Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.188953.498ON44344319810.0
KLTH0G02398g3.498ON4624599691e-127
SAKL0F02552g3.498ON4784797843e-99
KLLA0E03939g3.498ON4354435942e-71
Skud_16.4463.498ON4564475866e-70
TDEL0D056603.498ON4424665847e-70
TPHA0A056903.498ON4784785667e-67
Suva_16.4803.498ON4524555562e-65
Kpol_480.113.498ON4634765352e-62
KNAG0A079703.498ON3884485258e-62
YPR152C (URN1)3.498ON4654565134e-59
Smik_16.4043.498ON4604565091e-58
Ecym_12313.498ON3292384842e-56
KAFR0G037203.498ON4094504884e-56
AFR317C3.498ON3282514521e-51
ZYRO0D09768g3.498ON4602374006e-43
CAGL0L08404g3.498ON4104423652e-38
NCAS0F035803.498ON4134423433e-35
NDAI0B059003.498ON5222552644e-24
TBLA0D029303.498ON2761732114e-18
KAFR0A002302.649ON556791133e-05
NCAS0C051102.649ON60478990.001
TBLA0C009302.649ON65889990.002
Skud_11.2172.649ON583269890.028
Ecym_33972.649ON57553870.037
TDEL0F009908.134ON78979860.066
KLLA0E13575g8.134ON81979840.11
Smik_11.2432.649ON57980830.12
ZYRO0E00682g2.649ON57027830.12
ADL055C8.134ON81779830.13
Suva_11.2162.649ON58578830.14
KNAG0M024702.649ON60686830.15
SAKL0H24552g8.134ON79079830.15
KAFR0B021008.134ON80079820.17
Kwal_47.173028.134ON78779820.17
CAGL0K02255g8.134ON82279820.17
KLTH0E06908g8.134ON79179820.17
Ecym_83948.134ON84179820.18
CAGL0L05368g2.649ON59082820.18
Kpol_1031.398.134ON81579820.18
Skud_5.2538.134ON80979820.19
Smik_5.2718.134ON80879820.19
Suva_5.2468.134ON80979820.19
ZYRO0G18920g8.134ON81979820.19
YER125W (RSP5)8.134ON80979820.20
NCAS0B045408.134ON83579820.21
TBLA0G027908.134ON84479820.21
NDAI0B024608.134ON83679810.22
KNAG0D021808.134ON81179810.23
TPHA0D010308.134ON82279810.25
NDAI0G046002.649ON64798810.26
Kpol_1073.42.649ON53082790.38
YKL012W (PRP40)2.649ON58378770.66
KLTH0C00924g2.649ON56426751.1
TPHA0L020202.649ON58381751.2
ACL120W5.135ON16356721.2
KLLA0E18239g2.649ON57179741.6
Kwal_14.9392.649ON56278704.1
SAKL0G19360g2.649ON56878696.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18895
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   767   0.0  
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   377   e-127
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   306   3e-99
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   233   2e-71
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   230   6e-70
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   229   7e-70
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   222   7e-67
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   218   2e-65
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   210   2e-62
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   206   8e-62
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   202   4e-59
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   200   1e-58
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   191   2e-56
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   192   4e-56
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   178   1e-51
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   158   6e-43
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   145   2e-38
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   136   3e-35
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   106   4e-24
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    86   4e-18
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    48   3e-05
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    43   0.001
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    43   0.002
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    39   0.028
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    38   0.037
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    38   0.066
KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} high...    37   0.11 
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    37   0.12 
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    37   0.12 
ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON} S...    37   0.13 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    37   0.14 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    37   0.15 
SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} high...    37   0.15 
KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.1...    36   0.17 
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    36   0.17 
CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa] ...    36   0.17 
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    36   0.17 
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    36   0.18 
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    36   0.18 
Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON} (93761....    36   0.18 
Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON...    36   0.19 
Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W ...    36   0.19 
Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W ...    36   0.19 
ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} high...    36   0.19 
YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3 ubi...    36   0.20 
NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134     36   0.21 
TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.1...    36   0.21 
NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134     36   0.22 
KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {O...    36   0.23 
TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.1...    36   0.25 
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    36   0.26 
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    35   0.38 
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    34   0.66 
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    33   1.1  
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    33   1.2  
ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic hom...    32   1.2  
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    33   1.6  
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    32   4.1  
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    31   6.0  

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/443 (86%), Positives = 382/443 (86%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNVYQ 120
           ALIICNTGLRFFYNSESHTSRW               REKLVLLVGVAKGFDPGDRNVYQ
Sbjct: 61  ALIICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFDPGDRNVYQ 120

Query: 121 ELSDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYGXXXXXXXXXXXXXXXXXXX 180
           ELSDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYG                   
Sbjct: 121 ELSDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYGSSDESDKDEDEEEEENDEG 180

Query: 181 XXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDP 240
               AVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDP
Sbjct: 181 DSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDP 240

Query: 241 LFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHI 300
           LFYKITNDADRKELFENWCMNECSNQSEVPA            PAIDSLEPSRYHYLAHI
Sbjct: 241 LFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPSRYHYLAHI 300

Query: 301 VSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIF 360
           VSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIF
Sbjct: 301 VSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIF 360

Query: 361 KRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQED 420
           KRFLE           NQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQED
Sbjct: 361 KRFLEGKKKALKKGLKNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQED 420

Query: 421 VQYYVLGIKDKTVALRDILKDLI 443
           VQYYVLGIKDKTVALRDILKDLI
Sbjct: 421 VQYYVLGIKDKTVALRDILKDLI 443

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  377 bits (969), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/459 (44%), Positives = 276/459 (60%), Gaps = 23/459 (5%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           M R WREYKTPDG+KYYYN+NTK+ST + PDDF+E Q+   KSR++D    F + L NDW
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDW 65

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNVYQ 120
            L +C  G RFFY S +  SRW               + KLVLL+  A+GFD G+R+VYQ
Sbjct: 66  VLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGERDVYQ 125

Query: 121 ELSDSISELKEDSNNRDFRK--ETAEESIPTAV--------PGQ---SLVSGYGXXXXXX 167
           EL + I+ LK+     +  +  E AEE   TA         P Q   +L+S Y       
Sbjct: 126 ELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYESSDEDG 185

Query: 168 XXXXXXXXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYS 227
                              S     ++D++DL     +++ +    F SLF +Y +DPYS
Sbjct: 186 DSSDEINAEKEVH------SDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYS 239

Query: 228 TWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQS--EVPAXXXXXXXXXXXXPA 285
           TWNMQS+KI D+PLFY++ +DA+R+ELFE+WC+ +   +   E PA              
Sbjct: 240 TWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDD 299

Query: 286 ID--SLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSK 343
                LEP+RYHYLAHIVSK+++  STLP+D+R++QK+LFKQF+IK+SL K++QD FLSK
Sbjct: 300 TSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESLGKKQQDEFLSK 359

Query: 344 LLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQLLI 403
           LLFYYK MT EQR+ +  +FL+           N E+L ++LS   LP   +AIE+QLL 
Sbjct: 360 LLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQDLPTSGFAIESQLLR 419

Query: 404 LEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDL 442
           LEDCID HG +  LQ++VQYYVLGIK KT AL++ LK L
Sbjct: 420 LEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLKQL 458

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  306 bits (784), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/479 (38%), Positives = 252/479 (52%), Gaps = 43/479 (8%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           MA  W E+ TP G KYYYNL TK+ST E P  FD DQ S RK +KL  KP + + L   W
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKPAGFD-DQKS-RKRQKLQHKPKYLVPLDKGW 58

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNVYQ 120
           +L++CNTG +F++N  ++ S W               +EKLVLL+G+++G+    RNVY 
Sbjct: 59  SLVLCNTGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRNVYD 118

Query: 121 ELSDSISELKEDS-NNRDFRKETA---EESIPTAVPGQ----SLVSGYGXX-------XX 165
           E+ + +  LK+ S   +    E A   EE +     G+     LV+GYG           
Sbjct: 119 EIINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENIE 178

Query: 166 XXXXXXXXXXXXXXXXXXXAVSCTNVPDADVDDLGTVL--PEHDYSNDAEFISLFSKYAV 223
                              A     V  AD+D+L  +   P+ D  N   F  LF KY +
Sbjct: 179 EEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKN--RFTILFDKYNL 236

Query: 224 DPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXX- 282
           DPYS W  QSRKI  DP FY +TN + RK+LFE WC    +N  +  +            
Sbjct: 237 DPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQR 296

Query: 283 ---------------------XPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKE 321
                                 P  ++LEP+R+HYL+HI+SKS I  +T+  DI+ + K 
Sbjct: 297 QESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKA 356

Query: 322 LFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERL 381
           LFK FRIK SL K++Q+ F SKLLFYYKRM  EQR  IF++ L            N E+L
Sbjct: 357 LFKTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRSNLRNVEKL 416

Query: 382 STILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILK 440
             I +  S P ++YAIETQLL++EDC+D HG  +FLQ +V YY+LGIKDKT+ L+  L+
Sbjct: 417 RDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQLKQFLQ 475

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  233 bits (594), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/443 (33%), Positives = 238/443 (53%), Gaps = 19/443 (4%)

Query: 4   QWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALI 63
           +W+ +K P G+ YY+N  +K ST E P +F   Q +G K  ++   P+F L L N W L+
Sbjct: 3   EWKRFKDPSGNFYYFNTRSKVSTKEKPKEFG-SQQAGMKELRV---PVFCLPLRNYWNLV 58

Query: 64  ICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFD-PGDRNVYQEL 122
           IC  G +FF+N ES+ S++                  L LL+GVA+GF+   DR+VY E+
Sbjct: 59  ICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEI 118

Query: 123 SDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYGXXXXXXXXXXXXXXXXXXXXX 182
            D + + K DSN+++    T E    T     S V                         
Sbjct: 119 RD-VLQAKLDSNDKEQNDITEERPQVT----NSNVDTEDKSESSNILVSGYSSSSDDSGE 173

Query: 183 XXAVSCTNVPDA-DVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPL 241
              V   N P + DV +  T+   ++   +++FI L ++  +DPYSTW++Q+++I  DP 
Sbjct: 174 ESEVEEKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPR 233

Query: 242 FYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAID-SLEPSRYHYLAHI 300
           +Y IT++  R ELF+ WC  + +N +                   D +LEP++YHYLAHI
Sbjct: 234 YYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHI 293

Query: 301 VSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIF 360
           +SK+ IT  TL  +I+ + K LFK+  I  +L+K+EQ+ F SK++ YYKRM   QR  +F
Sbjct: 294 ISKANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELF 353

Query: 361 KRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQLLILEDC--IDTHGSNAFLQ 418
           K+ ++             E+LS ++   + P +++ +ETQLL LE+   I  +  N+++Q
Sbjct: 354 KKMMKNKLRFPPIS----EKLSQLMLEET-PSDSFKLETQLLQLENALLILDNLQNSYMQ 408

Query: 419 EDVQYYVLGIKDKTVALRDILKD 441
            ++ YY+LGIKDK  AL++IL+D
Sbjct: 409 NEIMYYILGIKDKLAALKEILRD 431

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  230 bits (586), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 155/447 (34%), Positives = 227/447 (50%), Gaps = 37/447 (8%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFNDWALI 63
           W+E+KTP G +YYYN  TK+S +E PD     DQ +  K+ +++ KP F+L L + W L+
Sbjct: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61

Query: 64  ICNTGLRFFYNSESHTSR---WXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNV-- 118
           ICN G +F+YNS+S   +                   +EKLVLL+GVA+G+D  D +V  
Sbjct: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVDK 121

Query: 119 -YQELSDSISELKEDSNNRDFRKETAEE----SIPTAVPGQSLVSGYGXXXXXXXXXXXX 173
            ++ L++ I+  K++ N      E  EE    + P       L+SGYG            
Sbjct: 122 IFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSEEEEEEEEE 181

Query: 174 XXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQS 233
                           N     +DDL  +    D      F  LF +Y +D +STW++QS
Sbjct: 182 EEEDDGEQD------LNKDATIIDDLNQI-DTGDADERGLFFRLFDRYELDKFSTWSLQS 234

Query: 234 RKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSR 293
           +KI +DP FY I +DA R+  FE WC +E S+ +   A               D LEP++
Sbjct: 235 KKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVG--------DVLEPTK 286

Query: 294 YHYLAHIVSKSK-ITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRM 351
           YHYLA I++K+  I    +P+DIR  QKEL+K +RIK+ + SKREQD F+S+LLFYYK  
Sbjct: 287 YHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTF 346

Query: 352 TPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTILS----TPSLPQENYAIETQLLILEDC 407
           + EQR  IF+  L            +  R S ++S        P +  ++E  LL +E  
Sbjct: 347 SLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIE-- 404

Query: 408 IDTHGSNAFLQEDVQYYVLGIKDKTVA 434
              +  N  +  D +YYV+GI DKT+ 
Sbjct: 405 ---YRCNIVVAADPRYYVVGILDKTMV 428

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  229 bits (584), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 153/466 (32%), Positives = 242/466 (51%), Gaps = 47/466 (10%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           M R W  +  P G KYYYNL TK+ST++ P+ F ED  + R     + +P +A+ L NDW
Sbjct: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDP--GDRNV 118
            L+I + G +++++S +  + W               + K++LLV +A+G++   GDR V
Sbjct: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDR-V 119

Query: 119 YQELSDSISELKEDSNNRDFRKETAEESIPTAVPG--------QSLVSGYGXXXXXXXXX 170
           YQE+ D +  L++ S   +  ++  E+   +              L++GY          
Sbjct: 120 YQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGY---------- 169

Query: 171 XXXXXXXXXXXXXXAVSCTNVPDADVDDLGTV----LPEHDYSNDAE----FISLFSKYA 222
                         +    N  D+DV+ L  +    LP+ ++ ++++    F  L  ++ 
Sbjct: 170 ------------SSSEEEENEIDSDVEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQ 217

Query: 223 VDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWC---MNECSNQSEVPAXXXXXXXX 279
            DPYSTW++Q+RKI++DPLFY+IT+D+ R+ +FE WC   +N  +N  ++          
Sbjct: 218 CDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQDL-VDEDNLDDD 276

Query: 280 XXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQD 338
                  D LEP  +HYLAHIVSK+ IT ST+ +DI+   K  FK+++IK  + SK +Q+
Sbjct: 277 SREEEEEDELEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQE 336

Query: 339 AFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQ-ERLSTILSTPSLPQENYAI 397
            F+SKLLFYYK+ T ++R  IF   LE            + E + + LS  +   + YAI
Sbjct: 337 TFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAI 396

Query: 398 ETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDLI 443
           ET+LL +E+ I        L  D +YYVLGIKDK + L   L   I
Sbjct: 397 ETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  222 bits (566), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 150/478 (31%), Positives = 244/478 (51%), Gaps = 42/478 (8%)

Query: 3   RQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWAL 62
           R W+E+  P+G KYYYNL TKK+T++ P+   E  N+  + +K D  P+FA  LFNDW L
Sbjct: 4   RVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEG-NAVSQGQK-DESPVFAFPLFNDWYL 61

Query: 63  IICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDR-NVYQE 121
           +I + G +F++N+  + S                 ++KL+LLVGVA+GF   +   VY+E
Sbjct: 62  VISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEE 121

Query: 122 LSDSISELKEDSNN--RDFRKETAEESIPTAV---PGQSLVSGYGXXXXXXXXXXXXXXX 176
           + +++  +K + +N  ++ +   A+ES  +A    PG  + +  G               
Sbjct: 122 IMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDI 181

Query: 177 XXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSND--------------AEFISLFSKYA 222
                    ++  N+   D      +  E D++ +               ++  LF KY 
Sbjct: 182 REDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQ 241

Query: 223 VDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEV------------- 269
           ++ +STW+ QS+ + DDP FY IT+++ R+++FE WC  + S+ + +             
Sbjct: 242 LNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSG 301

Query: 270 ---PAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQF 326
               A               ++LEP++YHYL+HI+SK+ I+  T+ +DI+ D K+LFKQF
Sbjct: 302 AHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIKKDNKKLFKQF 361

Query: 327 RIKDSL-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTIL 385
           +I   + SKR+ ++F SKL+FYYK+    QR  IF+  LE             E    +L
Sbjct: 362 KINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVV--EHSDKVL 419

Query: 386 STPSLP-QENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDL 442
            T +    E++  ETQLL LED +   GS   L  D +YY+LGIKDK   L++ L++L
Sbjct: 420 ETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRNL 477

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  218 bits (556), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 148/455 (32%), Positives = 228/455 (50%), Gaps = 59/455 (12%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSR--KLDAKPLFALSLFNDWAL 62
           W+E+KTP G +Y+YN NTK+S ++ PD F +   +  +++  +++ KP+FAL L +DW L
Sbjct: 7   WQEFKTPAGKRYFYNKNTKESRWDKPD-FKKASGAQDRAKVAQVERKPMFALELIDDWHL 65

Query: 63  IICNTGLRFFYNSESHTSRWX---XXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNV- 118
           IICN G +F+YN ES+ S++                  +EKL+LL+GVA+G++  + +V 
Sbjct: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125

Query: 119 --YQELSDSISELKE------DSNNRDFRKETAEESIPTAVPGQSLVSGYGXXXXXXXXX 170
             ++ L++ I   K+      +    +  +E  +   P       LVSGYG         
Sbjct: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSEEEEEE 185

Query: 171 XXXXXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWN 230
                              N     +DDL  +    D +    F  L  +Y +D +STW+
Sbjct: 186 EEP---------------ENDDAGIIDDLNQI-DSGDVNERGLFFQLCDRYELDKFSTWS 229

Query: 231 MQSRKIRDDPLFYKITNDADRKELFENWC----MNECSNQSEVPAXXXXXXXXXXXXPAI 286
           +Q +KI +DP FYK+ + A R+ LFE WC     +   N+SE                  
Sbjct: 230 LQCKKIENDPDFYKVGDAAVRESLFEEWCASASASASGNESE-------------DEDDA 276

Query: 287 DSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLL 345
           D LEP+++HYLA IV+K++I    +P+DIR  QK LFK +RIK+ + SKR+QD F+S+LL
Sbjct: 277 DLLEPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLL 336

Query: 346 FYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTILS------TPSLPQENYAIET 399
           FYYK  + EQR  IF+  L            +  +   ++S       P+   +  ++E 
Sbjct: 337 FYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPT-AADGASVED 395

Query: 400 QLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVA 434
            LL +E      G  A    D +YYVLGI DKT  
Sbjct: 396 ALLSIE---HRCGVGAIALADPRYYVLGILDKTAG 427

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  210 bits (535), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 147/476 (30%), Positives = 228/476 (47%), Gaps = 49/476 (10%)

Query: 2   ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61
            + W+E+  PDG KYYYN+ +K+ST+  PD    D   G+        PLF   L N W 
Sbjct: 3   VKIWKEFNAPDGRKYYYNIKSKESTWTKPDSL-YDTEKGKVGSDRAGAPLFVFPLLNGWH 61

Query: 62  LIICNTGLRFFYNSE-SHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNVYQ 120
           LIIC  G +++YN   + T                  ++KL+LL+ VA+G++  D   Y+
Sbjct: 62  LIICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPD---YE 118

Query: 121 ELSDSISELKEDSNNRDFRKETAE---------------ESIPTAVPGQSLVSGYGXXXX 165
           +L D + +  E  +N   + + AE               E    AV    L+ GY     
Sbjct: 119 KLYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIGGY----- 173

Query: 166 XXXXXXXXXXXXXXXXXXXAVSCTNVPD-----ADVDDLGTVLPEHDYSNDAE------- 213
                                  TN+ +     +D +D+   L   D+  D+        
Sbjct: 174 ----LSSDDEESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEK 229

Query: 214 ----FISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEV 269
               F  LF ++ +DPYS+W +Q +KI++ P +++IT+++ R+ELFE+WC ++ +     
Sbjct: 230 SKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSN 289

Query: 270 PAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIK 329
                            D  EP+++HYLAHI+SK+ I + T+  DI+ + K LFK+F+IK
Sbjct: 290 VTNFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIK 349

Query: 330 DSL-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFL-EXXXXXXXXXXXNQERLSTILST 387
           D + SK++Q+AF SKLLF+YK+    +R  +F + L E           N E +  I+  
Sbjct: 350 DFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKN 409

Query: 388 PSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDLI 443
                E Y IETQLL +E  I        L  D +YY+LGIKDK + L++ LKD I
Sbjct: 410 D--VDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLKDKI 463

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  206 bits (525), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 222/448 (49%), Gaps = 72/448 (16%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           M   WREY+ P+G KYY+N  T ++T++ P        + +  R+L  KP + + L N W
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSP-------YTRKPQRELSIKPQYVIPLLNAW 53

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFD--PGDRNV 118
            L+ICN G +F+ N +                     REKL+LL+GVA+G+    GD+ V
Sbjct: 54  NLVICNNGAKFYLNPDGDPV-LTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDK-V 111

Query: 119 YQELSDSISELKEDSNNRDF----RKETAEESIPTAVPGQSLVSGYGXXXXXXXXXXXXX 174
           Y  + + IS LK+D  N        +E  EE + T V  + + S                
Sbjct: 112 YNSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSA--------------- 156

Query: 175 XXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSR 234
                      VS         DD   V P+ D +N   + +LFS+Y +D YS W+++S 
Sbjct: 157 ----------LVSGYGSSSDGSDDEEEVPPDTD-ANRISYFNLFSEYGLDKYSVWSIESL 205

Query: 235 KIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRY 294
           KI +DP F+ I++D  R+E+FE WC +   + SE                  D L P++Y
Sbjct: 206 KISNDPRFHIISDDRQREEIFEEWCCSGVVDDSEDEGYSS----------GDDDLSPTKY 255

Query: 295 HYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPE 354
           HYL+ IV+KS +T +T+ +DI+ ++  LFKQ+ IK  LSKREQ+ F+S+LLFYYK+ T E
Sbjct: 256 HYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLE 315

Query: 355 QRIAIFKRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYA---IETQLLILEDCIDTH 411
           +R+ +F +F+             + R  T+ S P+ P ++     IET LL +E    +H
Sbjct: 316 ERVQLFTKFIA------------ESRTGTVPS-PTSPADSATPEDIETNLLQME----SH 358

Query: 412 GSNAFLQEDVQYYVLGIKDKTVALRDIL 439
                L   V YY L IK K   L  +L
Sbjct: 359 LPPTVLDNTV-YYTLDIKTKQSVLHRML 385

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  202 bits (513), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 148/456 (32%), Positives = 222/456 (48%), Gaps = 41/456 (8%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFND 59
           M  +W+E+KTP G KYYYN NTK+S +E P+     +  S  K  + + KP F+L L N 
Sbjct: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60

Query: 60  WALIICNTGLRFFYNSESHTSR---WXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDR 116
           W LII N G + ++N +S   +                   +EKLVLL+GVA+G+   + 
Sbjct: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120

Query: 117 NV---YQELSDSISELKEDSNNRDFRKETAEESIPTAVPGQ----SLVSGYGXXXXXXXX 169
           ++    +  ++ I   K + +  + + E +EE+     P Q     LVSGYG        
Sbjct: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDE 180

Query: 170 XXXXXXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTW 229
                               N   + +DDL  +  + D      F  LF +Y +D +STW
Sbjct: 181 EEDEEEDEEN-----EEQIVNQDISIIDDLNRIDTD-DIDERNIFFELFDRYKLDKFSTW 234

Query: 230 NMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSL 289
           ++QS+KI +DP FYKI +D  R+ LFE WC     N     A               + L
Sbjct: 235 SLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGN-----ATAEESDSEDNSEDDSEVL 289

Query: 290 EPSRYHYLAHIVSKS-KITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFY 347
           EP++YHYLA IV+ +  I   T+P+DIR  QK L+K ++IK+ + SKR+QD F+S+LLFY
Sbjct: 290 EPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFY 349

Query: 348 YKRMTPEQRIAIF-------KRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQ 400
           YK    EQR  IF       +R                +R  T+L  P+   ++ +IE  
Sbjct: 350 YKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPA---DSSSIEDI 406

Query: 401 LLILED--CIDTHGSNAFLQEDVQYYVLGIKDKTVA 434
           LL +E   C+     +  +  + +YYV+GI +KTV 
Sbjct: 407 LLSIEHRCCV-----SPIVVTEPRYYVVGILEKTVV 437

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  200 bits (509), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 229/456 (50%), Gaps = 46/456 (10%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFND 59
           M   W+E+KTP G KYYYN  TK+S +E P+   + D     K  +++  P FAL L + 
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 60  WALIICNTGLRFFYNSESHTSR---WXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDR 116
           W LIICN G + ++N +S   +                   ++KLVLL+G+A+G+   + 
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 117 N---VYQELSDSISELKEDSNNRDFRKETAEES-IPTAVPGQS---LVSGYGXXXXXXXX 169
           +   +++ L++ I   K++ +  +   ET EE+ +  ++  +S   L+SGYG        
Sbjct: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYG-----SSS 175

Query: 170 XXXXXXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAE---FISLFSKYAVDPY 226
                          A    N   + +DDL  +  + D     E   F  L  +Y +D +
Sbjct: 176 EEEEEEEEEEEEEDHAEQGVNQNVSIIDDLNHIDAD-DIDEGRERSLFFQLCDRYKLDKF 234

Query: 227 STWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAI 286
           STW++QS+KI +DP FYKI +D  R+ LFE WC    + +S+                  
Sbjct: 235 STWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDES------------- 281

Query: 287 DSLEPSRYHYLAHIVSKS-KITSSTLPKDIRTDQKELFKQFRIKDSLS-KREQDAFLSKL 344
           + LEP++YHYLA IV+K+  I    +P+DIR  QK L+K +RIK+ +  KREQD F+S+L
Sbjct: 282 NVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQL 341

Query: 345 LFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTILSTPSL----PQENYAIETQ 400
           LFYYK    EQR  IF+  L            +  + + ++S        P +  +IE  
Sbjct: 342 LFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDV 401

Query: 401 LLILED--CIDTHGSNAFLQEDVQYYVLGIKDKTVA 434
           LL +E+  C+     +A +  D +YYV+GI +KTV 
Sbjct: 402 LLSIENRCCV-----SAIVVADPRYYVVGILEKTVV 432

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  191 bits (484), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 147/238 (61%), Gaps = 6/238 (2%)

Query: 209 SNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWC---MNECSN 265
           S  A FI+LF +Y ++PYS+W++QSRK++ DP FY + +D  R+ELFE+WC   + +   
Sbjct: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144

Query: 266 QSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQ 325
            S                   +SLEP ++HYL+HIVSKS I   T+  D++T+ K LFK 
Sbjct: 145 DSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204

Query: 326 FRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTIL 385
           F I ++  K+EQ  F+S LLFYYK+ + ++R+ IFK  L+           N+++L  IL
Sbjct: 205 FNIDETHPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLD---TKVKHEINNEDQLQQIL 261

Query: 386 STPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDLI 443
              +LP + Y IE+QL+ +E  I  H S   LQED++YYV+G++DKT+ +++ L+ ++
Sbjct: 262 DQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSG 40
          W+  KT +G  YYY   + + T+E P+ F+E+   G
Sbjct: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMG 38

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  192 bits (488), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 140/450 (31%), Positives = 221/450 (49%), Gaps = 65/450 (14%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
           M + W+EY+ P+G KYYYN  TKK+T+E P+           +++ + +P+F + L NDW
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPE----------AAKREEIEPVFVIRLMNDW 50

Query: 61  ALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGD-RNVY 119
            L+ICN G++++ ++E+  ++                +EKLV L+G+A+G+   +   +Y
Sbjct: 51  KLVICNNGMKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIY 109

Query: 120 QELSDSISELKEDSNNRDFR-KETAEESIPTAV------PGQSLVSGYGXXXXXXXXXXX 172
             + + +  LKED  N   R K+ AE  +   V      P  +LV G             
Sbjct: 110 GNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEG----------YDS 159

Query: 173 XXXXXXXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQ 232
                            NV D  +             + A+F+ LF +Y +D +S W+M+
Sbjct: 160 SESEEEEEEEDDYEFLNNVADEGLS-----------GDKAKFMELFDRYGLDKFSEWSME 208

Query: 233 SRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPS 292
             K+  DP FY +T+D +R++LFE WC  +  + +   +                 LEP+
Sbjct: 209 MNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHST---SDEEAKEGGEPEEHEERPLEPT 265

Query: 293 RYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRM 351
           ++HYL+ IVSKS+I  +T+ +DI+   K LFK+++IKD + S +EQ+ F+SKLLFYYK  
Sbjct: 266 KFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTF 325

Query: 352 -TPEQRIAIFKRFLEXXXXXXXXXXXNQERLSTI--LSTPSLPQENYAIETQLLILEDCI 408
              E R   F  FL            N   +S +  LS      + YAIET LL +E C 
Sbjct: 326 PQVEDRTKQFNDFL-------REKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE-C- 376

Query: 409 DTHGSNAFLQE---DVQYYVLGIKDKTVAL 435
                  F Q+   DV+YY+L +K KT+ L
Sbjct: 377 ------NFPQDVLSDVRYYILDLKQKTIEL 400

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  178 bits (452), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 138/251 (54%), Gaps = 15/251 (5%)

Query: 200 GTVLPEHDYSND------AEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKE 253
           G      D  ND      AE  +LF +  +DPYS W  +S KI  D  FY + +D  R+E
Sbjct: 80  GAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQE 139

Query: 254 LFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPK 313
           LFE WC  + +++                      L P+R+HYLAHIVSKS +   T+  
Sbjct: 140 LFEQWCARKIADEGNA-------VLEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYS 192

Query: 314 DIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXX 373
           D+R + KELF Q  + D L K+EQ  F++ LLFYYK+M    R  +F++ L         
Sbjct: 193 DVRREHKELFDQLEV-DILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITA 251

Query: 374 X-XXNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKT 432
               N  +L  +L    LPQ++Y+IET L I+E CI  HG+ + LQ +++YYVLG+KDK 
Sbjct: 252 AFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKL 311

Query: 433 VALRDILKDLI 443
           V ++++L++++
Sbjct: 312 VVMKEVLREML 322

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPD 31
          W+  K+ DG  YYYN  T ++T++ PD
Sbjct: 3  WKRAKSEDGKAYYYNTETNETTWDKPD 29

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  158 bits (400), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 140/237 (59%), Gaps = 7/237 (2%)

Query: 207 DYSNDAEFI-SLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSN 265
           D S D + +  LF++Y ++PYS W  + +KIRDDP F ++ +D+ R+++FE WC +  S 
Sbjct: 225 DISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISG 284

Query: 266 QSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQ 325
               P                  LEP++YHYLAHIVSKS IT +T+  DI+ D K  FK+
Sbjct: 285 DQVEPVDEIKSEDFDEEE----DLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKK 340

Query: 326 FRIKDSL-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXXXXN-QERLST 383
           + IKD L SK++Q++F+SKLLFYYKRM  E+R  +F + L+           N  +++  
Sbjct: 341 YNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRH 400

Query: 384 ILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILK 440
            L+      + YA+ET+L  +E  +   G+ + L E+ +YY+LGI+DK + L D LK
Sbjct: 401 CLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457

 Score =  120 bits (302), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDE-DQNSG-RKSRKLDAKPLFALSLFN 58
           MAR WREY  PDG KYYYN  TK+ST+  P+  DE D+N G ++ +K+++KP  AL L++
Sbjct: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60

Query: 59  DWALIICNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRNV 118
            W L+IC+TG +F+YN E++ S W               + KLV L+G+A+G+ PG  ++
Sbjct: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLHI 120

Query: 119 YQELSDSISELKED 132
           Y+EL   + +L+++
Sbjct: 121 YEELVTDLVKLRQE 134

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  145 bits (365), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/442 (28%), Positives = 214/442 (48%), Gaps = 52/442 (11%)

Query: 2   ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61
           ++ W+EY  P+G KYYYN  T+++T+  PD   +D+ +    ++++ KPL A  L   WA
Sbjct: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETA---DKEIEIKPLVAFELLAGWA 62

Query: 62  LIICNTGLRFFYN-SESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAKGFD--PGDRNV 118
           LII + G + +YN +ES  SR                +++L+LL+G+ +G+      +++
Sbjct: 63  LIIFSDGSKKYYNCNESQWSR-KISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKDL 121

Query: 119 YQELSDSISELKEDSNNRDFRKETAEESIPTAVPG-QSLVSGYGXXXXXXXXXXXXXXXX 177
             E+ + I  ++ED N     ++    S    +   ++ + GY                 
Sbjct: 122 VNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGY--YSSDDEEEPAKRDEQ 179

Query: 178 XXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIR 237
                    +   VPD    +LG  + +        + +LF+K+ ++ YSTW ++S K+ 
Sbjct: 180 AVVEEPDETNTLEVPDI-TQELGQDIKDS-------YFALFAKHELNKYSTWRIESEKVS 231

Query: 238 DDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYL 297
            DP FYKI +DA R+ +FE WC N  S +S                P  D  EP++YHYL
Sbjct: 232 QDPEFYKIIDDAVRENIFEEWC-NAGSVES----------NEESGDPGDDQFEPTKYHYL 280

Query: 298 AHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRI 357
           + +V+   +   T+P +     K+L K++RIKD  +K EQ  FLSK+L +YK M+ E R 
Sbjct: 281 SQLVANYDLKPDTIP-EDIIKDKKLIKKYRIKDYTTKSEQRQFLSKMLAWYKHMSLEDRK 339

Query: 358 AIFKRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFL 417
            +F+ +++               +       S  QE+  +E+QLL LE+ +    S    
Sbjct: 340 QMFQTYIDRIP------------VGKYTDIDSDAQED--VESQLLELENQLGIPTS---- 381

Query: 418 QEDVQYYVLGIKDKTVALRDIL 439
           + D++YY + ++ K    RDIL
Sbjct: 382 ENDLEYYCIDLRSK----RDIL 399

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  136 bits (343), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 117/442 (26%), Positives = 197/442 (44%), Gaps = 56/442 (12%)

Query: 2   ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61
            + WREYK P+G KYYYN+ TK++T+  P + ++ +    K  K      FA  LF+ W 
Sbjct: 4   GKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK------FAFELFDGWY 57

Query: 62  LIICNTGLRFFYNSESHTS----RWXXXXXXXXXXXXXXXREKLVLLVGVAKGFDPGDRN 117
           L+I   G + FY+S +  S    R                +EK++LL+    G   G R+
Sbjct: 58  LLIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLI----GMTRGFRD 113

Query: 118 VYQELSDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYGXXXXXXXXXXXXXXXX 177
               +     ++ +D N   F K+   E +  A+  + L +                   
Sbjct: 114 DRYHIKGVYDDIAQDIN---FLKQ---EILNDAMELERLNAEAEEEESEKEEALPQEEQD 167

Query: 178 XXXXXXXAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIR 237
                          + DV D                  LF  + +D YSTW++QSRKI 
Sbjct: 168 DHTVELLNNLEEEEEEQDVKD--------------RLFHLFESFNLDVYSTWSLQSRKIS 213

Query: 238 DDPLFYKITNDADRKELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYL 297
           +   ++ + +D  R+E+FE+WC  +    +++P                D  EP++YHYL
Sbjct: 214 NQADYFLVHDDTQREEMFEDWCAMKV---AQLPEDESEA--------EDDDYEPTKYHYL 262

Query: 298 AHIVS--KSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRMTPE 354
           + I+   + +I + T+  DI    + LFKQ+ IK  +  +RE  A +S+LLFYYKR T  
Sbjct: 263 SEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTAR 322

Query: 355 QRIAIFKRFLEXXXXXXXXXXXNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSN 414
           +R A+F  ++            + +         SL  E   +ET++L  E    T G++
Sbjct: 323 ERRAVFHDYVSQRYGLLPGEDVDND------DAGSLSGEQ--METRILQWERDRQTEGNS 374

Query: 415 AFLQEDVQYYVLGIKDKTVALR 436
           ++    ++YYV+G+++K + LR
Sbjct: 375 SWDPTALEYYVVGLREKYIGLR 396

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 131/255 (51%), Gaps = 31/255 (12%)

Query: 214 FISLFSKYAVDPYSTWNMQSRKIRDDP-LFYKITNDADRKELFENWCMNEC-------SN 265
           F  L  K  +D YSTW++QSR+I + P +FY I+ND++R+E+FE+WC N         SN
Sbjct: 259 FFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLYSSN 318

Query: 266 QSE--------VPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSK--ITSSTLPKDI 315
             E          +               D LEP++YHYL+ ++ K +  I   ++ +DI
Sbjct: 319 VKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIFQDI 378

Query: 316 RTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEXXXXXXXXX 374
           +   K LFK +RIKD +  K+E +  +S LLFYYK+++ ++R   F+ ++          
Sbjct: 379 KRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYV--TKHYGEKI 436

Query: 375 XXNQERLSTIL----STPSLPQENYAIETQLLILEDCIDTHGSN------AFLQEDVQYY 424
             + E L+ IL    S  +  + +  IE ++L +E+ I   G +      A     ++YY
Sbjct: 437 KLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGLEYY 496

Query: 425 VLGIKDKTVALRDIL 439
           ++G++ K  AL  ++
Sbjct: 497 IIGLRAKHSALATLI 511

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 76/143 (53%), Gaps = 13/143 (9%)

Query: 3   RQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKL-----DAKPLFALSLF 57
           R W+EYKTP+G KYYYN+ TK+ST+E P  F +   +   ++ L     + +  FA  L 
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 58  NDWALIICNTGLRFFYNSESHTSRWXXXXXXXXXX-----XXXXXREKLVLLVGVAKGF- 111
           N+W LI+ + G +F+YN+ S+ S                      +  L+ L+G+ +G+ 
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYN 129

Query: 112 DPG--DRNVYQELSDSISELKED 132
           DP    + +Y+E+  +I  LK+D
Sbjct: 130 DPSIDIKGLYEEIVANIGFLKQD 152

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 87/173 (50%), Gaps = 23/173 (13%)

Query: 193 DADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRK 252
           DA  D++G        + + +F  L  +  +D YS W ++++KI DDP+FY I  D +R+
Sbjct: 62  DASEDEIG--------NKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVERE 113

Query: 253 ELFENWCMNECSNQSEVPAXXXXXXXXXXXXPAIDSLEPSRYHYLAHIVSKSKITSSTLP 312
           +LFE WC  +  ++ E               P +    P  YH LA ++    I S+T+ 
Sbjct: 114 KLFEQWCYGKLHSREE-----------ETTQPQLALALP--YHDLAEMICCFDIQSNTIY 160

Query: 313 KDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLE 365
           KDIR   K++ +Q  I + +SK EQ+ F +KLL   K         +F++ LE
Sbjct: 161 KDIRKANKKMVRQ--IDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLE 211

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 18/79 (22%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDE-DQNSGRKSRKLDAKPLFALSLFNDWALI 63
          W+  K P G  YYYN  TKKST+E P +F E DQ S                  NDW   
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQPSA-----------------NDWKTG 46

Query: 64 ICNTGLRFFYNSESHTSRW 82
              G  ++YN ++  SRW
Sbjct: 47 KTKDGKTYYYNVKTRESRW 65

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 2  ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFND 59
          A  W+  KT DG  YYYN+ T++S + +P +  +++    +  K   K +  L+  ND
Sbjct: 40 ANDWKTGKTKDGKTYYYNVKTRESRWTLPPEMKQEEKEEARPNKDSEKIVENLTSSND 97

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          WR  K  +G  YYYN+NTK+S ++ P   +   N+       D+  +    +   W   +
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNND------DSDKMLLEQI--GWKSNV 62

Query: 65 CNTGLRFFYNSESHTSRW 82
           N G  ++YN ++  SRW
Sbjct: 63 TNEGKVYYYNLKTGESRW 80

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 7/89 (7%)

Query: 1  MARQWREYKTPDGSKYYYNLNTKKSTYEIP-------DDFDEDQNSGRKSRKLDAKPLFA 53
          M   W++ K P G  YYYNL TK+S +++P            ++    K  +L  K    
Sbjct: 1  MENDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLE 60

Query: 54 LSLFNDWALIICNTGLRFFYNSESHTSRW 82
              + W       G  ++YN ++  SRW
Sbjct: 61 FLKLHGWRTAQTKEGRIYYYNVDTKESRW 89

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPD 31
          WR  +T +G  YYYN++TK+S ++ P+
Sbjct: 67 WRTAQTKEGRIYYYNVDTKESRWDPPN 93

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
           (REAL)
          Length = 583

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 97/269 (36%), Gaps = 31/269 (11%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
           W+E K  +G  YYYN  TKKST+E P      Q                L   N W    
Sbjct: 4   WKEAKDANGRVYYYNTLTKKSTWEKPTQLVSKQEQ--------------LLQENGWRAAK 49

Query: 65  CNTGLRFFYNSESHTSRWXXXXXXXXXXXXXXXREKLVLLVGVAK----GFDPGDRNVYQ 120
              G  ++YN+ +  + W                  ++L    +K      D   + + Q
Sbjct: 50  TAEGKVYYYNTTTRKTSWAIPIFEKKTEDIAKKEPDVILSAQASKYRTVSTDEEKKELRQ 109

Query: 121 ELSDSISELKEDS---NNRDFRKETAEESIPTAVPGQSLVSGYGXXXXXXXXXXXXXXXX 177
            + +  S+   DS   N +   KE AE+   T +  + + S +                 
Sbjct: 110 NIKEEESQYSNDSKLLNVKRRTKEEAEKEFITMLKEKQVDSTWSFSRIISELGTRDPRYW 169

Query: 178 XXXXX---XXAVSCTNVPDADVDDLGTVLPEHDYSN---DAEFISLFSKYAVDPYSTWNM 231
                      +    + +   D L   L EH+ ++   DA    L +   +  Y+ W+ 
Sbjct: 170 MVDDDPLWKKDMFEKYLSNRSADQL---LKEHNETSKFKDAFLEMLRNNSNIKYYTRWST 226

Query: 232 QSRKIRDDPLF-YKITNDADRKELFENWC 259
             R I D+P++ + + N+  +K+ F+N+ 
Sbjct: 227 AKRLIADEPIYKHSVVNEKTKKQTFQNYI 255

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 1  MARQWREYKTPDGSKYYYNLNTKKSTYEIP-------DDFDEDQNSGRKSRKL 46
          + + W+   T DG  YYYN NT +ST+E+P       D+  E    G++ RK+
Sbjct: 40 LKQGWKVASTEDGKVYYYNKNTNESTWELPVVREEKKDEGGEKNEEGKEKRKV 92

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  S  +  +P+  L  L + W + 
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPASTTIQQQPVSQLGPLPSGWEMR 376

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 377 LTNTARVYFVDHNTKTTTW 395

>KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSTNTIQQQPVSQLGPLPSGWEMR 406

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 407 LTNTARVYFVDHNTKTTTW 425

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 18/80 (22%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDF--DEDQNSGRKSRKLDAKPLFALSLFNDWAL 62
          W+E K  +G  YYYN  TKKST+E P +   +E+Q                L   N W  
Sbjct: 4  WKEAKDANGRVYYYNSLTKKSTWEKPKELVSEEEQ----------------LLRENGWRA 47

Query: 63 IICNTGLRFFYNSESHTSRW 82
               G  ++YN  +  + W
Sbjct: 48 AKTKEGKVYYYNPATRETSW 67

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIP 30
          WR  KT +G  YYYN  T+++++ IP
Sbjct: 45 WRAAKTKEGKVYYYNPATRETSWTIP 70

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPD 31
          W+  KT DG  YYYN  TK S +E+PD
Sbjct: 48 WKSSKTSDGKLYYYNAQTKTSRWELPD 74

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 14/78 (17%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          W+E K   G  YYYN  T +S +E P +   +Q                +   + W    
Sbjct: 7  WKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQE--------------LILAKHGWKSSK 52

Query: 65 CNTGLRFFYNSESHTSRW 82
           + G  ++YN+++ TSRW
Sbjct: 53 TSDGKLYYYNAQTKTSRW 70

>ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER125W
           (RSP5)
          Length = 817

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 345 WEQRYTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSNNTIQQQPVSQLGPLPSGWEMR 404

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 405 LTNTARVYFVDHNTKTTTW 423

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          W+E K  +G  YYYN  TKKS +E P++    Q                L   N W    
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEELVSQQEQ--------------LLQENGWKAAK 49

Query: 65 CNTGLRFFYNSESHTSRW 82
             G  ++YN  +  + W
Sbjct: 50 TAEGKIYYYNPSTRQTSW 67

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIP 30
          W+  KT +G  YYYN +T+++++ IP
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIP 70

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 4  QWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQN-----SGRKSRKLDAKPLFALS--L 56
          +W + + P G  YY+N  T+KS +E P +++   +      G  ++K++     +    +
Sbjct: 3  KWEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSSGEPV 62

Query: 57 FNDWALIICNTGLRFFYNSESHTSRW 82
             W       G  +FYNS +  S W
Sbjct: 63 KGTWKSAKTKDGKVYFYNSATGKSSW 88

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIP 30
          W+  KT DG  Y+YN  T KS++ +P
Sbjct: 66 WKSAKTKDGKVYFYNSATGKSSWTLP 91

>SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 790

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 318 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 377

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 378 LTNTARVYFVDHNTKTTTW 396

>KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.134
           YER125W
          Length = 800

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 328 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 387

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 388 LTNTARVYFVDHNTKTTTW 406

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLGPLPSGWEMR 374

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 375 LTNTARVYFVDHNTKTTTW 393

>CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa]
           {ON} highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125w Ubiquitin--protein ligase
          Length = 822

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 409

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 410 LTNTARVYFVDHNTKTTTW 428

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLGPLPSGWEMR 378

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 379 LTNTARVYFVDHNTKTTTW 397

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANNTIQQQPVSQLGPLPSGWEMR 428

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 429 LTNTARVYFVDHNTKTTTW 447

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
          MA QW++    +G  YYYN  TK+S ++ P +   D     K +  DA           W
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKPVEDTTD----LKQKLRDA----------GW 46

Query: 61 ALIICNTGLRFFYNSESHTSRW 82
           +     G  ++YN ++  SRW
Sbjct: 47 NVAKTKEGKVYYYNVKTKESRW 68

>Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON}
           (93761..96208) [2448 nt, 816 aa]
          Length = 815

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 343 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 402

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 403 LTNTARVYFVDHNTKTTTW 421

>Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON}
           YER125W (REAL)
          Length = 809

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 396

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 397 LTNTARVYFVDHNTKTTTW 415

>Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W
           (REAL)
          Length = 808

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 336 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 395

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 396 LTNTARVYFVDHNTKTTTW 414

>Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W
           (REAL)
          Length = 809

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 396

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 397 LTNTARVYFVDHNTKTTTW 415

>ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 406

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 407 LTNTARVYFVDHNTKTTTW 425

>YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3
           ubiquitin ligase of the NEDD4 family; involved in
           regulating many cellular processes including MVB
           sorting, heat shock response, transcription,
           endocytosis, and ribosome stability; human homolog is
           involved in Liddle syndrome; mutant tolerates
           aneuploidy; ubiquitylates Sec23p
          Length = 809

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 396

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 397 LTNTARVYFVDHNTKTTTW 415

>NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134
          Length = 835

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 363 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 422

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 423 LTNTARVYFVDHNTKTTTW 441

>TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.134
           YER125W
          Length = 844

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 372 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 431

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 432 LTNTARVYFVDHNTKTTTW 450

>NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134
          Length = 836

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 364 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 423

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 424 LTNTARVYFVDHNTKTTTW 442

>KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {ON}
           Anc_8.134 YER125W
          Length = 811

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 339 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 398

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 399 LTNTARVYFVDHNTKTTTW 417

>TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.134
           YER125W
          Length = 822

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 5   WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALS-LFNDWALI 63
           W +  TP+G  Y+ + NT+ +T+  P      +  G  +  +  +P+  L  L + W + 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMR 409

Query: 64  ICNTGLRFFYNSESHTSRW 82
           + NT   +F +  + T+ W
Sbjct: 410 LTNTARVYFVDHNTKTTTW 428

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 21/98 (21%)

Query: 2   ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDF-----------------DEDQNSGRKSR 44
             QWR  K   G  YYYNL TK+S +E P +                    +  +  K  
Sbjct: 11  GNQWRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIE 70

Query: 45  KLDAKPLFALSLFNDWALIICNTGLRFFYNSESHTSRW 82
           K DA  +  +     W   +   G  ++YN ++  SRW
Sbjct: 71  KDDASIMENIG----WKSNVTADGKTYYYNLKTGESRW 104

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 14/82 (17%)

Query: 1  MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60
          M+  W+E K  +G  YYYN  T +S +E P +    Q    K               N W
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQLLKK--------------NGW 46

Query: 61 ALIICNTGLRFFYNSESHTSRW 82
          ++     G  ++YN+++  S W
Sbjct: 47 SIGKSKAGKIYYYNTKTGESSW 68

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 14/78 (17%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          W+E K   G  YYYN  TKKST+E P +    +                L   N W    
Sbjct: 4  WKEAKDASGRIYYYNTLTKKSTWEKPKELISQEE--------------LLLRENGWKAAK 49

Query: 65 CNTGLRFFYNSESHTSRW 82
             G  ++YN  +  + W
Sbjct: 50 TADGKVYYYNPTTRETSW 67

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIP 30
          W+  KT DG  YYYN  T+++++ IP
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIP 70

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIP 30
          W+  KT +G  YYYN  T KS +EIP
Sbjct: 45 WKTGKTDEGQVYYYNQETGKSCWEIP 70

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 30/81 (37%), Gaps = 22/81 (27%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPD---DFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61
          WR  K  +G  YYYN  T  S +E P    D +  +  G                   W 
Sbjct: 7  WRTAKDSNGKVYYYNTKTGVSQWEKPGVSADIETLKQHG-------------------WG 47

Query: 62 LIICNTGLRFFYNSESHTSRW 82
          +     G  ++YNS +  SRW
Sbjct: 48 VARTKDGKLYYYNSSTGESRW 68

>ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJR017C (ESS1)
          Length = 163

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 15 KYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALIICNTGLR 70
          +YYYN  TK+S +E+P D D +Q     +R L   P+    L     L+I + G R
Sbjct: 22 EYYYNPETKESQWEVPADTDSEQ----LARHLAEHPVQVRCLH----LLIKHAGSR 69

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 17/79 (21%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDD-FDEDQNSGRKSRKLDAKPLFALSLFNDWALI 63
          W+E K P G  YYYN +T ++T+E P++ F E +      RKL         L   W   
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKPEELFTEFE------RKL---------LKYGWKTA 46

Query: 64 ICNTGLRFFYNSESHTSRW 82
          +   G  ++Y S++  + W
Sbjct: 47 LAEDGRVYYYKSDTGETTW 65

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 14/78 (17%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          W E   P+G  YYYN  + ++T++ P             R+L ++    L   + W    
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKP-------------RELYSELELQLEK-HGWKTGE 49

Query: 65 CNTGLRFFYNSESHTSRW 82
             G  ++YN  S  SRW
Sbjct: 50 TEGGKLYYYNESSGESRW 67

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

Query: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALII 64
          W+E K   G  YYYN  T ++T+  P +           R+L         L + W +  
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQEL-----YSELERRL---------LAHGWKVGS 51

Query: 65 CNTGLRFFYNSESHTSRW 82
                ++YN  S  SRW
Sbjct: 52 TAGKQTYYYNEASGESRW 69

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,420,264
Number of extensions: 1796318
Number of successful extensions: 6110
Number of sequences better than 10.0: 67
Number of HSP's gapped: 6138
Number of HSP's successfully gapped: 100
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)