Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.189033.500ON1131134533e-59
KLTH0G02354g3.500ON140462036e-21
TDEL0D056803.500ON140441602e-14
SAKL0F02508g3.500ON140451593e-14
ZYRO0D09724g3.500ON139461575e-14
NCAS0F035903.500ON140441298e-10
Kpol_480.93.500ON141501262e-09
Suva_16.4813.500ON139441252e-09
Smik_16.4053.500ON139441229e-09
YPR153W3.500ON140441211e-08
Skud_16.4473.500ON140441159e-08
TPHA0A057103.500ON141421088e-07
CAGL0L08382g3.500ON140441071e-06
AFR319W3.500ON141501052e-06
TBLA0C045203.500ON14044949e-05
KNAG0A079803.500ON14744810.006
KLLA0E03895g3.500ON14043790.014
KAFR0G037303.500ON14444760.033
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18903
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...   179   3e-59
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...    83   6e-21
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...    66   2e-14
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...    66   3e-14
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...    65   5e-14
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...    54   8e-10
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...    53   2e-09
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...    53   2e-09
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...    52   9e-09
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...    51   1e-08
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...    49   9e-08
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....    46   8e-07
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...    46   1e-06
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...    45   2e-06
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....    41   9e-05
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...    36   0.006
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...    35   0.014
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    34   0.033

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score =  179 bits (453), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 89/113 (78%), Positives = 89/113 (78%)

Query: 1   MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMHXXXXXXXXX 60
           MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMH         
Sbjct: 1   MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMHFLCVIFFVV 60

Query: 61  XXXPETVNLLTHITDSQSRIKPDCLRCLRGYRYAVXXXXXXXXXXXXTQWRAL 113
              PETVNLLTHITDSQSRIKPDCLRCLRGYRYAV            TQWRAL
Sbjct: 61  FVCPETVNLLTHITDSQSRIKPDCLRCLRGYRYAVLLSLFSSMSALLTQWRAL 113

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score = 82.8 bits (203), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 38/46 (82%), Positives = 43/46 (93%)

Query: 1   MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           MGFY AAGLWAS+SHR+ A GLWIMAFY+LVGGFQA+AAGTVTGL+
Sbjct: 55  MGFYTAAGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLI 100

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score = 66.2 bits (160), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/44 (72%), Positives = 35/44 (79%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY  AGLWAS SHRR AGGLWIMA Y++ GG QAVAAGTV G +
Sbjct: 57  FYGIAGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFL 100

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score = 65.9 bits (159), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/45 (66%), Positives = 38/45 (84%)

Query: 2   GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           GFY +AGL AS SHR+TAGG+WIM FY++ GG QA+A+GTV GL+
Sbjct: 56  GFYGSAGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLL 100

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa]
          {ON} similar to uniprot|Q06HN0 Saccharomyces cerevisiae
          YPR153W Hypothetical ORF
          Length = 139

 Score = 65.1 bits (157), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (71%)

Query: 1  MGFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           GFYA  GLWAS SHR+ AGGLWIMA Y   GG Q VA GT+TG +
Sbjct: 54 FGFYALTGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFL 99

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score = 54.3 bits (129), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 30/44 (68%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY AAGL AS SHRRT GG+WIM  Y+   G Q +A GT+ G +
Sbjct: 57  FYGAAGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFL 100

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 2   GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMH 51
           GFY  +GL AS +HR+ AGGLWIM  Y+ +G  Q V  GTVTG +  +++
Sbjct: 57  GFYLISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIY 106

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
          (REAL)
          Length = 139

 Score = 52.8 bits (125), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%)

Query: 3  FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
          FY AAGL+AS++HR+ AG +WI   YV  GG Q + AGT+ G +
Sbjct: 56 FYVAAGLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFL 99

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
          (REAL)
          Length = 139

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%)

Query: 3  FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
          FY   GL+AS++HR+ AG LWI + YV+ GG Q +  GTV G +
Sbjct: 56 FYIVTGLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFL 99

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY  AG++AS++HR+ AG +WI   YVL GG Q +  GTV G +
Sbjct: 57  FYVTAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFL 100

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score = 48.9 bits (115), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (63%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY   GL+AS++HR+  G +WI   YV+ GG Q +  GTV G +
Sbjct: 57  FYVTTGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFL 100

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON}
          Anc_3.500 YPR153W
          Length = 141

 Score = 46.2 bits (108), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 3  FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTG 44
          FY  AG  A  +HR+  GG WI+A Y+++GG Q +  GT+ G
Sbjct: 58 FYGVAGALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIG 99

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY  AGL+AS++H +  GGLWI   Y+L  G Q +  GTV G +
Sbjct: 57  FYGGAGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFL 100

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 2   GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLMYVKMH 51
           G Y A GL A  SHRR  GG+ I+A Y+L+G   A+  GT +GL+   ++
Sbjct: 57  GMYGAVGLIAGYSHRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIY 106

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score = 40.8 bits (94), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY   G  A VSHR   G +WI+  Y+  G  Q + AGT+ G M
Sbjct: 57  FYGVTGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYM 100

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY  +GL A++SH +    + I+  Y+L  G Q V  G + GL+
Sbjct: 64  FYGTSGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLL 107

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 4   YAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           Y   G  A  +H++   G W++  Y+++G  QA  +GTV G++
Sbjct: 58  YGTTGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGIL 100

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 33.9 bits (76), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46
           FY +AG  A ++ ++ +  L I A Y + GG Q V  GTV G +
Sbjct: 61  FYVSAGAVACLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFL 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.137    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,913,158
Number of extensions: 186040
Number of successful extensions: 463
Number of sequences better than 10.0: 19
Number of HSP's gapped: 463
Number of HSP's successfully gapped: 19
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)