-domains, involved in establishing cell
           polarity and morphogenesis; functions as a scaffold
           protein for complexes that include Cdc24p, Ste5p,
           Ste20p, and Rsr1p
          Length = 551

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYVK--- 109
           S +   +Y F+A++  +L   VG+ + +    + EW+  +  GR+   G+ P  +V    
Sbjct: 157 SLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIID 216

Query: 110 --PAFSGSNASLER---PNVPAPPEYQSQQIVPQATNTSANS 146
               ++  N  +E     N+P   E++S     +A+N S  S
Sbjct: 217 IATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGS 258

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRC-----NGRVGMFPSNYV 108
           V A ++++++   DL+   G KI V+     +WY G         R G+FP ++V
Sbjct: 13  VVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGIFPKSFV 67

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 69  QDGDLNLQVGDKIEVLEKPSPEWYKG---RCNGRVGMFPSNYVK 109
           Q  DLN +  + I+V++K    W+ G   R   R G FP+NYV+
Sbjct: 413 QSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKR-GYFPANYVE 455

>Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W
           (REAL)
          Length = 553

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYVK--- 109
           S +   +Y F+A++  +L   VG+ + +    + EW+  +  GR+   G+ P  +V    
Sbjct: 158 SLYAIVLYDFKAEKADELTTFVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIID 217

Query: 110 --PAFSGSNASLER---PNVPAPPEYQSQQIVPQATNTSANS 146
               ++  N  +E     N+P   E++S     +A+N S  S
Sbjct: 218 IATGYATGNDVIEDINSVNLPTVQEWKSNIAKYKASNISLGS 259

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVL---EKPSPEWYKGRC--NGRVGMFP 104
            I  +  + + +L+++ GDKIEVL   E+ +  WY GR    G  G++P
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYP 94

>YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}
           BBC1Protein possibly involved in assembly of actin
           patches; interacts with an actin assembly factor Las17p
           and with the SH3 domains of Type I myosins Myo3p and
           Myo5p; localized predominantly to cortical actin patches
          Length = 1157

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNGRV--GMFPSNYVKPAFS 113
           V A + +++  + DLN +   +I V      EWY G     NG V  G+FP ++V  A  
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFV--AVQ 67

Query: 114 GSNASLERPNVPAPPEYQSQQIVPQ 138
           GS    E  + P     + + I P+
Sbjct: 68  GSEVGKEAESSPNTGSTEQRTIQPE 92

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 45/106 (42%), Gaps = 11/106 (10%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYVK-----PAF 112
            +Y FQA++  +L    G+ + +    + EW+  +  GR+   G+ P  +V        +
Sbjct: 155 VLYDFQAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVAFVSIVDIASGY 214

Query: 113 SGSN---ASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPP 155
           +  N     +   N+P   E++      +A+N S  S   Q   PP
Sbjct: 215 ATGNDVREDINSVNLPTVQEWKGNIAKYKASNISLGSVEHQSAAPP 260

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           A+Y+++A ++   +++ +  + +EV +     W   R NG  G+ PSNYV+
Sbjct: 318 ALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 61  AIYAFQAQQ--DGDLNLQVGDKIEVLEKPSPEWYKGRC--NGRVGMFPSNYVKP 110
           A+Y +   Q  D +L  +  D  ++ +   P+W   R   +G VG  P NYV+P
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCN--GRVGMFPSNY 107
            ++A+Y + AQ  G+L+   G+  +V      EWY+      GR GM P +Y
Sbjct: 66  ILKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTSTEGGRKGMVPKSY 116

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +AIY ++ Q   +L L+  D + +LEK    +W+  K R  G      VG+ PSNY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 59  VEAIYAFQAQQ--DGDLNLQVGDKIEVLEKPSPEWY--KGRCNGRVGMFPSNYVKPA 111
           V+A+Y ++  Q  + +L     D   V +   P+W   K + +  VG  P NYV+P 
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPV 130

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 50  TVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSN 106
           T PSS    V  +Y FQA++  +L   VG+ + +    + EW+  +  GR+   G+ P +
Sbjct: 144 TQPSSLYGIV--LYDFQAEKADELTAYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPID 201

Query: 107 YV-----KPAFSGSNA---SLERPNVPAPPEYQSQQIVPQATNTSANS 146
           +V        F+  N     +   N+P   E++S     + +N +  S
Sbjct: 202 FVSIIDISTGFATGNKIKDDIIAANLPTVKEWKSNVTKYKNSNIALGS 249

>CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa]
           {ON} weakly similar to uniprot|P47068 Saccharomyces
           cerevisiae YJL020c
          Length = 1039

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR-CNG----RVGMFPSNYV 108
           V A + +Q++ + DLN + G  I V      EWY G   +G      G+FP ++V
Sbjct: 8   VVASFPYQSEYEDDLNFEKGQVITVTNIEDDEWYYGEYVDGTGASHEGIFPKSFV 62

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 73  LNLQVGDKIEVLEKPSPEWYKG-----RCNGRV-GMFPSNYVKP 110
           L++Q GD + VL K    W+ G     + +  V G FP NY KP
Sbjct: 38  LSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKP 81

>Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa]
           {ON} YJL020C (REAL)
          Length = 1101

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNGRV--G 101
           S P VP      V A + +++  + DLN +   +I +      EWY G     +G +  G
Sbjct: 2   SEPEVPFK----VVAQFPYKSDYEDDLNFEKDQEITITSVEDAEWYYGEYRDSSGDIVEG 57

Query: 102 MFPSNYVKPAFSGSNASLERPNVPAP 127
           +FP ++V    SGS    E     AP
Sbjct: 58  IFPKSFVAIQTSGSLKESESAATAAP 83

>CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032w HOF1
           involved in cytokinesis
          Length = 712

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 12/77 (15%)

Query: 45  PRSTPTVPSSQSE---FVEAIYAFQAQQDGDL-NLQVGDKIEVLEKPSPEWYKGRCNGRV 100
           P + PT+     E   F +A+Y     +  +L N + GD + + E  + +WY+G   G  
Sbjct: 630 PVTLPTITKEGEEVIKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNS 689

Query: 101 --------GMFPSNYVK 109
                   G+ PSN+++
Sbjct: 690 NTTTTHGNGLIPSNFIQ 706

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVL---EKPSPEWYKGRC--NGRVGMFPSNYVK 109
           AI  +  + + +L+++ GDKIEV+   ++ +  WY GR    G  G++P  + +
Sbjct: 34  AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQ 87

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 46  RSTPTVP-SSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---G 101
           R+TP     S + +   +Y FQA++  +L +  G+ + +    + EW+  +  GR+   G
Sbjct: 149 RTTPNESIKSGNMYAIVLYDFQAEKSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPG 208

Query: 102 MFPSNYV 108
           + P ++V
Sbjct: 209 LVPVDFV 215

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPS-PEWY--KGRCNGR-----VGMFPSNYVKPA 111
           +AIY ++ Q   +L +Q  D + +LEK +  +W+  K R  G       G+ PSNYV+ A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 572

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 59/137 (43%), Gaps = 19/137 (13%)

Query: 38  LPERYEPPRSTPTVPSSQSE-------FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPE 90
           L +R +      +V S QS+       +   +Y FQA++  +L    G+ + +    + E
Sbjct: 129 LADRNKSISRHASVLSQQSDISKMGTLYAIVLYDFQAEKGDELTSYAGENLFICAHHNFE 188

Query: 91  WYKGRCNGRV---GMFPSNYVK-----PAFSGSN---ASLERPNVPAPPEYQSQQIVPQA 139
           W+  +  GR+   G+ P  +V        ++  N     +   N+P   E++S     +A
Sbjct: 189 WFIAKPIGRLGGPGLVPVGFVSIIDITTGYATGNDVKEDINYVNLPTVQEWKSNIARYKA 248

Query: 140 TNTSANS-NYSQPPFPP 155
           +N S  S  ++QP   P
Sbjct: 249 SNISLGSVEHAQPSSVP 265

>Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]
           {ON} YBR200W (BEM1) - contains two SH3 domains [contig
           24] FULL
          Length = 499

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 50/104 (48%), Gaps = 11/104 (10%)

Query: 54  SQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRV---GMFPSNYV-- 108
           S S +   +Y F+A++  +L    G+ + +    + EW+  +  GR+   G+ P  +V  
Sbjct: 93  SGSLYAIVLYDFRAEKSDELTTYAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSI 152

Query: 109 ---KPAFSGSNA---SLERPNVPAPPEYQSQQIVPQATNTSANS 146
              +  ++  N     +   N+P+  E++++    +A+N S +S
Sbjct: 153 IDIETGYATGNKINDDIASVNLPSVQEWKTRVAKYKASNISLSS 196

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 44  PPRSTPTVPSSQSE----FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGR 99
           P R++ T    QS+    +   +Y F+A++  +L    G+ + +    + EW+  +  GR
Sbjct: 141 PKRTSQTSSMEQSKMGSLYAIVLYDFKAEKSDELTAYAGENLFICAHHNYEWFIAKPIGR 200

Query: 100 VG 101
           +G
Sbjct: 201 LG 202

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVK 109
           +A+Y + A  +   +++ +  + ++V +     W   R NG  G+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON}
           YJL020C (REAL)
          Length = 1141

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNGRV--GMFPSNYV 108
           A + +++  + DLN +   +I V      EWY G     NG +  G+FP ++V
Sbjct: 12  AQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGDIVEGIFPKSFV 64

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKP---SPEWYKGRCNGRV---GMFPSNYVK 109
           A+  +  + + +L+++ GDKIEV+      +  WY GR N R    G++P+ + K
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
          (REAL)
          Length = 1254

 Score = 30.0 bits (66), Expect = 6.0,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 40 ERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG 94
          ER E P   P       + VE IY    +    L+L++GD + VL K S  W+ G
Sbjct: 18 ERREVPCLQPI------DVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWDG 66

>KLLA0E20879g Chr5 complement(1862894..1865941) [3048 bp, 1015 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1015

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 26  INETSYRDILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLE 85
           I+ T+ R   G +P   E P      P         I  +  + D +L+++ GDKI+V+ 
Sbjct: 12  IDTTNLRSTSGGVPSVGETPLGAGFQPQKTFPLFICITEYSKRMDDELDMRPGDKIQVVT 71

Query: 86  KP---SPEWYKGRCNGRV---GMFPSNYVK 109
                +  WY G+ N R    G++P  + +
Sbjct: 72  DDGSYNDGWYFGK-NLRTQEEGLYPKVFTQ 100

>YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}
           SHO1Transmembrane osmosensor involved in activation of
           the Cdc42p- and MAP kinase-dependent filamentous growth
           pathway and the high-osmolarity glycerol response
           pathway; phosphorylated by Hog1p; interacts with Pbs2p,
           Msb2p, Hkr1p, and Ste11p
          Length = 367

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 82  EVLEKPSPE--WYKGR-CNGRVGMFPSNYVK 109
           E+L+    E  W+K R  NG  G+ PSNYV+
Sbjct: 327 EILQVSDIEGRWWKARRANGETGIIPSNYVQ 357

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
          1252 aa] {ON} ANNOTATED BY YGOB - skipping over
          frameshift in strain S288c
          Length = 1252

 Score = 29.6 bits (65), Expect = 7.8,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 57 EFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKG 94
          + VE  Y +  +    L+L+VGD I VL K S  W+ G
Sbjct: 29 DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Smik_12.238 Chr12 (458166..460016) [1851 bp, 616 aa] {ON} YLR177W
           (REAL)
          Length = 616

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 107 YVKPAFSGSNASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPS 157
           Y++P ++ +N+SL+ P   AP EY   Q  P   N   N+       PPP+
Sbjct: 186 YLQPVYTNNNSSLQMP-YTAPSEYTQHQQYPSPFNARRNTQPVVNLHPPPA 235

>Kpol_1060.48 s1060 (115796..118939) [3144 bp, 1047 aa] {ON}
           (115796..118939) [3144 nt, 1048 aa]
          Length = 1047

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 47  STPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGR---CNG--RVG 101
           S P+VP      V A + + ++ + DLN      I V      EWY G     +G  + G
Sbjct: 2   SQPSVPFE----VVAHFPYASEYEDDLNFDKDQVINVTSVEDDEWYYGEYKTADGVMKEG 57

Query: 102 MFPSNYVKP 110
           +FP ++V P
Sbjct: 58  IFPKSFVSP 66

>Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C
           (REAL)
          Length = 372

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 82  EVLEKPSPE--WYKGR-CNGRVGMFPSNYVK 109
           E+L+    E  W+K R  NG  G+ PSNYV+
Sbjct: 332 EILQVSDIEGRWWKARKANGETGIIPSNYVQ 362

>KLLA0F27181g Chr6 complement(2510636..2513059) [2424 bp, 807 aa]
           {ON} similar to uniprot|P22516 Saccharomyces cerevisiae
           YPL008W
          Length = 807

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 49/115 (42%), Gaps = 1/115 (0%)

Query: 33  DILGMLPERYEPPRSTPTVPSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWY 92
           D    LPE YE    +      + +  + I    A+ D   +++  + +E L+ P   ++
Sbjct: 147 DETNFLPEPYEQDSVSNQNDYEKGQINDEIQKLLAKIDKGYDVKTENNME-LKSPLKIYF 205

Query: 93  KGRCNGRVGMFPSNYVKPAFSGSNASLERPNVPAPPEYQSQQIVPQATNTSANSN 147
             R + ++  F S    P+F  S+ +LE+  +   P    +Q+   A  +   S+
Sbjct: 206 SSRTHSQLTQFASQLTLPSFPPSSPTLEKERIKFLPLASRKQLCIHAKVSKLKSD 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,042,488
Number of extensions: 818610
Number of successful extensions: 3666
Number of sequences better than 10.0: 303
Number of HSP's gapped: 3588
Number of HSP's successfully gapped: 351
Length of query: 236
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 130
Effective length of database: 41,326,803
Effective search space: 5372484390
Effective search space used: 5372484390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)