Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.18893na 1ON28928915470.0
KLTH0G02420gna 1ON28928811151e-154
SAKL0F02574gna 1ON2892869881e-135
Smik_10.3847.468ON2822667411e-97
YJR096W7.468ON2822667392e-97
Suva_12.1847.468ON2822667341e-96
Skud_10.3187.468ON2822677227e-95
ZYRO0G17600g7.468ON2832677229e-95
ABL209Cna 2ON3102697214e-94
TDEL0C033207.468ON2832677174e-94
KNAG0D013707.468ON2822656905e-90
KAFR0G009207.468ON2862756891e-89
KLTH0G05786g7.468ON2862666854e-89
Kpol_1013.827.468ON2852666821e-88
SAKL0F14278g7.468ON2862666821e-88
KLLA0F03256g7.468ON2852706802e-88
Kwal_47.182197.468ON2932666752e-87
NCAS0H005607.468ON2842676706e-87
CAGL0C04543g7.468ON2872666577e-85
Ecym_7160na 2ON2712606229e-80
Kwal_33.13276na 3ON3022635274e-65
KLTH0F01892gna 3ON3022895196e-64
SAKL0G02530g5.434ON3122894293e-50
KLLA0B14707gsingletonON3102814223e-49
Kwal_47.18084na 4ON3092804198e-49
CAGL0A02816g5.434ON3103014171e-48
Kpol_1062.295.434ON3113104145e-48
NDAI0C016005.434ON3132954136e-48
KLTH0E00220gsingletonON3062834092e-47
KLTH0A00528gsingletonON3062834092e-47
CAGL0I01100g5.434ON3102944083e-47
YDR368W (YPR1)5.434ON3122954041e-46
Suva_8.1735.434ON3122954032e-46
KLTH0A03476gna 4ON3082874005e-46
TDEL0D00230singletonON3122934005e-46
NCAS0H020605.434ON3222954006e-46
KLLA0D10109gsingletonON3092693971e-45
AER401W5.434ON3132923935e-45
KNAG0C049105.434ON3133093928e-45
Skud_15.2835.434ON3122933921e-44
Suva_2.5405.434ON3122953911e-44
TBLA0A02825singletonON3112933911e-44
KLTH0E15532gsingletonON3092853901e-44
Skud_4.6375.434ON3122943901e-44
TPHA0E017605.434ON3102903883e-44
YOR120W (GCY1)5.434ON3122913884e-44
ZYRO0F10032g5.434ON3102853874e-44
Smik_4.6345.434ON3122963832e-43
TBLA0A065105.434ON3122863814e-43
Smik_15.2985.434ON3122953798e-43
SAKL0G01914g5.409ON3293073745e-42
TDEL0E021505.409ON3293083712e-41
TDEL0E019105.434ON3112933632e-40
YHR104W (GRE3)5.409ON3273083632e-40
Kwal_55.214265.434ON3082873622e-40
KLTH0F16060g5.434ON3093093595e-40
TPHA0G00210singletonON3112793588e-40
KLTH0F16610g5.409ON3293073598e-40
KAFR0C05320singletonON3272913537e-39
Smik_8.1825.409ON3273083529e-39
Suva_15.3005.409ON3273073511e-38
KAFR0E038405.434ON3103183482e-38
Kwal_56.226113.108ON3212983492e-38
KAFR0E03850singletonON3112873482e-38
TBLA0A02835singletonON3112913473e-38
ACL107C5.409ON3543043495e-38
TPHA0E018605.409ON3262853467e-38
KLLA0E21627g5.409ON3293063469e-38
Kwal_55.215365.409ON3292963451e-37
CAGL0I01122g5.409ON3263083442e-37
Skud_8.1655.409ON3273083432e-37
NCAS0A066605.409ON3263043398e-37
NDAI0B056705.434ON3182983361e-36
SAKL0C10626gsingletonON3222943362e-36
NCAS0F033805.434ON3132903343e-36
KNAG0B03780singletonON3262923353e-36
NDAI0D016005.409ON3272913336e-36
Ecym_55085.409ON3263053274e-35
TBLA0F01720singletonON3262933274e-35
NDAI0A070003.108ON3203013231e-34
ZYRO0A06336g5.409ON3272913232e-34
KLTH0C10010g3.108ON3212983222e-34
KAFR0G013503.108ON3242963195e-34
TBLA0A00630singletonON3282893181e-33
SAKL0C09922g3.108ON3222753152e-33
Smik_2.2883.108ON3442913067e-32
KLTH0G00638gna 5ON3132893022e-31
Smik_2.289singletonON3442913032e-31
KLLA0F05775g7.285ON3092863002e-31
KNAG0C041107.285ON3112893002e-31
YBR149W (ARA1)3.108ON3442902996e-31
Suva_4.3983.108ON3442912998e-31
NCAS0I024203.108ON3202922942e-30
KLLA0F02728g3.108ON3303052924e-30
Kpol_1020.137.285ON3132862908e-30
Skud_2.2763.108ON3442912849e-29
Smik_4.1137.285ON3122862802e-28
KAFR0B012007.285ON3152882802e-28
KNAG0K020703.108ON3232852794e-28
TDEL0D051603.108ON3252892769e-28
ZYRO0B06138g3.108ON3282802751e-27
Skud_4.1317.285ON3122882723e-27
NCAS0A137407.285ON3092812704e-27
Kwal_47.19278na 5ON3142952644e-26
TDEL0D02790singletonON3292892629e-26
YDL124W7.285ON3122862574e-25
TBLA0F019807.285ON3022822565e-25
ZYRO0E09614gna 5ON3082832566e-25
NDAI0A023007.285ON3132892558e-25
SAKL0F00704gna 5ON3152482558e-25
ZYRO0C09196g7.285ON3122852513e-24
Kpol_381.8singletonON3092852461e-23
CAGL0J09394g7.285ON3112402382e-22
Kwal_33.13274singletonON1081052252e-22
SAKL0F09746g7.285ON3122942251e-20
Ecym_32647.285ON3112872136e-19
NDAI0C01480singletonON3433061361e-08
NDAI0J00730singletonON3433071324e-08
TDEL0A08000singletonON3192091235e-07
KLTH0A08052gsingletonON3383261227e-07
NDAI0H02960singletonON3443311219e-07
TBLA0G00960singletonON3213001173e-06
Kpol_449.4singletonON3413001148e-06
SAKL0E00264gsingletonON3152021121e-05
Suva_12.272singletonON2651861102e-05
ABR094W2.604ON3591431102e-05
Kpol_400.9singletonON3413011075e-05
NCAS0C019908.565ON3433261068e-05
NCAS0C02450singletonON3432181051e-04
ZYRO0D02816gsingletonON3433051051e-04
NCAS0F04070singletonON3443261032e-04
KLTH0E01474gsingletonON3131861013e-04
KAFR0C03670singletonON3433021004e-04
KNAG0M023402.604ON309125988e-04
KAFR0D04230singletonON342312960.001
NDAI0G01600singletonON344325950.002
KAFR0J00220singletonON343199940.002
SAKL0E00286gsingletonON338336930.003
TBLA0E05040singletonON342302930.003
Kwal_47.16887singletonON313256920.004
Kpol_2000.109singletonON342301910.005
Suva_9.17singletonON308173910.006
TDEL0C06010singletonON344304900.007
NCAS0J01740singletonON345298900.007
SAKL0C14058gsingletonON315202890.009
AAR033W3.462ON341239870.018
Ecym_22962.604ON340126870.018
CAGL0E05236gsingletonON344300860.021
TDEL0B069702.604ON338128860.022
Smik_3.208singletonON344333860.024
KLTH0D08844g2.604ON340124850.033
NCAS0A03110singletonON344331840.041
TPHA0H00110singletonON345199840.047
CAGL0F06061g2.604ON336133830.055
Suva_16.4543.462ON345197830.059
ZYRO0F04840gsingletonON379307820.067
TDEL0C053003.393ON426110820.079
CAGL0E05214gsingletonON346299810.091
TBLA0B10110singletonON345311790.15
NCAS0D03150na 6ON338195790.15
Suva_16.2248.565ON342212790.17
Kwal_47.166964.370ON1430120780.30
Kpol_1018.1552.436ON11570710.62
NCAS0I02160singletonON344202702.4
TBLA0B08920singletonON344261684.0
KAFR0A023402.604ON329144666.3
KAFR0E007308.579ON15989646.6
ZYRO0C06468g3.462ON341243667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18893
         (289 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   600   0.0  
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   434   e-154
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   385   e-135
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   290   1e-97
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   289   2e-97
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   287   1e-96
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   282   7e-95
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   282   9e-95
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   282   4e-94
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   280   4e-94
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   270   5e-90
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   270   1e-89
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   268   4e-89
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   267   1e-88
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   267   1e-88
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   266   2e-88
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   264   2e-87
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   262   6e-87
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   257   7e-85
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   244   9e-80
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   207   4e-65
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   204   6e-64
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   169   3e-50
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   167   3e-49
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   166   8e-49
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   165   1e-48
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   164   5e-48
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   163   6e-48
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   162   2e-47
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   162   2e-47
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   161   3e-47
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   160   1e-46
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   159   2e-46
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   158   5e-46
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   158   5e-46
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     158   6e-46
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   157   1e-45
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   155   5e-45
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   155   8e-45
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   155   1e-44
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   155   1e-44
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     155   1e-44
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   154   1e-44
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   154   1e-44
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   154   3e-44
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   154   4e-44
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   153   4e-44
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   152   2e-43
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   151   4e-43
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   150   8e-43
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   148   5e-42
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   147   2e-41
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   144   2e-40
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   144   2e-40
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   144   2e-40
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   142   5e-40
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 142   8e-40
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   142   8e-40
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   140   7e-39
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   140   9e-39
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   139   1e-38
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   138   2e-38
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   139   2e-38
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     138   2e-38
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     138   3e-38
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   139   5e-38
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   137   7e-38
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   137   9e-38
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   137   1e-37
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   137   2e-37
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   136   2e-37
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             135   8e-37
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   134   1e-36
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   134   2e-36
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     133   3e-36
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               133   3e-36
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               132   6e-36
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   130   4e-35
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     130   4e-35
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   129   1e-34
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   129   2e-34
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   128   2e-34
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   127   5e-34
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     127   1e-33
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   125   2e-33
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   122   7e-32
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   120   2e-31
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   121   2e-31
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   120   2e-31
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   120   2e-31
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   119   6e-31
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   119   8e-31
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   117   2e-30
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   117   4e-30
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   116   8e-30
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   114   9e-29
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   112   2e-28
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   112   2e-28
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   112   4e-28
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   110   9e-28
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   110   1e-27
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   109   3e-27
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   108   4e-27
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   106   4e-26
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     105   9e-26
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   103   4e-25
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   103   5e-25
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   103   6e-25
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     102   8e-25
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   102   8e-25
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   101   3e-24
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...    99   1e-23
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...    96   2e-22
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    91   2e-22
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...    91   1e-20
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    87   6e-19
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               57   1e-08
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    55   4e-08
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              52   5e-07
KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {...    52   7e-07
NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON}               51   9e-07
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      50   3e-06
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    49   8e-06
SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}...    48   1e-05
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    47   2e-05
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    47   2e-05
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    46   5e-05
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     45   8e-05
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    45   1e-04
ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} simila...    45   1e-04
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    44   2e-04
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    44   3e-04
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    43   4e-04
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    42   8e-04
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    42   0.001
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               41   0.002
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      41   0.002
SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON...    40   0.003
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             40   0.003
Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {O...    40   0.004
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    40   0.005
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     40   0.006
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    39   0.007
NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {...    39   0.007
SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON} conse...    39   0.009
AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic ho...    38   0.018
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    38   0.018
CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {...    38   0.021
TDEL0B06970 Chr2 complement(1232117..1233133) [1017 bp, 338 aa] ...    38   0.022
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    38   0.024
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    37   0.033
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    37   0.041
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 37   0.047
CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {...    37   0.055
Suva_16.454 Chr16 (792236..793273) [1038 bp, 345 aa] {ON} YPR127...    37   0.059
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    36   0.067
TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {O...    36   0.079
CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {...    36   0.091
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    35   0.15 
NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {O...    35   0.15 
Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088...    35   0.17 
Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {O...    35   0.30 
Kpol_1018.155 s1018 (401514..401861) [348 bp, 115 aa] {ON} (4015...    32   0.62 
NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON}               32   2.4  
TBLA0B08920 Chr2 (2116179..2117213) [1035 bp, 344 aa] {ON}             31   4.0  
KAFR0A02340 Chr1 complement(485299..486288) [990 bp, 329 aa] {ON...    30   6.3  
KAFR0E00730 Chr5 complement(154594..155073) [480 bp, 159 aa] {ON...    29   6.6  
ZYRO0C06468g Chr3 (493466..494491) [1026 bp, 341 aa] {ON} simila...    30   7.8  

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG
Sbjct: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
           LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI
Sbjct: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180
           AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT
Sbjct: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180

Query: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240
           RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP
Sbjct: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240

Query: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQP 289
           LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQP
Sbjct: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQP 289

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  434 bits (1115), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 201/288 (69%), Positives = 241/288 (83%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           M++T STTKTLTNGVKIPVL  G YE PKE+ E  V  A K GYRHVD AQLY NERE  
Sbjct: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
             +AKFLKE+P VSR ++FYTTKV+GDNHGYEKAKKSII+SLE  KE+EY+DL LIHNP 
Sbjct: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180
           A TE+RLGT+KALQE Y  GK++AIGVS+YSIKHLEELY+WEGL+V+PMVNQFELNPWLT
Sbjct: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180

Query: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240
           RK+L +YC+++ +V+EAFSP+TR ++FSDP +Q+L+K SYP +TPAQ+LIRWSLQMGF+P
Sbjct: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240

Query: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQ 288
           LPKS +  R  SNL ALDFEIS +DMK LTHD  +FLA   FDPI+T+
Sbjct: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETE 288

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  385 bits (988), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 176/286 (61%), Positives = 221/286 (77%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           M  TP TT  L NGVK+P L LG+Y+ PKEET + V  ALK GYR VD AQLYGNERE  
Sbjct: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
           LGI KFL+E+P VSRS+IF+TTK+   + GYE AKKSI +SL  VKE++YIDL LIH P+
Sbjct: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180
              E+RLGTWKA QE Y  GK++AIGVSNY I+HLEE+Y W+GLK++PMVNQ+ELNPWLT
Sbjct: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180

Query: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240
           RKEL  YC +KGMV++A+SPLTR ++  DP+L +L++ SYP QT AQIL+ WSLQMGF+P
Sbjct: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240

Query: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIK 286
           L K+ +  R   N+++ DFE+S  D+K LTHDD Y+L+   +DPIK
Sbjct: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIK 286

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  290 bits (741), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 187/266 (70%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L+NG+KIP +ALG YE P+ +T   V+  +K GYRH D A LYGNE+EVG GI ++L E 
Sbjct: 8   LSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNED 67

Query: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P N  R++IFYTTK+    +GY KAK +I + L +V  +EYIDLLLIH+P+  ++ RL T
Sbjct: 68  PKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLRLET 127

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           W+A+QEA   G V++IGVSNY  KH++EL NW  L+  P+VNQ E++PW+ R+EL +YC+
Sbjct: 128 WRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSELRHYPVVNQIEISPWIMRQELADYCK 187

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            KG+++EAF+PL  G K ++P L  LI     ++ P Q+LIRWSLQ G++PLPK+   KR
Sbjct: 188 SKGLIVEAFAPLCHGYKMTNPDL--LIVCKEVDRNPGQVLIRWSLQHGYLPLPKTRTVKR 245

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
              NL A  FE+SD+ MK L H D Y
Sbjct: 246 LEGNLAAYSFELSDEQMKTLDHPDAY 271

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  289 bits (739), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 138/266 (51%), Positives = 190/266 (71%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L+NG KIP +ALG Y+ P+ +T   V+  +K GYRH D A LYGNE+EVG GI K+L E 
Sbjct: 8   LSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNED 67

Query: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P N  R EIFYTTK+    +GY++AK +I + L +V  ++YIDLLLIH+P+  ++ RL T
Sbjct: 68  PGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLRLET 127

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           W+A+QEA  EG V++IGVSNY  KH++EL NW  LK +P+VNQ E++PW+ R+EL +YC+
Sbjct: 128 WRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADYCK 187

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            KG+V+EAF+PL  G K ++P L ++ K    ++ P Q+LIRWSLQ G++PLPK+   KR
Sbjct: 188 SKGLVVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVKR 245

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
              NL A +FE+SD+ MK L H D Y
Sbjct: 246 LEGNLAAYNFELSDEQMKFLDHPDAY 271

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 135/266 (50%), Positives = 188/266 (70%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
            +NG K+P +ALG Y+ P+ +T   V+  +K GYRH D A LYGNE+EVG GI K+L E 
Sbjct: 8   FSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHED 67

Query: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P N  R ++FYTTK+    +GY++AK +I + L +V  ++YIDLLLIH+P+  ++ RL T
Sbjct: 68  PENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLET 127

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           W+A+QEA  EG V++IGVSNY  KH++EL NW  LK +P+VNQ E++PW+ R+EL +YC+
Sbjct: 128 WQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQLKHKPVVNQIEISPWIMRQELADYCK 187

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            K +V+EAF+PL  G K +DP L ++ K    ++ P Q+LIRWSLQ G++PLPK+   KR
Sbjct: 188 SKNLVVEAFAPLCHGYKMTDPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVKR 245

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
             SNL A +FE+SD  MK L H D Y
Sbjct: 246 LESNLAAYNFELSDDQMKILDHPDAY 271

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  282 bits (722), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 187/267 (70%), Gaps = 3/267 (1%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
            L+NG +IP +ALG Y+ P+ +T   V+  +K GYRH D A LYGNE+EVG GI K+L E
Sbjct: 7   NLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 70  TPNVSRSE-IFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128
            P  ++ E IFYTTK+    +GY++AK +I + L +V  ++YIDLLLIH+P+  ++ RL 
Sbjct: 67  NPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRLE 126

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188
           TW+A+QEA  EG V++IGVSNY  KH++EL  W  L  +P+VNQ E++PW+ R+EL +YC
Sbjct: 127 TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDLTYKPVVNQIEISPWVMRQELADYC 186

Query: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248
           + KG+++EAF+PL  G K ++P L ++ K    ++ P Q+LIRWSLQ G++PLPK+   K
Sbjct: 187 KSKGLIVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTVK 244

Query: 249 RQISNLQALDFEISDKDMKALTHDDTY 275
           R   NL A DFE+ DK MK L H D Y
Sbjct: 245 RLEGNLAAYDFELLDKQMKILDHPDAY 271

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  282 bits (722), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 135/267 (50%), Positives = 186/267 (69%), Gaps = 3/267 (1%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           T+ NG+KIP LALG Y+ P+ +T + V+ ALK GYRH D A LYGNE+EVG GI K+LKE
Sbjct: 8   TMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKE 67

Query: 70  TP-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128
            P N  R ++FYTTK+    +GY  AK+ I + +  VKE+ YIDLLLIH+P++    RL 
Sbjct: 68  DPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLSGPRRRLE 127

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188
           T++A+QEA  +G V++IGVSNY  +H+EELY W+ LK +P+ NQ E++PW  R++L  +C
Sbjct: 128 TYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKHKPVANQIEISPWCMREDLTSWC 187

Query: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248
           + KG+++EAFSPLT G K  +P L  L K     +   Q+LIRWSLQ G +PLPK+ N  
Sbjct: 188 QSKGLIVEAFSPLTHGYKLKEPGLVSLAKKL--GRDTGQVLIRWSLQRGLLPLPKTQNPA 245

Query: 249 RQISNLQALDFEISDKDMKALTHDDTY 275
           R  SNL+  DFE++ +D+K L H + Y
Sbjct: 246 RLSSNLEVYDFELTPEDVKELDHPEAY 272

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  282 bits (721), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 131/269 (48%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 9   KTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLK 68
           + L++G +IP + LGVY+  ++  +  V+ AL+ GYR  D AQ Y NE  V  GIA +LK
Sbjct: 13  RRLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLK 72

Query: 69  ETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128
             P   R ++++TTK++  NHGYE  KKS+ KSL     + YIDL+L+H P++    RLG
Sbjct: 73  HAPGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188
           TW+AL+EA  EG+VR+IGVSNY  +HL EL  WEGLK+ P+VNQ E+NPWL R+EL +YC
Sbjct: 133 TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQYC 192

Query: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248
            +  + ++AFSPL RG++  DP LQ+ +   Y ++  AQIL+RWS+QMGFI LPK++  +
Sbjct: 193 RENNIAVQAFSPLMRGKRLDDPILQK-VAHQY-DKGVAQILVRWSIQMGFIVLPKAAKKE 250

Query: 249 RQISNLQALDFEISDKDMKALTHDDTYFL 277
           R   N    DFE+S + M  LTH D YF+
Sbjct: 251 RLAPNFDIWDFELSAETMSELTHSDDYFV 279

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  280 bits (717), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 135/267 (50%), Positives = 192/267 (71%), Gaps = 3/267 (1%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           TL+NGVKIP LALG Y+ PK  T + V+ ALK GYRH D A LY NER+VG GI ++L+E
Sbjct: 8   TLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 70  TP-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128
            P N  R ++FYTTK+    +GY+ AK++I + L+ V+++ YIDLLLIH+P++ + +RL 
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE 127

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188
           T+KA+QEA  EG V++IGVSNY   HLEEL +WEGLK +P+VNQ E++PW  R+EL ++C
Sbjct: 128 TYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGLKYKPVVNQIEISPWCMRQELAQWC 187

Query: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248
           + +G+V+E ++PLT G K  DPQL ++ +    N    Q+LIRWSLQ G++PLPK+SN  
Sbjct: 188 QSQGIVVEDYAPLTHGYKLKDPQLVKVAEEVGKNT--GQVLIRWSLQHGYLPLPKTSNVD 245

Query: 249 RQISNLQALDFEISDKDMKALTHDDTY 275
           R   NL   DF++++  +KA  H + +
Sbjct: 246 RLPGNLDVYDFKLTESQIKAFEHPEAH 272

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  270 bits (690), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 176/265 (66%), Gaps = 2/265 (0%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L +G  IP + LG Y+ P   T   V  AL+ GYRH+D A LYGNE EV  G   FL   
Sbjct: 9   LASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFLGRH 68

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGTW 130
           P+VSR +IFYTTK+     GYEKAK++I + +E +  + YIDLLL+H+PI   + R GTW
Sbjct: 69  PDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQVRRGTW 128

Query: 131 KALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEK 190
           KA+QEA  +G VR+IGVS+Y  +HLE+L+ W  LK  P VNQ E++PW+ R++L +YC+ 
Sbjct: 129 KAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWSELKHAPAVNQIEISPWIMRQQLADYCKS 188

Query: 191 KGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQ 250
           KG+V+EA+SPLT G K  DP L ++ + +   + P Q+L+RWSLQ G++PLPK+    R 
Sbjct: 189 KGIVVEAYSPLTHGYKLDDPDLLKVAEET--GKNPGQVLLRWSLQHGYVPLPKTKTVSRL 246

Query: 251 ISNLQALDFEISDKDMKALTHDDTY 275
             NL   D+E+S + MK L H + Y
Sbjct: 247 QLNLDVFDWELSPEHMKLLDHPEAY 271

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  270 bits (689), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 181/275 (65%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           M L+   T  L++   IP +ALG Y+ P  ET   V  AL  GYRH D A LY NE EV 
Sbjct: 1   MKLSIQKTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVA 60

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
            GI+ +L   P   R EIFYTTK+     GY+ AK++I + ++ V++++YIDLLL+H+PI
Sbjct: 61  QGISNWLIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI 120

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180
              + R  TW+A+QEA  EG V++IGVSN+ IKHL+EL+ W+GLK  P+VNQ E++PWL 
Sbjct: 121 GGPQIREETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWDGLKYRPVVNQIEISPWLM 180

Query: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240
           R+EL ++C+ +G+V+EA++PLT G K + P L ++       +   QILIRWSLQ G++P
Sbjct: 181 RQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNNTKNTGQILIRWSLQHGYVP 240

Query: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTY 275
           LPK+    R  SNL   DFE+++  MK L H + Y
Sbjct: 241 LPKTKTIGRLESNLDVYDFELTEDQMKFLDHPEAY 275

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  268 bits (685), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L++G  +P L LG Y+ P+ ET   V+ ALK+GYRH+D A LYGNEREVG G+ K+LKE 
Sbjct: 12  LSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKED 71

Query: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P N  R ++FYTTK+    +GY  AK++I + L+ V+ + YID+LLIH+P++ T  RL T
Sbjct: 72  PKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRLET 131

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           +KA+QEA   G VR+IGVSNY   H++EL  WE LK +P+VNQ E++PW+ R++L +YC+
Sbjct: 132 YKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEELKHKPVVNQIEISPWVMRQDLADYCK 191

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            KG+V+EAFSPLT G K   P +  + +     +   Q+LIRWSLQ G++PLPKS + +R
Sbjct: 192 SKGLVVEAFSPLTHGYKIKHPNVVRVAEEV--GRNTGQVLIRWSLQHGYVPLPKSRSVER 249

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
              NL+  DFE+S + +  L     Y
Sbjct: 250 LKGNLEVYDFELSPEQITFLDQPQAY 275

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  267 bits (682), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 130/266 (48%), Positives = 177/266 (66%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L+NG  IP + LG Y+ P   T + V+ ALK+GYRH D A LYGNE EVG GI ++L E 
Sbjct: 11  LSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLED 70

Query: 71  PNVSRSE-IFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P  +R E +FYTTK+    +GYEKA K+I   L+ VK +EYIDLLLIH+P+  T+ RL T
Sbjct: 71  PENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLRLET 130

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           WKA+QEA   G V++IGVSNY + H++EL  W+ LK +P+VNQ E++PWL R+EL +YC+
Sbjct: 131 WKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQYLKYKPVVNQIEISPWLMRQELADYCK 190

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
              + +E +SPLT G K +D  L+++   +  N    Q+LIRWSLQ G+IPLPK+    R
Sbjct: 191 SNSIFVECYSPLTHGYKLNDQDLKKVANETGKN--VGQVLIRWSLQHGYIPLPKTRTINR 248

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
             +NL   DF ++   M  L H  +Y
Sbjct: 249 LKTNLDVYDFNLTSDQMTILDHPLSY 274

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  267 bits (682), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L++G  +P + LG Y+ P   T   V+ ALK GYRH+D A LYGNEREVG GI K+LKE 
Sbjct: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71

Query: 71  PNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P+ + R ++FY TK+    +GY  AK++I +  E V+ + YIDLLLIH+P++ + +RL T
Sbjct: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLET 131

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           +KA+QEA  +G VR+IGVSNY + H++EL NW  LK +P VNQ E++PWL R+EL +YC+
Sbjct: 132 YKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCK 191

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            +G+++EA++PLT G K + P +  + K +  N    Q+LIRWSLQ G++PLPK+ + KR
Sbjct: 192 SRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNS--GQVLIRWSLQHGYVPLPKTKSVKR 249

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
             SNL   + E++ + M  L   D Y
Sbjct: 250 LPSNLDVYNIELTQEQMDFLDQPDAY 275

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  266 bits (680), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 180/270 (66%), Gaps = 3/270 (1%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           M L+   +  L++G  IP + LG YE P  +T + V  AL+ GYRH D A LYGNE EVG
Sbjct: 1   MELSVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVG 60

Query: 61  LGIAKFLKETPNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP 119
            GI K+L E P  + R ++FYTTK+    HGYEKAKK+I   L++V+++ YIDLLLIH+P
Sbjct: 61  QGIKKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSP 120

Query: 120 IAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWL 179
           +   + RL T++A+QEA   GKVR+IGVSNY  +H+EEL NWE LK +P+VNQ E++PW 
Sbjct: 121 LGGKKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWC 180

Query: 180 TRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFI 239
            R+EL ++C+KKG+++EA++PLT G K  DP L ++           Q LIRWSLQ G+I
Sbjct: 181 MRQELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEV--GCDVGQALIRWSLQKGYI 238

Query: 240 PLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           PLPK+ +  R  SNL    FE +   M  L
Sbjct: 239 PLPKTQSVSRLASNLDVFSFEWTTDQMDQL 268

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  264 bits (675), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L++G  +P + LG Y+ P+ ET   V+ ALKSGYRH+D A LYGNE EVG GI K+L+E 
Sbjct: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78

Query: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
           P +  R ++FYTTK+    +GY  AK++I + +E V  + YIDLLLIH+P++ T  RL T
Sbjct: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLET 138

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           +KA+QEA  EG VR+IGVSNY   H++EL  W+ LK +P+VNQ E++PW+ R++L +YC+
Sbjct: 139 YKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCK 198

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
            KG+V+EAFSPLT G K   P +  + K +       ++LIRWSLQ G++PLPKS + +R
Sbjct: 199 SKGLVVEAFSPLTHGYKLKHPDVLLVAKET--GTDAGRVLIRWSLQHGYVPLPKSRSVER 256

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
              N++A DFE+S + +  L     Y
Sbjct: 257 LKGNVKAYDFELSPEQVSFLDQPQAY 282

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  262 bits (670), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 181/267 (67%), Gaps = 3/267 (1%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           T  NG +IP +ALG Y+ P+  T   V+ ALK+GYRH D A LYGNE +VG GI ++++E
Sbjct: 9   TFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 70  TPNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG 128
            P  + RS++FYTTK+    +GY +A+ +I + L  V  ++YID+LLIH+P+    +RL 
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE 128

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYC 188
           TW+A+QEA   G V+ IGVSNY  +H+EEL  WE L ++P+VNQ E++PW+ R EL +YC
Sbjct: 129 TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELADYC 188

Query: 189 EKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSK 248
           +  G+V+EAF+PLT G K  D  L  + K     ++  Q+LIRWSLQ G++PLPK+   K
Sbjct: 189 KSVGLVVEAFAPLTHGYKLHDADLVRVSKEV--GRSTVQVLIRWSLQHGYLPLPKTKTVK 246

Query: 249 RQISNLQALDFEISDKDMKALTHDDTY 275
           R   NL+A +F+++ + M+ + H D Y
Sbjct: 247 RLEENLEAYNFQLTTEQMQLIDHPDAY 273

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  257 bits (657), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 124/266 (46%), Positives = 177/266 (66%), Gaps = 3/266 (1%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L +G KIP LALG Y+ P   T   V  ALK GYRH D A LYGNEREVG GI  ++ E 
Sbjct: 13  LQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINED 72

Query: 71  -PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129
             +  R ++FYTTK+    +GY +AK++I + ++ V  + YID+LLIH+P++    RL T
Sbjct: 73  KAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRLET 132

Query: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189
           WKA+QEA  EG V++IGVSNY   H+EEL  W+ LK +P+VNQ E++PW+ R+EL +YC+
Sbjct: 133 WKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISPWVMRQELADYCK 192

Query: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
              +V+EA++P+  G K +DP L+E+ K +  N  P Q+LIRWSLQ G++PLPK+    R
Sbjct: 193 SVNLVVEAYAPMAHGYKMNDPGLREISKETGMN--PGQLLIRWSLQHGYLPLPKTKTVAR 250

Query: 250 QISNLQALDFEISDKDMKALTHDDTY 275
             SNL   + +++   +K + H + Y
Sbjct: 251 LASNLDVYNHKLTLDQVKRMDHPEAY 276

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  244 bits (622), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 167/260 (64%), Gaps = 3/260 (1%)

Query: 8   TKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           T TLTNG  +P L LG Y  PK  T   V  ALK GYRH D A  YGNE EVG GIA +L
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 68  KETPNVSR-SEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEER 126
            E P+ +R  ++FY TK+    +GY +AK +I + L+ V  + YIDLLLIH+P   + +R
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 127 LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCE 186
           L T++A+QE+   G V++IGVSNY   HL+ELY    LK  P+VNQ E+ PWL R +L +
Sbjct: 125 LATYEAMQESVDAGIVKSIGVSNYERHHLQELYAMPNLKHNPVVNQIEVTPWLPRNDLVD 184

Query: 187 YCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSN 246
           YC+  G+ ++A+SPL  G + +DP +  L   +  N TPAQILI WSL  G+ PLPK+ N
Sbjct: 185 YCKSIGLAIQAYSPLGCGDRVNDPYIASL--ATQKNCTPAQILIAWSLAKGYAPLPKTQN 242

Query: 247 SKRQISNLQALDFEISDKDM 266
            +R  SNL + +  ++ +++
Sbjct: 243 IQRLQSNLDSYNVSLTAEEL 262

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  207 bits (527), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 167/263 (63%), Gaps = 11/263 (4%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           +++   T   L NG +IPV+  GVYE PKE+T   V++ALK GYRH+D A LY N++E  
Sbjct: 5   IDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAA 64

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKE-IEYIDLLLIHNP 119
            G+ K+L ET   +R  I++TTK+     G E+ +K++ +   DVKE I Y+DLLL+H+P
Sbjct: 65  QGVRKYLDETGE-ARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSP 123

Query: 120 IAATEERLGTWKALQEAYAEG-----KVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFE 174
               + RL TW  L++A  E      ++++IGVSN+ + HLEEL   +  KV+P+++Q E
Sbjct: 124 RGGAKRRLETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELL--KVAKVKPVLDQLE 181

Query: 175 LNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSL 234
           L+PWL R EL +Y ++K +  EA+SPLT+G +  DP+L  L   +  N+  A IL+RWS 
Sbjct: 182 LHPWLPRVELRKYLKEKDIFAEAYSPLTQGYRLQDPELLALEAKTGINK--AVILLRWSF 239

Query: 235 QMGFIPLPKSSNSKRQISNLQAL 257
             GF+ L KSSN +R   NL  L
Sbjct: 240 LQGFVVLVKSSNPERIRQNLAVL 262

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  204 bits (519), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 171/289 (59%), Gaps = 22/289 (7%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           +++   T   L NG ++PV+  GVY+ P EET   V+TAL+ GYRH+D A +Y N+++  
Sbjct: 5   IDINRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAA 64

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKE-IEYIDLLLIHNP 119
            G+ +FL+ET    R E+++TTK+     G +   +++ +   DVKE I Y+DLLL+H+P
Sbjct: 65  QGVHRFLEET-GTPREEVWFTTKLWNTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSP 123

Query: 120 IAATEERLGTWKALQEAYAEG-----KVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFE 174
           +   + RL TW  L+ A  E      ++RAIGVSN+ ++HL+EL   E   V+P+V+Q E
Sbjct: 124 LTDAQRRLETWAVLERAVQEPASSALEIRAIGVSNFGVRHLQELL--EVATVKPVVDQLE 181

Query: 175 LNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSL 234
           L+PWL R EL  +  + G++ EA+SPLT+G +  DP+L  L   S    +  +IL+RWS 
Sbjct: 182 LHPWLPRAELRAFLRENGILAEAYSPLTQGVRLQDPELLALEAKS--GLSKGEILLRWSF 239

Query: 235 QMGFIPLPKSSNSKRQISNLQ-----------ALDFEISDKDMKALTHD 272
             GF  L KS+N +R   NL            +LD E+ D   K  +HD
Sbjct: 240 LQGFAVLVKSNNPQRIRDNLAVLPAKTDSWKVSLDQELWDALDKPDSHD 288

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  169 bits (429), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 150/289 (51%), Gaps = 40/289 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T  L  G  IP L LG + +  EE  ++V +A+K GYRH+D A +YGNE  VG  I  
Sbjct: 9   SATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124
                  V R+E+F TTK+ G      EKA  + +K L     ++Y+DL LIH PIA   
Sbjct: 67  ---RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLG----LDYVDLYLIHWPIAFKT 119

Query: 125 ERLG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
           + +                           TW+ +QE  A GK +A+GVSN+S+ +L+EL
Sbjct: 120 DNIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKEL 179

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELI 216
               G K+ P  NQ EL+P L + EL E+ + KG+V+EA+SPL         +P + E+ 
Sbjct: 180 LASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVA 239

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
           K       PAQ+LI W +Q G++ LPKS N KR  SN +  D    D D
Sbjct: 240 KKY--GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVD 286

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  167 bits (422), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 148/281 (52%), Gaps = 38/281 (13%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L  G  IPV+ LG +++P+E+  + V +AL++GYRH+D A +YGNE  VG GI       
Sbjct: 12  LNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGI-----RD 66

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG-- 128
             V R EIF TTK+ G      +A   +  SL+ +  ++Y+DL LIH P+      +   
Sbjct: 67  SGVPREEIFVTTKLWGTQQRDPEAALDL--SLQRLG-LDYVDLYLIHWPVPLNASSITDG 123

Query: 129 ------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGL 164
                                   TW+ +Q     GK +AIGVSN+SIK++E L      
Sbjct: 124 NYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPD 183

Query: 165 KVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELIKTSYPN 222
            + P  NQ E++P L + EL +YC+ KG+++EA+SPL        +DP + E I + Y N
Sbjct: 184 FIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTI-EGIASKY-N 241

Query: 223 QTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
             PA ILI W    G++ LPKS N +R  +NL+ LD    D
Sbjct: 242 AEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTED 282

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  166 bits (419), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 151/280 (53%), Gaps = 37/280 (13%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L  G  IP+L  G + + +EE  + V +A+K GYRH+D A +YGNE  VG  I       
Sbjct: 13  LNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGRAI-----RD 67

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG-- 128
             V R E+F TTK+   N    +  K++ +SL+ +  ++Y+DL LIH P+    +R+   
Sbjct: 68  SGVPREELFVTTKLW--NTQQREPAKALDQSLQRLG-LDYVDLYLIHWPLPIKTDRITDG 124

Query: 129 -----------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLK 165
                                  TW+ +QE  + GK RA+GVSN S+  LE+L   +G K
Sbjct: 125 NLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGNK 184

Query: 166 VEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKFSD-PQLQELIKTSYPNQ 223
           V P V Q E +P L + +L ++C K  ++LEA+SPL ++G    D P ++E+ K    N 
Sbjct: 185 VVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKY--NA 242

Query: 224 TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
            PAQI+I W ++ G++ LPKS    R  SNLQ LD E  D
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDED 282

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  165 bits (417), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/301 (35%), Positives = 163/301 (54%), Gaps = 43/301 (14%)

Query: 1   MNLTPST-TKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREV 59
           M+L  ST T  L  G +IPV+ LG + +   +   +V  ALK GYRH+D A +YGNE +V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 60  GLGIAKFLKETPNVSRSEIFYTTKVSGDNH-GYEKAKKSIIKSLEDVKEIEYIDLLLIHN 118
           G  I     +   V R EIF TTK+ G  H    KA  S +K L     ++Y+DL L+H 
Sbjct: 61  GRAI-----KDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLG----LDYVDLYLMHW 111

Query: 119 PIA----ATEER----------------------LGTWKALQEAYAEGKVRAIGVSNYSI 152
           P+A     +EE+                      + TW+ +QE    GK +AIGVSN+SI
Sbjct: 112 PVALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSI 171

Query: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDP 210
            +L+ L N       P  NQ E++P   + EL EYC+ + +++EA+SP          +P
Sbjct: 172 NNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEP 231

Query: 211 QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           +L +L +    N + AQ++I WS+Q G++ LPKS +++R  +NL+ L  +  D+DM+ +T
Sbjct: 232 ELHKLAEKY--NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLK--DEDMETIT 287

Query: 271 H 271
           +
Sbjct: 288 N 288

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  164 bits (414), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 169/310 (54%), Gaps = 45/310 (14%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L  G ++P + LG +++ + +    V TALK+GYRH+D A +Y NE EVG    K ++++
Sbjct: 12  LNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG----KAIRDS 67

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI----AATEER 126
             V R+EIF TTK+ G        + ++ +SLE +  ++Y+DL LIH PI    A  EE 
Sbjct: 68  -GVPRNEIFVTTKLWGTQQ--RTPQLALEQSLERLG-LDYVDLYLIHWPIPLNPAQCEES 123

Query: 127 -----------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEG 163
                                  + TW+ +QE  A GK +A+GVSN+SI +++EL +  G
Sbjct: 124 GNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSSPG 183

Query: 164 LKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSYP 221
            K+ P VNQ EL+P L + EL  +C++KG+V+EA+SPL  T      +P ++EL K    
Sbjct: 184 NKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY-- 241

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH----DDTYFL 277
           N   A +++ W +Q G + LPKS    R ISNLQ L   ++ +D++ +T+          
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLT--LAPEDVEKITNLSKEKGEKRT 299

Query: 278 ATEDFDPIKT 287
              DF P  T
Sbjct: 300 CAPDFSPFNT 309

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  163 bits (413), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 159/295 (53%), Gaps = 41/295 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64
           + T  L  G  IP + LG +++  E E    V  ALK+GYRH+D A +Y NE +VG  I 
Sbjct: 9   TATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQVGKAI- 67

Query: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA--- 121
                   + R EIF TTK+ G  H     + ++ +SLE +  ++Y+DL L+H P+A   
Sbjct: 68  ----NDSGIPREEIFVTTKLWGTQH--RDPETALNQSLERLG-LDYVDLYLMHWPVAFKP 120

Query: 122 -----------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
                                   T   + TW+ +QE    GK RA+GVSN+SI +L+ L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216
            +  G K+ P  NQ E +P L + EL ++C++KG++LEA+SPL  T     ++P++ E+ 
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           K    N  PAQ++I W +Q G + LPKS + +R  +N Q   FE+S  +M +L +
Sbjct: 241 KKH--NVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQT--FELSKDEMDSLNN 291

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  162 bits (409), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 152/283 (53%), Gaps = 42/283 (14%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           +  G  IPVL LG ++A   +T   V  AL+SGYRH+D A +Y NE  VG  I       
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI-----RD 62

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG-- 128
             V R +IF TTK+          + ++  SLE +  ++Y+DL L+H P+A   + +   
Sbjct: 63  SGVPREKIFVTTKLWCTQQ--RDPQSALNASLERLG-LDYVDLYLMHFPVALKTDLIKDG 119

Query: 129 ------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE-G 163
                                   TW+ +Q+    GK +AIGVSN+SIK++EE+   E G
Sbjct: 120 NVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 164 LKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSYP 221
           L V P  NQ E++P L + EL EYC+ KG+++EA+SPL  +     +DP   +LIK +  
Sbjct: 180 LSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDP---DLIKLAEK 235

Query: 222 NQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           +Q  PAQILI W +  G+  LPKS NSKR  SNL+ +    +D
Sbjct: 236 HQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSND 278

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  162 bits (409), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 152/283 (53%), Gaps = 42/283 (14%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           +  G  IPVL LG ++A   +T   V  AL+SGYRH+D A +Y NE  VG  I       
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAI-----RD 62

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLG-- 128
             V R +IF TTK+          + ++  SLE +  ++Y+DL L+H P+A   + +   
Sbjct: 63  SGVPREKIFVTTKLWCTQQ--RDPQSALNASLERLG-LDYVDLYLMHFPVALKTDLIKDG 119

Query: 129 ------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE-G 163
                                   TW+ +Q+    GK +AIGVSN+SIK++EE+   E G
Sbjct: 120 NVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 164 LKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSYP 221
           L V P  NQ E++P L + EL EYC+ KG+++EA+SPL  +     +DP   +LIK +  
Sbjct: 180 LSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDP---DLIKLAEK 235

Query: 222 NQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           +Q  PAQILI W +  G+  LPKS NSKR  SNL+ +    +D
Sbjct: 236 HQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSND 278

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  161 bits (408), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 162/294 (55%), Gaps = 41/294 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           ++T  L  G  IPV+ LG +++ + E  +    ALK+GYRH+D A +Y NE E+G  I  
Sbjct: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI-- 65

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
                 N+ R+E+F TTK+ G  H      +++ +SL+ +  ++Y+DL L+H P+A    
Sbjct: 66  ---RDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119

Query: 122 --------ATEER--------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159
                      ER              + TW+ +QE   E K RAIGVSN+SI +L+EL 
Sbjct: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIK 217
           N +G KV P  NQ E++P L + EL  +C++KG+VLEA+SPL  T      + ++ E+ K
Sbjct: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238

Query: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            +  N    Q++I W  Q G++ LPKS   +R   N +   F++SD+D   L++
Sbjct: 239 KNGVNA--GQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  160 bits (404), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 156/295 (52%), Gaps = 42/295 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T  L  G  IPVL  G + +      H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
              +   V R EIF TTK+ G      +A  ++ KSL+ +  ++Y+DL L+H P+    +
Sbjct: 67  ---KDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLG-LDYVDLYLMHWPVPLKTD 120

Query: 126 R--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159
           R                          + TW+ +QE    GK +A+GVSN+SI +++EL 
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LIK 217
                KV P  NQ E++P L + EL  +C++KG+V+EA+SP         P L+E  +I 
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANA---PLLKEQAIID 237

Query: 218 TSYPNQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            +  +   PAQ++I WS+Q G++ L KS N +R +SN +   F + + D K +++
Sbjct: 238 MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 162/295 (54%), Gaps = 42/295 (14%)

Query: 7   TTKTL--TNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64
           +TKTL    G KIP + LG +++   +   +V  ALK GYRH+D A +YGNE +VG  I 
Sbjct: 8   STKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVGQAI- 66

Query: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI---- 120
               +   V R EIF TTK+    H +E A K++ +SL+ +  ++Y+DL L+H P+    
Sbjct: 67  ----KDSGVPREEIFVTTKLWCTQH-HEPA-KALDQSLKRLG-LDYVDLYLMHWPVRLDP 119

Query: 121 ----------AATEER------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
                       T+E             + TW+ +QE     K RA+GVSN+SI +L++L
Sbjct: 120 NYIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216
               G ++ P  NQ EL+P L + EL ++C+ KG+++EA+SPL  T      +P + E+ 
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           K +  N  P  ++I W  Q G++ LPKS N  R  +N +   F +SD+D +A+ +
Sbjct: 240 KKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKV--FTLSDEDFEAINN 290

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  158 bits (400), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 148/287 (51%), Gaps = 38/287 (13%)

Query: 5   PSTT-KTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGI 63
           PST+   L  G  IP++ LG Y +  E     V  A+K GYRH+DCA LY NE  VG  I
Sbjct: 6   PSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAI 65

Query: 64  AKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAAT 123
                    V R E+F TTKV    H   +  K++ +SL  +  ++Y+DL L+H P A  
Sbjct: 66  -----RDSGVPREELFVTTKVWNTQH--REPAKALEESLSRLG-LDYVDLFLMHWPQALR 117

Query: 124 EERLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
            ER+                          TW  +Q+  A GK +A+GVSN+S+K LE+L
Sbjct: 118 TERITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKL 177

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216
               G KV P  NQ E++P L +  L ++C+KK ++L A+SPL   +     DP + E+ 
Sbjct: 178 LADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEI- 236

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
             +     PAQI+I W ++ G++ LPKS    R  SNLQ ++   S+
Sbjct: 237 -AAKHKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSE 282

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  158 bits (400), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 155/293 (52%), Gaps = 41/293 (13%)

Query: 3   LTPSTTKT----LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNERE 58
           +T ++TKT    L  G  +P + LG +++ +E+    V +ALK+GY+H+D A +Y NER 
Sbjct: 1   MTVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERA 60

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHN 118
           VG  I         + R E+F TTK+    H   KA  ++  SLE +  ++Y+DL LIH 
Sbjct: 61  VGKAI-----RDSGIPRDELFITTKLWSTQHRDPKA--ALDGSLERLG-LDYVDLYLIHY 112

Query: 119 PIAATEERL--------------------------GTWKALQEAYAEGKVRAIGVSNYSI 152
           P+A   +R+                           TW+ +Q     GK +A+GVSN+SI
Sbjct: 113 PVAFKTDRIEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSI 172

Query: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDP 210
            +L+ L   +     P VNQ E++P L + EL ++C+ K +V+EA+SPL  T  Q  +D 
Sbjct: 173 NNLKTLLESDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDD 232

Query: 211 QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
            LQ++ +     Q PAQILI W +  G+  LPKS   KR  +N + +D +  D
Sbjct: 233 TLQKIAEKXXDAQ-PAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKED 284

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  158 bits (400), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 162/295 (54%), Gaps = 41/295 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64
           +TT  L  G  I  + LG +++  E E    V  ALK+GYRH+D A +YGNE +VG  I 
Sbjct: 18  TTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI- 76

Query: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAA-- 122
                   V R EIF TTK+    H    A   +  SL+ +  ++Y+DL L+H P+    
Sbjct: 77  ----NDSGVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMHWPVTLNP 129

Query: 123 ------------------------TEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
                                   T + + TW+ +QE    GK RA+GVSN+SI +L+++
Sbjct: 130 RSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKV 189

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216
            +  G KV P VNQ E++P L ++EL E+C  KG++LEA+SPL  T     ++P L  L 
Sbjct: 190 LSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLA 249

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           K  +  QT AQI+I W +Q G+I LPKS +++R  +N + L  ++SD++M+ + +
Sbjct: 250 K-KHGVQT-AQIVISWHVQRGYIVLPKSVHAERIQANFKTL--KLSDEEMREINN 300

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  157 bits (397), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 137/269 (50%), Gaps = 36/269 (13%)

Query: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70
           L  G  IP L  G + +   +    V TALK+GYRH+D A +YGNE  VG GI       
Sbjct: 13  LNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGI-----RD 67

Query: 71  PNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH-----NPIAATEE 125
             + R EIF TTK+   N        ++ +SLE +  ++Y+DL LIH      P+   E 
Sbjct: 68  SGIPREEIFVTTKLW--NTQQRDPASALDESLERLG-LDYVDLFLIHWPVPLKPVGGPEN 124

Query: 126 RLG-------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKV 166
            L                    TW+ +Q     GK RA+GVSN+SIK+LE+L N     +
Sbjct: 125 LLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVL 184

Query: 167 EPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSYPNQT 224
            P VNQFE++P L + EL  YC+ KG+V+EA+ PL  +     SDP + E I   Y +  
Sbjct: 185 VPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAE-IADKY-HVK 242

Query: 225 PAQILIRWSLQMGFIPLPKSSNSKRQISN 253
           PA +LI W +  G+  LPKS    R  SN
Sbjct: 243 PANVLINWGISRGYCVLPKSFTPARIASN 271

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  155 bits (393), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 154/292 (52%), Gaps = 41/292 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T TL  G KIP+  LG +++  ++    V  ALK GY+H+D A  Y NE  VG    K
Sbjct: 11  TDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVG----K 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE- 124
            +KE+  + R E+F TTKV  D         ++  SL+ +   EY+DLLL+H P+   E 
Sbjct: 67  AVKES-GIPREELFITTKVWNDQQ--RDPAGALDLSLKKLG-TEYVDLLLMHWPVPFKEP 122

Query: 125 ------------------------ERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
                                   + + TW  +Q+    GKV+AIGVSN+SI +LEEL N
Sbjct: 123 ENSTLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLN 182

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSY 220
            EG  V P VNQ EL+  L + EL EYC+KKG+V+EA+SPL      S P L++      
Sbjct: 183 AEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSS---SAPLLKDATVNKV 239

Query: 221 PNQ---TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
             +   TPA +L+ +    G + LPKS    R ISN +   F++ ++D+K L
Sbjct: 240 AEKYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEY--FKMDEEDIKLL 289

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  155 bits (392), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 167/309 (54%), Gaps = 45/309 (14%)

Query: 11  LTNGVKIPVLALGVYE-APKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           L  G  I  + LG +  A   +   +V  AL++GYRH+D A +YGNE EVG    + ++E
Sbjct: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVG----RAIRE 69

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERL-- 127
           +  V R EIF TTK+    H  ++ + ++ +SL+ +  ++Y+DL L+H P+    E +  
Sbjct: 70  S-GVPRGEIFVTTKLWCTQH--KEPELALDQSLKRLG-LDYVDLYLMHWPVRMRGENMPE 125

Query: 128 ------------------------GTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEG 163
                                    TW+ +Q+    GK RAIGVSN+SI +L++L    G
Sbjct: 126 GDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASPG 185

Query: 164 LKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELIKTSYP 221
            K+ P  NQ E++P L ++EL ++C  KG+V+EA+SPL         +P + E+ K +  
Sbjct: 186 NKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN-- 243

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH----DDTYFL 277
             + AQ++I W++Q G+I LPKS N +R  +NL  L F ++ +D +A+ +      T  +
Sbjct: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANL--LTFTLTSEDFEAVNNISKVQGTKRI 301

Query: 278 ATEDFDPIK 286
              D++P K
Sbjct: 302 IDPDWEPFK 310

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 156/293 (53%), Gaps = 40/293 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T +L  G +IP + LG +++   +   +V  ALK GYRH+D A +Y NE +VG  I  
Sbjct: 9   TRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  V R +IF TTK+    H +E A K++ +SL  +  ++Y+DL L+H P+    +
Sbjct: 67  ---RDSGVPREKIFVTTKLWCTQH-HEPA-KALDQSLRRLG-LDYVDLYLMHWPVRLDPD 120

Query: 126 R--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159
                                      + TW+ +QE    GK +A+GVSN+SI +L++L 
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIK 217
             +G K+ P  NQ E++P L + EL ++C  KG+++E +SPL  T      +P + E+ K
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            +  N  PA ++I W  Q G++ LPKS N  R  +N +   F +SD+D +A+ 
Sbjct: 241 KN--NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAIN 289

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 157/295 (53%), Gaps = 42/295 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T  L  G  IPVL  G + +      H+V  ALK+GYRH+D A +Y NE EVG    K
Sbjct: 9   SATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEEVG----K 64

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
            +K++  V R EIF TTK+ G      +A  ++ KSL+ +  ++Y+DL L+H P+    +
Sbjct: 65  AIKDS-GVPREEIFITTKLWGTEQRDPEA--ALDKSLKRLG-LDYVDLYLMHWPVPLKTD 120

Query: 126 RLG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159
            +                           TW  +Q+    GK +A+GVSN+SI +++EL 
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LIK 217
                K+ P  NQ E++P L + EL  +C++KG+V+EA+SP         P L+E  +I 
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANA---PLLKEQAIID 237

Query: 218 TSYPNQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            +  +   PAQ++I WS+Q G++ L KS N +R +SN +   F + + D K +++
Sbjct: 238 MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKTISN 290

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 150/293 (51%), Gaps = 39/293 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T  L  G  IP + LG + +   +   +V  A K GYRH+D A +YGNE +VG  I +
Sbjct: 9   TATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQVGKAINE 68

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  V+RSE+F TTK+ G        + ++ +SL+ +  ++Y+DL LIH P+A   +
Sbjct: 69  C-----GVTRSELFVTTKLWGTQQ--RDPETALNQSLKRLG-LDYVDLYLIHWPVAFKTD 120

Query: 126 R-------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
                                     + TW+ +Q     GK +AIG+SN+SI +++EL  
Sbjct: 121 TIKDGNLLTIPKKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLA 180

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKT 218
                V P  NQ E++P L + EL  +C++KG+V+EA+SPL         D  + E+ K 
Sbjct: 181 APTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKR 240

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           +  N    Q++  W +Q G++ LPKS    R ISNL+   F +SD DM  + +
Sbjct: 241 N--NVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDDDMTKINN 289

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  154 bits (390), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 147/285 (51%), Gaps = 37/285 (12%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S    L  G  IP+L  G + + +E+  + V TALK GYRH+D A +YGNE  VG  I  
Sbjct: 8   SAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI-- 65

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  V R ++F TTK+    H     + ++ +SL+ +  ++Y+DL LIH P+    +
Sbjct: 66  ---RDSGVPRDQLFVTTKLWNTQH--RDPRLALDQSLQRLG-LDYVDLYLIHWPLPLRTQ 119

Query: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           R+                          TW+ +Q+     K RA+GVSN+S+  L+ L  
Sbjct: 120 RITDGNLFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLA 179

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKF-SDPQLQELIKT 218
             G KV P VNQ E +P L + +L ++C +  ++LEA+SPL ++G     +P ++E+   
Sbjct: 180 ASGTKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEI--A 237

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           S  N  PAQ+LI W ++ G++ LPKS    R  SN + +D    D
Sbjct: 238 SKHNADPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDD 282

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  154 bits (390), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 150/294 (51%), Gaps = 44/294 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T  L  G  IP L  G + +      H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124
              +   ++R EIF TTK+ G +    E A    +K L     ++Y+DL L+H P+    
Sbjct: 67  ---KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLG----LDYVDLYLMHWPVPLKT 119

Query: 125 ER--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
           +                           + TW  +QE    GK RA+GVSN+SI +++EL
Sbjct: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LI 216
                 K+ P  NQ E++P L + EL  +C++KG+V+EA+SP         P L+E  +I
Sbjct: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANA---PLLKEQAII 236

Query: 217 KTSYPNQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
             +  +   P+Q++I WS+Q G++ L KS N +R +SN +   F + + D KA+
Sbjct: 237 DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  154 bits (388), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 158/290 (54%), Gaps = 43/290 (14%)

Query: 1   MNLTPSTTK-TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREV 59
           M L+ ST K TL +G ++P + LG +++ + +    V  ALK+GYRH+D A +YGNE EV
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60

Query: 60  GLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP 119
           G  I     +   V RSEIF TTK+ G  H +     ++ +SLE +  ++Y+DL L+H P
Sbjct: 61  GRAI-----KDSGVRRSEIFVTTKLWGTQHRH--PDDALNQSLERLG-LDYVDLYLMHWP 112

Query: 120 IA---------------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSI 152
           +                            A+ + + TW+ +Q A  + KV++IGVSN+SI
Sbjct: 113 VPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQ-ALPKSKVKSIGVSNFSI 171

Query: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDP 210
            ++++L    G K  P+VNQ EL+P L + EL E+C+ K +V+EA+SPL  T        
Sbjct: 172 NNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELG 231

Query: 211 QLQELIKT-SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDF 259
            + E+ K  + P   PA ++  W +Q   + LPKS    R ISNLQ ++ 
Sbjct: 232 TINEVSKKLAIP---PANVVFSWLIQRKIVVLPKSVTESRIISNLQTMEL 278

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  154 bits (388), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 155/291 (53%), Gaps = 42/291 (14%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           +L  G +IP + LG +++ + +    V TALK GYRH+D A +Y NE +VG  I     +
Sbjct: 13  SLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI-----K 67

Query: 70  TPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP--------- 119
              V R EIF TTK+    +H  E A    +K L     ++Y+DL L+H P         
Sbjct: 68  DSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRL----GLDYVDLYLMHWPARLDPAYIK 123

Query: 120 ----IAATEERLG-------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE 162
               ++   ++ G             TW+ +QE    GK +A+GVSN+SI +L++L   +
Sbjct: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183

Query: 163 GLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTSY 220
           G K+ P  NQ E++P L + EL  +C+ KG+V+EA+SPL  T      +P + E+ K + 
Sbjct: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN- 242

Query: 221 PNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            N  P  ++I W +Q G++ LPKS N  R  +N +   F +S +D +A+ +
Sbjct: 243 -NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINN 290

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  153 bits (387), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 150/285 (52%), Gaps = 37/285 (12%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           ++T  L  G  IP + LG + + + E    V  ALK+GYRH+D A +YGNE EVG  I  
Sbjct: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI-- 65

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
              +   V R+EIF TTK+          ++++ +SL+ +  ++Y+DL LIH P+    E
Sbjct: 66  ---QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTE 119

Query: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
            +                          TW+ +Q+    GK +AIGVSN+S+ +L++L  
Sbjct: 120 NIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLT--RGQKFSDPQLQELIKT 218
               KV P VNQ EL+P L +++L ++ ++ G+V+EA+SPL        SDP +QE+ K 
Sbjct: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           +        ++I W++Q G + LPKS    R + NL+ L    SD
Sbjct: 240 N--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSD 282

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 149/296 (50%), Gaps = 44/296 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S +  L  G  IPVL  G + + +    H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124
              +   V R +IF TTK+ G +    E A    +K L     ++Y+DL L+H P+    
Sbjct: 67  ---KDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLG----LDYVDLYLMHWPVPLKT 119

Query: 125 ERLG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
           E +                           TW  +QE    GK +A+GVSN+SI +++ L
Sbjct: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKT 218
                 K+ P  NQ E++P L + EL  +C++KG+V+EA+SP       + P L+E    
Sbjct: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPF---GSVNAPLLEEQAII 236

Query: 219 SYPNQ---TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
               +    PAQ++I WS+Q G++ L KS N +R +SN +   F + + D K +++
Sbjct: 237 DMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  151 bits (381), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 154/286 (53%), Gaps = 40/286 (13%)

Query: 7   TTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKF 66
           T  TL NG KIP + LG +++ + +  ++V  ALK+GYRH+D A +Y NE EVG  I   
Sbjct: 10  TYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGRAI--- 66

Query: 67  LKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA----- 121
             +   V R +IF TTK+      ++  K+++  SL+ +  ++Y+DL L+H P+      
Sbjct: 67  --KDSGVPRDQIFITTKLWCTE--FQNPKRALESSLKRLG-LDYVDLYLMHWPVVLNPRY 121

Query: 122 ---------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
                                 T + + TW+ +QE  A G  R++GVSN+SI +LE++ +
Sbjct: 122 IKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLS 181

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LIKT 218
             G K+ P VNQ EL+P L + EL +YC+ K + LEA+SP         P L++  ++  
Sbjct: 182 SPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNA---PNLKQKTIVDI 238

Query: 219 SYPNQ-TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           +  N  +PAQ++  W +Q   + LPKS + +R ISN +  D    D
Sbjct: 239 AAKNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKED 284

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  150 bits (379), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 160/295 (54%), Gaps = 42/295 (14%)

Query: 7   TTKTLT--NGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64
           +TKTL+   G +IP + LG +++   +   +V  ALK+GY+H+D A +Y NE +VG  I 
Sbjct: 8   STKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI- 66

Query: 65  KFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH------- 117
               +   V R EIF TTK+    H +E AK ++ +SL+ +  ++Y+DL LIH       
Sbjct: 67  ----KDSGVPREEIFVTTKLWSTQH-HEPAK-ALDESLQRLG-LDYVDLYLIHWPARLDT 119

Query: 118 ----------NPIAATEER---------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
                      P  A   R         + TW+ +QE    GK +AIGVSN+SI +L++L
Sbjct: 120 NYIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDL 179

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELI 216
               G K+ P  NQ E++P L + EL  +C+ K +++EA+SPL  T      +P + ++ 
Sbjct: 180 LASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIA 239

Query: 217 KTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           K +  N  P  ++I W  Q G++ LPKS N  R  +N +   F +S++D +A+ +
Sbjct: 240 KKN--NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINN 290

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  148 bits (374), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 167/307 (54%), Gaps = 47/307 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T TL NG+++P++ LG ++ P +     V+ A+K GYR  D AQ YGNE+EVG GI K
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V R ++F  +K+    H  +  K ++ K+L+D+  ++Y+DL  IH P+A    
Sbjct: 65  AIAEGI-VKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIG-LDYLDLFYIHFPLAFKFV 122

Query: 122 -------------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                        A +E+ G           T++AL++   EG +++IG+SN++   +++
Sbjct: 123 PFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQD 182

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFS--DPQLQEL 215
           L    G +++P+  Q E +P+LT++ L +YC+  G+ + A+S     Q F   D +L + 
Sbjct: 183 LL--RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGP-QSFIELDSELAKT 239

Query: 216 IKTSYPNQT-----------PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEISD 263
             T + N T            +Q+L+RW+ Q G   +PKSS  +R + NL   D   +SD
Sbjct: 240 TPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSD 299

Query: 264 KDMKALT 270
           K++KA++
Sbjct: 300 KELKAIS 306

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  147 bits (371), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/308 (30%), Positives = 163/308 (52%), Gaps = 47/308 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S   TL NG+K+P++ LG ++ P E     V+ A+K GYR  D AQ YGNE+EVG GI K
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V R E+F  +K+    H  +  K ++ ++L+D+K ++Y+DL  IH PIA    
Sbjct: 62  AIDEGI-VKREELFVVSKLWNSFHDPKNVKAALQRTLDDMK-LDYLDLFYIHFPIALKFV 119

Query: 122 -------------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                        + +E+ G           T++AL++   EG +++IG+SN+S   + +
Sbjct: 120 PFKEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--------------TR 203
           L    G +++P+  Q E +P+LT++ L  Y + +G+ + A+S                T 
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTT 237

Query: 204 GQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEIS 262
              F +P++ E+ K      +P+Q+L+RW+ Q     +PKSS  +R   NL   D   ++
Sbjct: 238 PPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLT 297

Query: 263 DKDMKALT 270
           D+++K ++
Sbjct: 298 DQELKEIS 305

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 154/293 (52%), Gaps = 39/293 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           ++T  L  G  IP + LG + + + +    V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 9   TSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  + R E+F TTK+   N      ++++ +SLE +  +EY+DL L+H P+    +
Sbjct: 67  ---RDSGIPREELFITTKLW--NTQQRNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTK 120

Query: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           R+                          TW+ +QE     K R++GVSN+SI +L+EL  
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLA 180

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLT--RGQKFSDPQLQELIKT 218
             G K+ P V Q E++P L +  LC++C++  + +EA+SPL         DP ++++   
Sbjct: 181 SPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADR 240

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
              N     +++ W +Q G + LPKS+  +R +SNL+   F++SD++M ++ +
Sbjct: 241 H--NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 169/308 (54%), Gaps = 48/308 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+  TL NG+K+P++ LG ++  K+   + ++ A+K GYR  D A  YGNE+EVG GI K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   VSR +IF  +K+  + H  +  K ++ K+L D+  ++Y+DL  IH PIA    
Sbjct: 62  AISEGL-VSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMG-LDYLDLYYIHFPIAFKYV 119

Query: 122 -------------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                        A +E+ G           T++AL+E   EG +++IGVSN+    +++
Sbjct: 120 PFEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQ---- 213
           L    G +++P+  Q E +P+LT++ L E+C+   + + A+S     Q F +  LQ    
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGP-QSFIEMDLQLAKT 236

Query: 214 -------ELIK---TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA-LDFEIS 262
                  ++IK    ++P  T +Q+L+RW+ Q G   +PKSS  +R + NL+    F ++
Sbjct: 237 TPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLT 296

Query: 263 DKDMKALT 270
           ++++K ++
Sbjct: 297 EQELKDIS 304

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 148/287 (51%), Gaps = 40/287 (13%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T TL  G KIP+L LG +   KE     +  ALK+GYRH+D A +  NE+ +G  I  
Sbjct: 9   TATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  V R E+F TTK+    H    A  ++ +SL+ +  +EY+DL ++H P+A   +
Sbjct: 67  ---RDSGVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRVD 120

Query: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           ++                          TW+ +Q+   E K RAIGV+N+S+  L  L  
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTE-KTRAIGVANFSVPQLTSLLK 179

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKT 218
               K+ P  +Q E +P+L   E+  +C +KG+++EA+SPL    G    +P ++E+ K 
Sbjct: 180 SPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKK 239

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
            +    PAQ+LI W L+ G   LPKS    R  SNL+   F++SD+D
Sbjct: 240 LHVE--PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDED 282

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  142 bits (359), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 157/309 (50%), Gaps = 50/309 (16%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T  L  G +IP+L LG + + KE   +    A+K+GYRH+D A +  NE+ VG  I  
Sbjct: 9   TATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI-- 66

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125
                  V R E+F TTK+    H     K ++ +SL+ +  ++Y+DL ++H P+A   E
Sbjct: 67  ---RDSGVPREELFVTTKLWCTQH--RDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSE 120

Query: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           ++                          TW+ +QE  A GK  A+GV+N+S+  L++L +
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLID 180

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKFSD-PQLQELIKT 218
             G K+ P  +Q E +P+L + ++  +C+K  +++EA+SPL + G    D P ++E+ K 
Sbjct: 181 SPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKK 240

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT-------- 270
            +    PAQ+L+ W LQ G   L KS    R  +NL    F+I + D++ +         
Sbjct: 241 LHVE--PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRINELAQERGT 296

Query: 271 ---HDDTYF 276
              H+ T+F
Sbjct: 297 KRIHNPTWF 305

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  142 bits (358), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 139/279 (49%), Gaps = 41/279 (14%)

Query: 8   TKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           T  +    KIP +ALG ++A   E    V  ALK+GYRH+D A +Y NE EVG  I    
Sbjct: 11  TYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEEEVGKAI---- 66

Query: 68  KETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEER 126
                + R +IF TTK+ G +     +A  S +K L     ++Y+DL L+H P+A   + 
Sbjct: 67  -RDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRL----GLDYVDLYLMHWPVALKADS 121

Query: 127 LG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           +                           TW+ +QE     K +AIGVSN+SI +L EL  
Sbjct: 122 ITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQE-LPTSKAKAIGVSNFSINNLNELLA 180

Query: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELIKT 218
               K  P  NQFE++P L + EL +YC+ K +++EA+ PL        ++P + E+   
Sbjct: 181 APTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATK 240

Query: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQAL 257
              N    Q+LI W +Q G++ LPKS   +R ++N Q +
Sbjct: 241 LGVNA--GQLLISWGIQRGYVVLPKSVRKERIVTNFQTI 277

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  142 bits (359), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 166/307 (54%), Gaps = 47/307 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T  L NG+++P++ LG ++ P E     V+ A+K GYR  D AQ YGNE+EVG GI K
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAAT-- 123
            + E   V R ++F  +K+    H  +  KK++ ++L+D+  +EY+DL  IH P+A    
Sbjct: 65  AIDEGI-VKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLG-LEYLDLFYIHFPLAFKFV 122

Query: 124 --EER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
             EER                        L T++AL++   EG ++AIGVSN+    L +
Sbjct: 123 PFEERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHD 182

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKF--SDPQL--- 212
           L    G K+ P   Q E +P+LT+++L EYC+++G+ + A+S     Q F   D QL   
Sbjct: 183 LL--AGAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFG-PQSFLEMDSQLAKS 239

Query: 213 ------QELIKTSYPNQ--TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEISD 263
                  +++K    N   + +++L+RW+ Q     +PKSS  +R ++NLQ  +   +SD
Sbjct: 240 TPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSD 299

Query: 264 KDMKALT 270
           ++++ ++
Sbjct: 300 EELQEIS 306

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  140 bits (353), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 155/291 (53%), Gaps = 47/291 (16%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           TL NG K+P++ LG ++   +     V+ A+K GYR  D A  YGNE EVG GI K + E
Sbjct: 6   TLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDE 65

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA----ATEE 125
              V RS++F  +K+    H  +  K ++ ++L+D+  ++YIDL  IH PIA      EE
Sbjct: 66  GL-VKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLG-LDYIDLYYIHFPIAFKFVPFEE 123

Query: 126 R------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNW 161
           +                        L T++AL+E    G +++IG+SN++   +++L N 
Sbjct: 124 KYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN- 182

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKF---------SDPQL 212
            G +++P+  Q E +P+LT+++L EYC+ KG+ + A+S     Q F         S P L
Sbjct: 183 -GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGP-QSFIELDSQLAKSTPSL 240

Query: 213 QEL-----IKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD 258
            E      I  ++ + TP+++L+RW+ Q G   +PKS+  +R + NL   D
Sbjct: 241 LEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVED 291

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  140 bits (352), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 165/308 (53%), Gaps = 48/308 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+  TL NG+K+P++ LG ++  K+   + ++ A+K GYR  D A  YGNE+EVG GI +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAAT-- 123
            + E   V+R ++F  +K+  + H  +  K ++ K+L D+  ++Y+DL  IH PIA    
Sbjct: 62  AISEGL-VARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMG-LDYLDLYYIHFPIAFKYV 119

Query: 124 --EER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
             EE+                        L T++AL+E   EG +++IG+SN+    +++
Sbjct: 120 PFEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQ---- 213
           L    G +++P+  Q E +P+LT++ L E+C    + + A+S     Q F +  LQ    
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGP-QSFIEMDLQLAKT 236

Query: 214 ----------ELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA-LDFEIS 262
                     + I  ++P  T +Q+L+RW+ Q G   +PKSS  +R + NL+    F ++
Sbjct: 237 TPTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLT 296

Query: 263 DKDMKALT 270
           ++++K ++
Sbjct: 297 EQELKEIS 304

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  139 bits (351), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 165/307 (53%), Gaps = 46/307 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+  TL NG K+P++ LG ++   +   + ++ A+K GYR  D A  YGNE+EVG GI K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V+R +IF T+K+  + H  +  K ++ K+L+D+  ++Y+DL  IH PIA    
Sbjct: 62  AISEGL-VTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMG-LDYLDLYYIHFPIAFKYV 119

Query: 122 -------------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                        A +++ G           T++AL+    EG +++IG+SN+    +++
Sbjct: 120 PFEEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP--------LTRGQKFSD 209
           L    G +++P+  Q E +P+LT++ L +YC+   + + A+S         +  G   S 
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKST 237

Query: 210 PQLQE-----LIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA-LDFEISD 263
           P L E      +  ++P  T +Q+L+RW+ Q G   +PKSS  +R + NL+      ++D
Sbjct: 238 PTLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTD 297

Query: 264 KDMKALT 270
           +++K ++
Sbjct: 298 QELKEIS 304

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 167/318 (52%), Gaps = 45/318 (14%)

Query: 2   NLTPST-TKTLTNGVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREV 59
           NL  ST T  L +G +IP++ LG ++A  E +  + V  AL +GYRH+D A +Y NE +V
Sbjct: 4   NLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQV 63

Query: 60  GLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNP 119
           G  I         V R EIF TTK+    H   + + ++ +SL+ +  ++Y+DL L+H P
Sbjct: 64  GEAI-----RDSGVPREEIFVTTKLWNAQH--HEPEVALDESLQRLG-LDYVDLYLMHWP 115

Query: 120 IAATEERL------------------------GTWKALQEAYAEGKVRAIGVSNYSIKHL 155
           ++  +  +                         TW+ +Q+   + KVR+IGVSN+S+ +L
Sbjct: 116 VSLDKSYMKESPLELMKRPDGTRPVETDWTFINTWELMQK-LPKNKVRSIGVSNFSVNNL 174

Query: 156 EELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQ 213
           ++L       V P +NQ EL+P L + EL +YC++  + +EA+SPL  T     S+P + 
Sbjct: 175 KDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVI 234

Query: 214 ELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL---- 269
           ++ K +     PA +++ W +Q   I LPKS +++R  +NL+   F + ++D  A+    
Sbjct: 235 DVAKKN--GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKIS 290

Query: 270 THDDTYFLATEDFDPIKT 287
                  +   +F+P KT
Sbjct: 291 QQRGERRINNPNFEPFKT 308

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  139 bits (349), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 156/298 (52%), Gaps = 42/298 (14%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNER 57
           L P  T+   TL NGVK+P L LG     ++  +T+  V  A+KSGYRH+D A  Y  E 
Sbjct: 2   LHPKNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCED 61

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
            +G  + +  +E   + R +IF TTKV   N  +++A +SI +SLE++  ++Y+DL+L H
Sbjct: 62  RIGEALKELFEEGV-IKREDIFITTKVWPTN--WDRADESISRSLENLG-VDYVDLVLQH 117

Query: 118 NPIAATE---------------------------ERLGTWKALQEAY--AEGKVRAIGVS 148
            P+                               + L T+K+L++ Y   + + R+IGVS
Sbjct: 118 WPLCFNRLQDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVS 177

Query: 149 NYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKF 207
           NY +++LE L   +  KV P VNQ E++P L + EL ++C K  + LEAFSP    G   
Sbjct: 178 NYPVEYLERLL--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPM 235

Query: 208 SDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
              +L + +   Y + TP  +LI + L+ G + +P+S N K   SN+Q +     D D
Sbjct: 236 VKNELVQKVAQKY-SCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDID 292

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 155/287 (54%), Gaps = 43/287 (14%)

Query: 14  GVKIPVLALGVYEAPKE-ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPN 72
           G  +P+L LG + A  + E  + V +AL++GYRH+D A +Y NE  VG  I    +E+  
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVVGRAI----RES-G 71

Query: 73  VSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA----------- 121
           + R EIF TTK+ G  H    A  ++ +SLE +  ++Y+DL L+H P+            
Sbjct: 72  IPRDEIFVTTKLWGTQHRDPAA--ALDQSLERLG-LDYVDLYLMHWPVPMEAKYSKSSSL 128

Query: 122 -----------ATE---ERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVE 167
                      A E   + + TW+ +QE   + K RAIGVSN+SI ++ +L    G K+ 
Sbjct: 129 LEFPYRPDGSLAVESDWDFIKTWELMQE-LPKTKTRAIGVSNFSINNINDLLKSPGNKIV 187

Query: 168 PMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQL--QELIKTSYPNQ-T 224
           P  NQ EL+P L + EL  +C++KG+V+EA+SP       S P L  Q +I+ +  +  +
Sbjct: 188 PAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFG---SVSAPLLSEQAIIEVAKKHDVS 244

Query: 225 PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            AQ+++ W ++ G   LPKS + +R +SN +   F + + D   + +
Sbjct: 245 AAQVILSWHIKRGIAVLPKSVHKERVVSNFKT--FSLPEDDFATINN 289

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  138 bits (347), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 39/291 (13%)

Query: 8   TKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           T TL NG KIPV+ LG Y + + E    V TA K+GYRHVD A  Y NE +VG    K +
Sbjct: 11  TITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQVG----KAV 66

Query: 68  KETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERL 127
           K+   V RSE++ TTKV          + ++ KSL+ +  +EYIDL L+H P+    + +
Sbjct: 67  KDC-GVPRSEMYVTTKVWPTE--LRDPEAALDKSLKRLG-LEYIDLYLMHWPVTLKTDTI 122

Query: 128 G-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE 162
                                      W+A+Q+    GKV++IGVSN+SI +++EL    
Sbjct: 123 KDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLAAP 182

Query: 163 GLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK--FSDPQLQELIKTSY 220
              V P+VNQ E+ P L   EL E+C  K ++ +A+ P    +     D  + E+ K + 
Sbjct: 183 TTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKGNG 242

Query: 221 PNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            +    Q++  W +Q G++ LPKS    R ISNL+   F +SD DM  + +
Sbjct: 243 VDA--GQVITSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDADMTKMNN 289

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  139 bits (349), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 158/304 (51%), Gaps = 45/304 (14%)

Query: 8   TKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           T  L NG  +P++ LG ++ P E     V+ A+K GYR +D A+ Y NEREVG GI + +
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  KETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA------ 121
            E   V R E+F  +K+  + H  E   K++ ++L D+  ++Y+DL  IH P+A      
Sbjct: 92  DEG-LVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLG-LDYLDLFYIHFPLAFKFVPL 149

Query: 122 -----------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159
                      A +E+ G           T++AL++   EG++RAIG+SN+    +++L 
Sbjct: 150 EERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLL 209

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL---------TRGQKFSDP 210
              G ++ P   Q E +P+LT++ L +Y + +G+ +  +S L             + + P
Sbjct: 210 R--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAP 267

Query: 211 QLQELIKTSYPNQ---TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEISDKDM 266
            LQ  +      +   TPA++L+RW+ Q     +PKSS  +R  +NL+  +   ++D ++
Sbjct: 268 LLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDEL 327

Query: 267 KALT 270
           + L+
Sbjct: 328 RELS 331

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  137 bits (346), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 152/285 (53%), Gaps = 44/285 (15%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           TL NG+K+P++ LG ++ P +     V+ A+K GYR  D AQ YGNE+EVG GI + + E
Sbjct: 6   TLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISE 65

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAAT----EE 125
              V R E+F  +K+    H  +  K ++ ++L D+K ++Y+DL  IH PIA      EE
Sbjct: 66  GI-VKREELFVISKLWNSYHDPKHVKMALQRTLSDMK-LDYLDLYYIHFPIAFKFVPFEE 123

Query: 126 R------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNW 161
           +                        + T++A+++   +G +++IG+SN++   +++L   
Sbjct: 124 KYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLL-- 181

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-------TRGQKFSDPQL-- 212
              K++P   Q E +P+LT+  L EYC+   + + A+S            QK  D ++  
Sbjct: 182 RSCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVLF 241

Query: 213 -QELIKTSYPNQT--PAQILIRWSLQMGFIPLPKSSNSKRQISNL 254
             E+IK+   N +  P+Q+L+RW+ Q G   +PKSS  +R + NL
Sbjct: 242 EHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENL 286

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  137 bits (346), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 164/306 (53%), Gaps = 45/306 (14%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           + T TL NG K+P++ LG ++ P +     ++ A+K GYR  D AQ Y NE+EVG G+ +
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            +KE   V R ++   +K+    H  +   +++ ++L D+ +++Y+D+  IH P+A    
Sbjct: 65  AIKEGL-VKREDLVVVSKLWNSFHHPDNVPRALERTLSDL-QLDYVDIFYIHFPLAFKPV 122

Query: 122 ---------------------ATEER---LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                                  EE+   L TW+AL++   +GK++++G+SN+S   +++
Sbjct: 123 PFDEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQD 182

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP--------LTRGQKFSD 209
           L    G +++P+  Q E +P+LT++ L +Y +  G+ + A+S         L   +  + 
Sbjct: 183 LL--RGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNT 240

Query: 210 PQL--QELIKT--SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEISDK 264
           P L   + IK+  S    TP Q+L+RW+ Q G   +PKSS  +R + NL+  D   ++D 
Sbjct: 241 PTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDD 300

Query: 265 DMKALT 270
           ++K ++
Sbjct: 301 ELKQIS 306

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  137 bits (345), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 156/296 (52%), Gaps = 47/296 (15%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           M  T  T K L NG+++P++ LG ++ P E     V+ A+K GYR  D AQ YGNE+EVG
Sbjct: 1   MTYTSETVK-LNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVG 59

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
            GI K + E   V R ++F  +K+    H  +  KK++ ++LED+ E+EY+DL  IH P+
Sbjct: 60  QGIHKAIDEGI-VKREDLFVVSKLWNSYHDPKNVKKALKRTLEDM-ELEYLDLFYIHFPL 117

Query: 121 A-----------------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSI 152
           A                 A + + G           T++AL+E   EG +++IG+SN+  
Sbjct: 118 AFKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRG 177

Query: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKF----- 207
             + +L    G  ++P+  Q E +P+LT+++L EYC ++ + + A+S     Q F     
Sbjct: 178 ILIHDLL--AGATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGP-QSFLELDS 234

Query: 208 ----SDPQL--QELIKTSYPNQ--TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
               S P L   E I+    N   + +Q+L+RW+ Q     +PKSS  +R + NLQ
Sbjct: 235 ELAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQ 290

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/308 (29%), Positives = 161/308 (52%), Gaps = 49/308 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+  TL NG+K+P++ LG ++ P +     V+ A+K GYR  D A+ YGNE+EVG GI K
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAAT-- 123
            + E   V R ++F  +K+    H  +  K ++ ++L D+  ++Y+DL  IH PIA    
Sbjct: 62  AIDEGV-VKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMG-LDYLDLFYIHFPIAFKYV 119

Query: 124 --EER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
             EE+                        + T++AL++   EG +++IG+SN+S   +++
Sbjct: 120 PFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFS------------PLTRGQ 205
           L      K++P+  Q E +P+LT++ L EYC+  G+ + A+S            PL +  
Sbjct: 180 LL--RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNT 237

Query: 206 K--FSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEIS 262
              F    ++++      N   +Q+L+RW+ Q G   +PKSS  +R   NL   +   ++
Sbjct: 238 PNLFHHDTIKQIANNH--NVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLT 295

Query: 263 DKDMKALT 270
            K+++A++
Sbjct: 296 HKELEAIS 303

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  136 bits (343), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 165/308 (53%), Gaps = 48/308 (15%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+  TL NG+K+P++ LG ++  K    + ++ A+K GYR  D A  YGNE+EVG GI K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V+R ++F  +K+  + H  +  K ++ K+L D+  ++Y+DL  IH PIA    
Sbjct: 62  AIYEGL-VTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMG-LDYLDLYYIHFPIAFKYI 119

Query: 122 ------------ATEER------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                        TE+             + T++AL++   EG +++IG+SN+    +++
Sbjct: 120 PFEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKF--SDPQLQEL 215
           L    G +++P+  Q E +P+LT++ L E+C+   + + A+S     Q F   D QL + 
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGP-QSFIEMDLQLAKA 236

Query: 216 IKTSYPN------------QTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA-LDFEIS 262
            +T + N             T +Q+L+RW+ Q G   +PKSS  +R + NL+    F ++
Sbjct: 237 TQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLT 296

Query: 263 DKDMKALT 270
           ++++K ++
Sbjct: 297 EQELKKIS 304

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  135 bits (339), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 163/304 (53%), Gaps = 49/304 (16%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           TL NG+K+P + LG ++ P +     V+ A+K+GYR  D A  Y NE EVG G+ + + +
Sbjct: 6   TLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDD 65

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA----ATEE 125
              V R ++F  +K+  + H  +  K ++ ++L+D+  ++Y+DL  IH PIA      EE
Sbjct: 66  GI-VKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLG-LDYLDLYYIHFPIAFKFVPMEE 123

Query: 126 R------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNW 161
           R                        L T++AL+E   EG +++IG+SN++   + ++   
Sbjct: 124 RYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL-- 181

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYP 221
            G  ++P+  Q E +P+LT+++L EYC+   + +  +S     Q F+D  + +L K + P
Sbjct: 182 RGCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGP-QSFADCGM-DLAKNTPP 239

Query: 222 --------------NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD-FEISDKDM 266
                         N + A++L+RW+ Q G   +PKSS+ KR +SNL   D   ++++D+
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 267 KALT 270
           K+++
Sbjct: 300 KSIS 303

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  134 bits (336), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 148/298 (49%), Gaps = 51/298 (17%)

Query: 11  LTNGVKIPVLALGVYEA-PKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           L+ G  IP + LG + +    +  H+V  ALK+GYRH+D A +YGNE +VG  I      
Sbjct: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI-----R 67

Query: 70  TPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA------- 121
              V R+EIF T+K+     H  + A    +K L     ++YIDL L+H P+        
Sbjct: 68  DSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRL----GLDYIDLYLMHWPVTFNPRSIK 123

Query: 122 ------------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                                    T   + TW+ +Q     GK +A+GVSN+SI +L +
Sbjct: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIK 217
           L      KV P  NQ EL+P L + EL +YC++K +++EA+SP       + P L++   
Sbjct: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG---SINAPILKDETI 240

Query: 218 TSYPNQTP---AQILIRWSLQM-GFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
            +   +      Q+++ W +Q  G++ LPKS + +R I+N + +   + D+D +A+ +
Sbjct: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINN 296

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 159/294 (54%), Gaps = 44/294 (14%)

Query: 10  TLTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
            L  G KIP L LG    P++  +T+  V  A+K+GYR +D A +YG+E  +G  + +  
Sbjct: 12  NLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELF 71

Query: 68  KETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEER- 126
           +E   V R ++F TTKV   +  Y   ++S+ +SL+ +K ++Y+DLLL H P+   ++  
Sbjct: 72  EEG-VVKREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQHWPLCFVKQYD 127

Query: 127 -------------------------LGTWKALQEAYAEG--KVRAIGVSNYSIKHLEELY 159
                                    L TWK L++ Y +G  +VR IGVSNY +++LE L 
Sbjct: 128 EHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLL 187

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG--QKFSDPQLQELIK 217
             +  +V P++NQ EL+P L ++EL EYC   G+++E+FSPL          P ++EL K
Sbjct: 188 --KETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSK 245

Query: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDF-EISDKDMKALT 270
               +  P  +L+ + ++ G + +P+S N  R I N    DF  +S++D+  L+
Sbjct: 246 KY--DCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKN---ADFVALSEEDLDKLS 294

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 150/290 (51%), Gaps = 35/290 (12%)

Query: 6   STTKTLTNGVKIPVLALGVYEA-PKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIA 64
           + T  L  G  IP ++LG + +    +   +V  ALK+GYRH+D A +YGNE +VG  I 
Sbjct: 9   TATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAI- 67

Query: 65  KFLKETPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLE---------------DVKEI 108
                   + R EIF T+K+ +   H    A K  +  L                + + +
Sbjct: 68  ----RDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNV 123

Query: 109 EYIDLLLIHNPIAA-------TEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNW 161
           +  D ++I             T   + TW+ +QE  A G  +A+GVSN+SI +L+EL   
Sbjct: 124 KGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTS 183

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIKTS 219
            G K+ P  NQ E++P L   +L ++C +KG+++EA+SPL         +P++ E+ K  
Sbjct: 184 PGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKL 243

Query: 220 YPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
             +  PAQ++I W +Q G++ L KS++ +R I+N +   F +S +D +A+
Sbjct: 244 --DVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAI 289

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 154/292 (52%), Gaps = 48/292 (16%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S T TL NG+ +P++ LG ++   +     V+ A+K GYR  D A  YGNE++VG GI +
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V R ++F  +K+    H  +  K ++ ++L+D+K +EY+DL  IH P+A    
Sbjct: 62  AIDEGI-VKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMK-LEYLDLYYIHFPLAFKFV 119

Query: 122 ---------------------ATEERLG---TWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
                                 TEE++    T++A++E   EG  ++IG+SNY+   +++
Sbjct: 120 PFEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIK 217
                G +++P+  Q E +P+LT+++L EYC+  G+ + A+S     Q F D   Q+L K
Sbjct: 180 --TLRGCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGP-QSFVDID-QKLAK 235

Query: 218 TSYP--------------NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
            + P                T +Q+++RW+ Q G   +PKS++  R + NLQ
Sbjct: 236 HTPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQ 287

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  132 bits (333), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 154/291 (52%), Gaps = 47/291 (16%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S   TL NG+K+P++ LG ++ P       ++ A+K GYR  D A  YGNE+EVG GI +
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V R ++F  +K+  + H  +  K ++ ++L+D+  ++Y+DL  IH PIA    
Sbjct: 62  AIDEGL-VKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLG-LDYVDLYYIHFPIAFKFV 119

Query: 122 ATEER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
           + +ER                        + T++A+++   EG +++IG+SNY+   + +
Sbjct: 120 SPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVAD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP------LTRGQK----- 206
                G +++P+  Q E +P+LT+++L EYC+   + + A+S       +  GQ+     
Sbjct: 180 --TLRGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNT 237

Query: 207 ---FSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNL 254
              F  P +++ I   Y   T +Q+L+RW+ Q G   +PKSS  +R + NL
Sbjct: 238 PPLFDHPTIKK-IADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENL 287

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  130 bits (327), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 161/305 (52%), Gaps = 45/305 (14%)

Query: 3   LTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLG 62
           +  + T TL NG+K+PV+ LG ++   +     V+ A+K GYR  D A  YGNE+E+G+G
Sbjct: 1   MADTRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVG 60

Query: 63  IAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI-- 120
           I + + E   V R ++F  +K+  + H  +  K ++ ++L D+  ++Y+DL  IH P+  
Sbjct: 61  IKQAINEGL-VKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLG-LDYVDLYYIHFPLPI 118

Query: 121 --------------AATEER------------LGTWKALQEAYAEGKVRAIGVSNYSIKH 154
                            E+R            L T++A+++   EG V+++G+SN+    
Sbjct: 119 KYVPLEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACL 178

Query: 155 LEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFS---PLT------RGQ 205
           +++L    G +++P+  Q EL+P+L+++ L  Y + K + + A+S   PL+         
Sbjct: 179 IQDLL--RGARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAA 236

Query: 206 KFSDPQLQELIKTSYPNQ---TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA-LDFEI 261
           K   P L+  I  +   +   TP+Q+++RW+ Q G   +PKSS  +R ++NL +     +
Sbjct: 237 KDVTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTL 296

Query: 262 SDKDM 266
           SD +M
Sbjct: 297 SDSEM 301

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  130 bits (327), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 151/293 (51%), Gaps = 52/293 (17%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           S+   L NG+K+P++ LG ++ P       V+ A+K GYR  D A+ YGNE+EVG GI +
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            + E   V RS++F  +K+    H  +  K ++ K+L D+  ++Y+DL  IH P+A    
Sbjct: 62  AIDEKI-VKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLG-LDYLDLYYIHFPLAFKFV 119

Query: 122 ATEER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
             EE+                        L T+ A++    EG +++IGVSN     L++
Sbjct: 120 PIEEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQK----------- 206
           +    G K++P+  Q E +P+LT+  L +YC+++ +++ A+S    GQ+           
Sbjct: 180 VL--MGCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSF--GQQSYLELGSELKE 235

Query: 207 -----FSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNL 254
                F  P ++ +   S  N T +++L+RW+ Q G   +PKSS  +R + NL
Sbjct: 236 DTPNLFDHPVIKRI--ASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNL 286

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  129 bits (323), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 156/301 (51%), Gaps = 47/301 (15%)

Query: 5   PSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNERE 58
           P++T+    L NG +IP + LG   +PK+   ET+  V  A+++GYRH+D A  Y  E  
Sbjct: 4   PTSTEIYFNLNNGTRIPAIGLGT-ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPY 62

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHN 118
           +G  + K L E+  + R E+F TTKV      +     SI +SL+D+  I+Y+DL+L H 
Sbjct: 63  IGQAL-KELFESAEIKREELFITTKVWPT--FWNNPSDSIDQSLKDLG-IDYVDLVLQHW 118

Query: 119 PIAATE-------------------------ERLGTWKALQEAY---AEGKVRAIGVSNY 150
           P+   +                         + L T+KAL++ Y    + +VRAIGVSNY
Sbjct: 119 PVCFQKVENSQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNY 178

Query: 151 SIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTR--GQKFS 208
            I++LE L+  +  KV P +NQ E++P L + EL ++C    ++L A+SPL         
Sbjct: 179 PIEYLERLF--KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLK 236

Query: 209 DPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKA 268
              +Q+L K       PA IL  + +  G + LP+S N KR  +N+     +++D D+  
Sbjct: 237 IKSVQDLAKKY--KVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFA--KLTDDDLSK 292

Query: 269 L 269
           L
Sbjct: 293 L 293

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 148/291 (50%), Gaps = 48/291 (16%)

Query: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65
           ++   L NG K+P++ LG ++ P E     ++ A+  GYR  D AQ YGNE+EVG G+ +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121
            +K+   V R E+F  +K+    H  +  K ++ ++L D+  ++Y+DL  IH PIA    
Sbjct: 62  AIKDG-LVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMG-LDYLDLFYIHFPIALKPV 119

Query: 122 ATEER------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157
           + EE+                        L T++AL+E   EG +++IGVSN+S   + +
Sbjct: 120 SFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLD 179

Query: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIK 217
           L    G ++ P   Q EL+P+LT++   ++ + KG+ + A+S     Q F D    E+ K
Sbjct: 180 LL--RGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGP-QSFVDIG-SEVAK 235

Query: 218 TSYP--------------NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNL 254
            + P              N + +Q+L+RW+ Q     +PKSS  +R   NL
Sbjct: 236 ATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNL 286

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  128 bits (322), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 152/298 (51%), Gaps = 42/298 (14%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNER 57
           L P  T+   TL NGV++P + LG     ++  +T+  V  A+KSGYRH+D A  Y  E 
Sbjct: 2   LHPKNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCED 61

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
            VG  + +  +E   V R +IF TTKV   N  +++  +SI +SLE++  ++++DL+L H
Sbjct: 62  RVGEALKELFEEGV-VKREDIFVTTKVWPTN--WDRVDESISRSLENLG-LDHVDLVLQH 117

Query: 118 NPIAATE---------------------------ERLGTWKALQEAY--AEGKVRAIGVS 148
            P+                               + L T+K L++ Y   + + RAIGVS
Sbjct: 118 WPLCFNRLEDPDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVS 177

Query: 149 NYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKF 207
           NY +++LE L   +  +V P +NQ E +P L + EL ++C K  + LEA+SPL       
Sbjct: 178 NYPVEYLERLL--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPL 235

Query: 208 SDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
            D +L + I   Y   T   +LI + ++ G + +P+S N K   SN+Q +     D D
Sbjct: 236 IDNELVKKIAGKYACST-QNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDID 292

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  127 bits (319), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 159/296 (53%), Gaps = 48/296 (16%)

Query: 3   LTPSTTKT---LTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P +T+    L NG  IP L  G Y AP+E   ET+  V  A+K+GYRH+D A +Y +E
Sbjct: 2   LHPKSTEIYFKLNNGTTIPALGFGTY-APRERIPETKQAVKAAIKAGYRHIDTAWVYESE 60

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + ++E   VSRS++F TTKV      ++  +KS+ +SLE +  ++Y+DLLL 
Sbjct: 61  PYVGEAIKEMIEEG-EVSRSDLFVTTKVWPVY--WDNVEKSLNESLEALG-LDYVDLLLQ 116

Query: 117 HNP----------------IAATEERLG------------TWKALQEAYA---EGKVRAI 145
           H P                +A  E+  G            T++ +++ Y    + +VRAI
Sbjct: 117 HWPLCFPRVEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAI 176

Query: 146 GVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTR-- 203
           GVSNY+I++LE L+  +  KV+P+VNQ E++P L + EL ++C   G++L A+SPL    
Sbjct: 177 GVSNYAIEYLEALF--KECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDG 234

Query: 204 GQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDF 259
                 P + +L +    + +   ILI + ++ G   +P+S N  R  S ++   F
Sbjct: 235 APNLKIPLVHQLAEKY--DMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPF 288

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  127 bits (318), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 148/289 (51%), Gaps = 46/289 (15%)

Query: 10  TLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69
           TL NG+K+P++ LG ++ P +     V+ A+K GYR  D A  YGNE+EVG GI K L E
Sbjct: 6   TLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINKALSE 65

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA-------- 121
              V RS++F  +K+    H  +  K ++ ++L D+  ++Y+DL  IH P+A        
Sbjct: 66  GI-VKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLG-LDYLDLYYIHFPLAFKYVPFEE 123

Query: 122 ---------ATEERLG-----------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNW 161
                    A + ++G           T++A+++   EG  ++IGVSN     L+++   
Sbjct: 124 KYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL-- 181

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP------LTRGQK--------F 207
            G ++ P   Q E +P+LT++ L ++C+ + + + ++S       L  G K        F
Sbjct: 182 MGCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPALF 241

Query: 208 SDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQA 256
             P ++++      + T +++L+RW+ Q     +PKSS  +R + NL  
Sbjct: 242 DHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNV 290

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  125 bits (315), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 147/275 (53%), Gaps = 44/275 (16%)

Query: 10  TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKF 66
            L NG +IP + LG    PK+   +T+  V  A+K+G+R +D A  YG E  +G  + + 
Sbjct: 12  NLNNGTRIPAVGLGT-ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 67  LKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEER 126
             E   V R ++F TTKV  +   +++A+KS+ +SL+ + +++Y+DLLL H P    +++
Sbjct: 71  FAEGV-VKREDLFITTKVWPNY--WDQAEKSLNESLKRL-QLDYVDLLLQHWPFCFVKKQ 126

Query: 127 ---------------------------LGTWKALQEAYA---EGKVRAIGVSNYSIKHLE 156
                                      L T+K ++  Y    + +VRAIGVSNY I++LE
Sbjct: 127 DPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLE 186

Query: 157 ELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQE 214
            L+  +  K  P +NQ EL+P L ++ELC+YC K G+++ ++SPL          P +QE
Sbjct: 187 RLF--KECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQE 244

Query: 215 LIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
           L   S  N     +L+ + ++ G I +P+S N +R
Sbjct: 245 L--ASKYNANGNDVLVSYHIRQGTIVIPRSLNLER 277

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  122 bits (306), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 158/291 (54%), Gaps = 47/291 (16%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P TT+   +L NGV+IP L LG    P+E   ET+  V  A+K+GYRH+D A  Y  E
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTAN-PQEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + L+E   + R ++F TTKV      +++  +S+ +SL+ +  ++Y+DLLL 
Sbjct: 75  PFVGEAIKELLEEG-TIQREDLFITTKVW--PVLWDEVDRSLNESLKALG-LDYVDLLLQ 130

Query: 117 HNPI---------------------------AATEERLGTWKALQEAYAEG---KVRAIG 146
           H PI                           A+  + L T+K L++ Y +    +VRAIG
Sbjct: 131 HWPICFGKVKDPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIG 190

Query: 147 VSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQ 205
           VSN+SI++LE L   +  KV+P VNQ E +P L + EL ++C    ++L A+SPL ++G 
Sbjct: 191 VSNFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGA 248

Query: 206 -KFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                P +++L +    N T   +LI + ++ G I +P+S N  R  SN++
Sbjct: 249 PNLKIPLVKKLCEKY--NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIE 297

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 146/289 (50%), Gaps = 34/289 (11%)

Query: 7   TTKTLTNGVKIPVLALGV---YEAPKEETEH----------TVFTALKSGYRHVDCAQLY 53
           T +   +G K+PV+  G    +   K E E            V  A+K+G+ H+D A+ Y
Sbjct: 7   TVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAY 66

Query: 54  GNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLE---DVKEIEY 110
               EVG GIA        V R +++ T K +  +  + K K  + +SLE      +++Y
Sbjct: 67  KTHPEVGAGIA-----NSGVPREKLWVTDKYTPWSWTWRKGKGPL-ESLELSLGKMQMQY 120

Query: 111 IDLLLIH----NPIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKV 166
           +DL L+H    NP  A  +    W+ ++E Y  G  + IGVSN+ ++ LE +      K 
Sbjct: 121 VDLYLVHVPFINPETAGIDLKEAWRQMEEIYDRGWAKNIGVSNFDVESLEYIRTIG--KY 178

Query: 167 EPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPL---TRGQKFSDPQLQELIKTSYP 221
           +P+VNQ E + ++ ++   +  YC+K G+ +E +SPL   T+G+      +  L+   Y 
Sbjct: 179 QPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDDILPLMAKKY- 237

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            ++  QIL+RW +Q G I +  S+  KR   +L   DFE+S +D  ++T
Sbjct: 238 GKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSIT 286

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  121 bits (303), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 158/291 (54%), Gaps = 47/291 (16%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P TT+   +L NGV+IP L LG    P+E   ET+  V  A+K+GYRH+D A  Y  E
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTAN-PQEKLAETKQAVKAAIKAGYRHIDTAWAYRTE 74

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + L+E   + R ++F TTKV      +++  +S+ +SL+ +  ++Y+DLLL 
Sbjct: 75  PFVGEAIKELLEEG-TIQREDLFITTKVWP--VLWDEVDRSLNESLKALG-LDYVDLLLQ 130

Query: 117 HNPI---------------------------AATEERLGTWKALQEAYAEG---KVRAIG 146
           H P+                           A+  + L T+K L++ Y +    +VRAIG
Sbjct: 131 HWPLCFEKVKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIG 190

Query: 147 VSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQ 205
           VSN+SI++LE L   +  KV+P VNQ E +P L + EL ++C    ++L A+SPL ++G 
Sbjct: 191 VSNFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGA 248

Query: 206 -KFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                P +++L +    N T   +LI + ++ G I +P+S N  R  SN++
Sbjct: 249 PNLKIPLVKKLCEKY--NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIE 297

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  120 bits (300), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 149/286 (52%), Gaps = 33/286 (11%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS----------GYRHVDCAQLYGNE 56
           TL+NG KIP +A+   G      EET+ T    L            G  H+D A++Y   
Sbjct: 8   TLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTY 67

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
            E+G      LK+T    R EIF T K S      E  K ++  SL+ +  ++Y+DL L+
Sbjct: 68  PELGAA----LKDTKK-PRDEIFITDKYSTLKQLSENPKVALETSLKKLG-VDYVDLYLL 121

Query: 117 HNPIAATEERL---GTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           H+PI   E +L     WK L+E Y  GK + IGVSN+++K LE+L      +V+P VNQ 
Sbjct: 122 HSPIIK-ESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLL--AVAEVKPQVNQI 178

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFSD-----PQLQELIKTSYP-NQTP 225
           E +P+L  +   + E+ +K G++LEA+SPL   Q+  +     P  Q + + S   N++ 
Sbjct: 179 EFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPFYQYIAELSKKYNKSE 238

Query: 226 AQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271
           AQIL+ W  + G +P+  SS  +R         F +++++++ +T 
Sbjct: 239 AQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKITQ 284

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  120 bits (300), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 145/289 (50%), Gaps = 40/289 (13%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTV---------FTALKSGYRHVDCAQLYGNER 57
           TL NG K+P +A+   G +   K+E +H +         F     G  H+D A++YG   
Sbjct: 9   TLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKA-KKSIIKSLED---VKEIEYIDL 113
           E  L  A  + E P   RSEIF T     D H    A  K  I  LED      ++Y+DL
Sbjct: 69  E--LSAALRMTEKP---RSEIFIT-----DKHALHAAMSKDPIAGLEDSLKANNLDYVDL 118

Query: 114 LLIHNPIAATEE----RLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPM 169
            L+H+P  A E+      G W+ +++ Y +GK + IGVSN+S++ L+ + +   +K  P 
Sbjct: 119 YLLHSPFVAKEKPGLTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDLKRVLSVAEIK--PQ 176

Query: 170 VNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQ-KFSDPQLQELIK-----TSYP 221
           VNQ E +P+L  +   + ++C+ + + LEAF+PL   Q K  + +  E  K     +   
Sbjct: 177 VNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDENDEFFKYISSLSGKY 236

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            +T AQI++RW  + G IP+  S    R        +F++ D+++  +T
Sbjct: 237 QKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDEEVTKIT 285

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  119 bits (299), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 154/290 (53%), Gaps = 45/290 (15%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P TT+   +L NGV+IP L LG    P E   ET+  V  A+K+GYRH+D A  Y  E
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTAN-PHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + L E  ++ R ++F TTKV      +++  +S+ +SL+ +  +EY+DLLL 
Sbjct: 75  PFVGEAIKELL-EDGSIKREDLFITTKVWP--VLWDEVDRSLNESLKALG-LEYVDLLLQ 130

Query: 117 HNPI---------------------------AATEERLGTWKALQEAYA---EGKVRAIG 146
           H P+                           AA  + L T+K L++ Y    + +VRAIG
Sbjct: 131 HWPLCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIG 190

Query: 147 VSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQ 205
           VSN+SI++LE L   +  +V+P VNQ E +P L + EL ++C    ++L A+SPL + G 
Sbjct: 191 VSNFSIEYLERLI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGA 248

Query: 206 KFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                 L + +   Y N T   +LI + ++ G I +P+S N  R  S+++
Sbjct: 249 PNLKIPLVKKLAEKY-NVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIE 297

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  119 bits (299), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 156/291 (53%), Gaps = 47/291 (16%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P TT+   TL NGV++P L LG    P E   ET+  V  A+K+GYRH+D A  Y  E
Sbjct: 16  LHPKTTEIYFTLNNGVRVPALGLGTAN-PHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + L+E  ++ R ++F TTKV      +++ ++S+ +SL+ +  ++Y+DL L 
Sbjct: 75  PFVGEAIKELLEEG-SIKREDLFITTKVWPV--LWDEVERSLSESLKAMG-LDYVDLFLQ 130

Query: 117 HNP---------------------------IAATEERLGTWKALQEAYA---EGKVRAIG 146
           H P                           +A+  + + T+K L++ Y    + +VRAIG
Sbjct: 131 HWPLCFEKVKDPKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIG 190

Query: 147 VSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRG 204
           VSN+SI++LE L   +  +V+P VNQ E +P L + EL ++C    ++L A+SPL     
Sbjct: 191 VSNFSIEYLERLV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGA 248

Query: 205 QKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                P +++L++    N T   +LI + ++ G I +P+S N  R  S+++
Sbjct: 249 PNLKIPLVKKLVEKY--NVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIE 297

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/292 (31%), Positives = 152/292 (52%), Gaps = 44/292 (15%)

Query: 11  LTNGVKIPVLALGVYEAPK---EETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           L NG +IP + LG   +PK    ET+  V  A+++GYR +D A  Y  E  +G  + +  
Sbjct: 13  LNNGGRIPAIGLGT-ASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKELF 71

Query: 68  KETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI------- 120
           ++   + R ++F TTKV      ++    SI +SL+ +  I+Y+D++L H P+       
Sbjct: 72  RDG-EIKREDLFITTKVWPCY--WDDPSTSINESLKSLG-IDYVDMVLQHWPLCYKKTYD 127

Query: 121 ------------------AATEERLGTWKALQEAYAEGK---VRAIGVSNYSIKHLEELY 159
                             A   + + T++ +++ Y + K   VRAIGVSNY I++LE + 
Sbjct: 128 ENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVI 187

Query: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSD--PQLQELIK 217
             +  KV P++NQ EL+P L + EL ++C K G++L A+SPL  G   +   P +QE  K
Sbjct: 188 --KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAK 245

Query: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
                  PA IL  + ++ G + +P+S N +R  SN+      ++  +MK+L
Sbjct: 246 KH--EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFA--PLTKNEMKSL 293

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  117 bits (292), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 94/305 (30%), Positives = 156/305 (51%), Gaps = 47/305 (15%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNER 57
           L P +T+   T  NG K+P   LG     +   ET+  V  A+K+GYRH+D A  YG E 
Sbjct: 2   LHPLSTEIYFTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEE 61

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
            VG  + +  +E   V R ++  T+KV   +  +    KS+ +SL  +K ++Y+DL L H
Sbjct: 62  YVGEALQELFEERV-VKREDLHITSKVW--HTMWNDVDKSLNESLARLK-VDYVDLFLQH 117

Query: 118 NPIAATE---------------------------ERLGTWKALQEAYA---EGKVRAIGV 147
            P+   +                           + + T+K +++ Y    + +VRAIGV
Sbjct: 118 WPLCTQKVPDPHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGV 177

Query: 148 SNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQK 206
           SN+ I++L+ +   +  +  P  NQ EL+P L ++ELCE+C +  +++ A+SPL   G  
Sbjct: 178 SNFPIEYLKRVL--KECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAP 235

Query: 207 FSD-PQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
             + P L+ L +    N +P  IL  + L+ G I +P+S NS R  SNL+ +   +S++D
Sbjct: 236 LLELPILKGLCEKY--NASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFV--PLSEED 291

Query: 266 MKALT 270
           +  L 
Sbjct: 292 VNKLN 296

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  116 bits (290), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 139/286 (48%), Gaps = 35/286 (12%)

Query: 11  LTNGVKIP---VLALGVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNERE 58
           L NG +IP   ++  G     +  +EHT    L           G  H+D A+ YG   E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHN 118
               +AK LKE+    RSEIF T K S          + +   L+ +  ++Y+DL LIH+
Sbjct: 70  ----LAKALKESSK-PRSEIFITDKYSTQTKFTNDPIEGLNTGLKTLG-LDYVDLYLIHS 123

Query: 119 PIAATEERLG-----TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           P    E +        WK ++  Y EGK ++IGVSN+S+K++EE+    G+K  P VNQ 
Sbjct: 124 PFFDPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEILKIAGIK--PQVNQI 181

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQ-------T 224
           E N +L  +   +  YC+K  + LEA+SPL   QK  +    EL   +Y ++       T
Sbjct: 182 EFNAFLQNQTPGIVNYCQKNNIQLEAYSPLGPLQKRPENS-NELPFYNYIDELASKYGKT 240

Query: 225 PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            +QIL+ W    G +P+  SS ++R I       F ++  ++  LT
Sbjct: 241 DSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEVDTLT 286

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  114 bits (284), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 152/291 (52%), Gaps = 47/291 (16%)

Query: 3   LTPSTTK---TLTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P TT+   +L NGV+IP L LG    P E   ET+  V  A+K+GYRH+D A  Y  E
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTAN-PHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             VG  I + L E  ++ R ++F TTKV      +++  +S+ +SL+ +  ++Y+DL L 
Sbjct: 75  PFVGEAIKELL-EDGSIKREDLFITTKVWP--VLWDEVDRSLNESLKALG-LDYVDLFLQ 130

Query: 117 HNPI---------------------------AATEERLGTWKALQEAYA---EGKVRAIG 146
           H P+                           A+  + L T+K L++ Y    + ++RAIG
Sbjct: 131 HWPLCFEKVKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIG 190

Query: 147 VSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRG 204
           VSN+SI++LE L   +  +V+P VNQ E +P L +  + ++C    ++L A+SPL     
Sbjct: 191 VSNFSIEYLERLI--KECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGA 248

Query: 205 QKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                P +++L  T   N T   +LI + ++ G I +P+S N  R  S+++
Sbjct: 249 PNLKIPLVKKL--TEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIE 297

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  112 bits (280), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 154/286 (53%), Gaps = 34/286 (11%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHT--------VFTALK-SGYRHVDCAQLYGNER 57
           TL NG KIP +A+   G     +EET+ T        +  ALK  G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
           EVG  ++  L E P   R+EIF T K S      E     +  +L+ +   +Y+DL L+H
Sbjct: 69  EVGKALS--LTEKP---RNEIFLTDKYSTQIKVSESPAVGLDIALKKMG-TDYVDLYLLH 122

Query: 118 NPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           +P  + E    T    WK +++ Y  GK + IGVSN+++K LE +   +  ++ P VNQ 
Sbjct: 123 SPFVSKETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLERIL--KVAEIRPQVNQI 180

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFS--DPQLQ--ELIK--TSYPNQTP 225
           E +P+L  +   + ++C++  ++LEA+SPL   QK +  D  L   E +K  +    ++ 
Sbjct: 181 EFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLPFFEYVKELSEKYIKSE 240

Query: 226 AQILIRWSLQMGFIPLPKSSNSKRQISNLQAL-DFEISDKDMKALT 270
           AQI +RW  + G +P+  SS  +R IS+ Q L  F+++D+++  +T
Sbjct: 241 AQITLRWVTRRGVLPVTTSSKPQR-ISDAQNLFSFDLTDEEVNQIT 285

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  112 bits (280), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 145/288 (50%), Gaps = 34/288 (11%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNER 57
           TL NG K+P +A+   G      EET  T    L           G  H+D A++Y    
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYP 69

Query: 58  EVGLGIAKFLKETPNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
           EVG    K L+E+ NV  R EIF T K S      E     +   L+ +  ++Y+DL L+
Sbjct: 70  EVG----KALRESHNVKPRDEIFITDKYSTQLKISENPMVGLTNGLKKLG-LDYVDLYLL 124

Query: 117 HNPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQ 172
           H+P  + E+   T    WK +++ Y  GKV+ IGVSN+S+  L+ +   +  +V+P VNQ
Sbjct: 125 HSPFISKEKNGFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQRIL--KSCEVKPQVNQ 182

Query: 173 FELNPWLTRKE--LCEYCEKKGMVLEAFSPL----TRGQKFSDPQLQELIK--TSYPNQT 224
            E N +L  +   +  +C +  + + A++PL     + + F      + +K      +++
Sbjct: 183 IEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQENFHKFVKQLAEKYDKS 242

Query: 225 PAQILIRWSLQMGFIPLPKSSNSKRQISNLQAL-DFEISDKDMKALTH 271
            AQIL+RW  + G IP+  SS  KR I + Q L  F+++D +++ +T 
Sbjct: 243 EAQILLRWVSKRGIIPVTTSSKEKR-IKDAQYLFTFDLTDSEVEKITQ 289

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  112 bits (279), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 144/285 (50%), Gaps = 46/285 (16%)

Query: 3   LTPSTTKT---LTNGVKIPVLALGVYEAPKE---ETEHTVFTALKSGYRHVDCAQLYGNE 56
           L P +T+    L NGV +P L LG   +P+E   ET+  V  A+K+GYRH+D A  YG E
Sbjct: 2   LHPKSTEIYFKLNNGVNMPALGLGT-ASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTE 60

Query: 57  REVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
             +G  + + L E  +V RS++F T+KV      ++    S+ +SL+ +  ++Y+DL L 
Sbjct: 61  GYIGDALKELL-ENGDVKRSDLFITSKVWPVY--WDDVDLSLNESLKSLG-LDYVDLYLQ 116

Query: 117 HNP----------------------------IAATEERLGTWKALQEAY---AEGKVRAI 145
           H P                            I    + L T+K +++ Y    + +VRAI
Sbjct: 117 HWPLCFQKIEDSKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAI 176

Query: 146 GVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRG 204
           GVSNY +++L+ L   +   V+P VNQ E++P L + EL E+CE   + L A+SPL + G
Sbjct: 177 GVSNYPVEYLDRLL--KVCTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSG 234

Query: 205 QKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249
                  L + +   Y   T   +LI + ++ G   +P+S N  R
Sbjct: 235 APLLKLPLVKELSEKY-QVTLNDVLISYHIRKGSFVIPRSLNPVR 278

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  110 bits (276), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 150/289 (51%), Gaps = 43/289 (14%)

Query: 3   LTPSTTKT---LTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNER 57
           L P +T+    L NGV++P + LG    P++  ET+  V  A+K+GYR++D A  YG+E 
Sbjct: 2   LHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEP 61

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
            VG  I + ++E   + R ++F T+KV      ++ A++S+ +SL+ +  ++YIDL L H
Sbjct: 62  FVGEAIKELIEEGA-IKREDLFITSKVWP--VLWDDAERSLQESLKSLG-VDYIDLWLQH 117

Query: 118 NPIAATEER---------------------------LGTWKALQEAYA---EGKVRAIGV 147
            P+                                 L T+K ++  Y+   + +VRAIGV
Sbjct: 118 WPLCYNRREDPHGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGV 177

Query: 148 SNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQK 206
           SN+ +++L+ +   +   V+P++NQ E++P L + EL E+C    + L A+SPL + G  
Sbjct: 178 SNFPVEYLKRVL--KECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAP 235

Query: 207 FSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
                L + +   Y   +   IL  + ++ G   +P+S NS R  SN++
Sbjct: 236 MVKHPLIKEMSQKY-KASENDILTSFHIRQGNTVVPRSINSVRIASNIE 283

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 147/280 (52%), Gaps = 42/280 (15%)

Query: 10  TLTNGVKIPVLALGVYEAPKE--ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFL 67
           TL NGV++P L LG      E   T+  V  A+K+GYRH+D A  YG+E  VG  I + +
Sbjct: 15  TLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKELM 74

Query: 68  KETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEER- 126
           +E   + R +IF T+KV      ++  ++S+ +SLE +  ++YIDL L H P+   ++  
Sbjct: 75  EEGV-IRREDIFITSKVWPVL--WDDVERSLNESLESLG-VDYIDLWLQHWPLCYVKQED 130

Query: 127 --------------------------LGTWKALQEAY---AEGKVRAIGVSNYSIKHLEE 157
                                     L T+  +++ Y   ++ +VR+IGVSN+ +++LE 
Sbjct: 131 THGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLER 190

Query: 158 -LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL-TRGQKFSDPQLQEL 215
            L+      V+P VNQ E++P L + EL ++C    ++LEA+SPL +        QL + 
Sbjct: 191 TLFE---CAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQD 247

Query: 216 IKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQ 255
           +   Y + +P+ IL  + ++ G   + +S N+ R  SN++
Sbjct: 248 LAEKY-SMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVE 286

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  109 bits (272), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 149/288 (51%), Gaps = 38/288 (13%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNER 57
            L NG KIP +A+   G       ET+ T   +L           G  H+D A++Y    
Sbjct: 9   VLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
           EVG  ++  L + P   R EIF T K S      +     +  SL+ +   +Y+DL L+H
Sbjct: 69  EVGKALS--LTKKP---RDEIFLTDKYSTQIKVSDSPAAGLEVSLKKMG-TDYVDLYLLH 122

Query: 118 NPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           +P  + E    T    WK +++ Y  GK + IGVSN+++K LE++      +V+P VNQ 
Sbjct: 123 SPFVSKEANGFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEKILKIA--EVKPQVNQI 180

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPLT-----RGQKFSDP---QLQELIKTSYPNQ 223
           E +P+L  +   + ++C+   ++LEA+SPL        Q  S P    ++EL +  +  +
Sbjct: 181 EFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKPFFEYVKELSEKYF--K 238

Query: 224 TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQAL-DFEISDKDMKALT 270
           + AQI++RW  + G +P+  SS  +R IS+ Q L  F+++D+++  +T
Sbjct: 239 SEAQIILRWVSKRGVLPVTTSSKPQR-ISDAQNLFSFDLTDEEVDEIT 285

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  108 bits (270), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 139/281 (49%), Gaps = 35/281 (12%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNER 57
           TL NG KIP +A+   G      EET+ T    L           G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
           EV    A  L+E+ N  R EIF T K S      +     +  SL+ +  ++Y+DL L+H
Sbjct: 69  EV----AAALRES-NRPRDEIFITDKYSTQLKLSDDPIAGLNISLKTLG-LDYVDLYLLH 122

Query: 118 NPIAATEERLG-TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELN 176
           +P       L   WK +++ Y  GK + IGVSN+ ++ LE++     +K  P +NQ E N
Sbjct: 123 SPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIATIK--PQINQIEFN 180

Query: 177 PWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFSD-PQ-------LQELIKTSYPNQTPA 226
             L  +   + ++C++  + LEA++PL   Q+  D P+       + EL K    N+T A
Sbjct: 181 AALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKY--NKTEA 238

Query: 227 QILIRWSLQMGFIPLPKSSNSKR--QISNLQALDFEISDKD 265
           QIL+RW  + G +P+  SS  +R     NL + D E S+ D
Sbjct: 239 QILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVD 279

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  106 bits (264), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 146/295 (49%), Gaps = 34/295 (11%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALG------VYEAPKE-------ETEHTVFTALKSGYRHV 47
           MN    T +   +G +IP++  G      + +A  E       E    V +A+ +G+ H+
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 48  DCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAK---KSIIKSLED 104
           D A+ Y    EVG G+     +   V R +++ T K +  +  + K     +S+  SLE 
Sbjct: 61  DAAEAYKTHPEVGRGV-----KNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEK 115

Query: 105 VKEIEYIDLLLIHNPIAATE----ERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160
           + ++ Y+DL L+H P    +    +    W+ ++E Y  G  + IGVSN+ ++ LE  Y 
Sbjct: 116 M-QMSYVDLYLLHVPFITVQTAGIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLE--YI 172

Query: 161 WEGLKVEPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPL---TRGQKFSDPQLQEL 215
            +  K  P+VNQ E N +L ++   +  YC+   +V+E +SPL   T+G+     +L   
Sbjct: 173 TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLDKLLPA 232

Query: 216 IKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           +   Y +++  QIL+RW  Q G + +  S+   R   ++   DFE++ +D  ++T
Sbjct: 233 LAEKY-HKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFDSIT 286

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  105 bits (262), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 146/289 (50%), Gaps = 42/289 (14%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNER 57
           TL NG KIP +A+   G      EETE      L           G  H+D A+ Y   +
Sbjct: 28  TLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQ 87

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSG--DNHG--YEKAKKSIIKSLEDVKEIEYIDL 113
           E+G    + L+E+P   R EIF T K S    NHG   E+ +  I K       ++Y+DL
Sbjct: 88  ELG----QALRESPK-PRDEIFITDKFSPTPKNHGGVLERFESGIKKM-----GVDYVDL 137

Query: 114 LLIHNPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPM 169
            LIH+P+   E+   T    WK L++ Y  GK + IGVSN+ ++ L+ +   +  KV+P 
Sbjct: 138 YLIHSPLIEKEKNGVTLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRIL--KVAKVKPQ 195

Query: 170 VNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQ-KFSDPQ-----LQELIKTSYP 221
           VNQ E + +L  +   + ++ +   + LEA++PL   Q K SD       ++EL K    
Sbjct: 196 VNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYNYVEELAKKY-- 253

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            +T AQ+L+RW  +   +P+  SS  +R  +      F+++D+++K +T
Sbjct: 254 GKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKIT 302

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  103 bits (257), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 150/286 (52%), Gaps = 34/286 (11%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHT--------VFTALK-SGYRHVDCAQLYGNER 57
           TL NG KIP +A+   G      EET+ T        +  ALK  G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
           EVG  ++  L E P   R+ IF T K S      +     +  +L+ +   +Y+DL L+H
Sbjct: 69  EVGKALS--LTEKP---RNAIFLTDKYSPQIKMSDSPADGLDLALKKMG-TDYVDLYLLH 122

Query: 118 NPIAATE----ERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           +P  + E         WK +++ Y  GK + IGVSN++++ L+ +   +  +V+P VNQ 
Sbjct: 123 SPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRIL--KVAEVKPQVNQI 180

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPL-----TRGQKFSDPQLQELIKTSYPN-QTP 225
           E +P+L  +   + ++C++  +++EA+SPL        Q  S P  + + + S    ++ 
Sbjct: 181 EFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYIKSE 240

Query: 226 AQILIRWSLQMGFIPLPKSSNSKRQISNLQAL-DFEISDKDMKALT 270
           AQI++RW  + G +P+  SS  +R IS+ Q L  F+++ +++  +T
Sbjct: 241 AQIILRWVTKRGVLPVTTSSKPQR-ISDAQNLFSFDLTAEEVDKIT 285

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  103 bits (256), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 140/282 (49%), Gaps = 30/282 (10%)

Query: 10  TLTNGVKIP---VLALGV--YE-APKEETEHTVFTALKS-----GYRHVDCAQLYGNERE 58
           TL NG KIP   ++  G   Y+  P+++    +   +++     G  H+DCA++Y    E
Sbjct: 9   TLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQTHAE 68

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHN 118
           VG  +    K      R EIF T K +         K+ +  +LE +  +EY+DL L+H 
Sbjct: 69  VGEALRNSKK-----PRDEIFITDKYAIPRKFSSNPKEGLKLALEKMG-LEYVDLYLLHF 122

Query: 119 PIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFE 174
           PI   +    T    WK +++ Y EG  + IGVSN+ ++ LE+L   +   ++P +NQ E
Sbjct: 123 PIIDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVEDLEQLS--KSWVIKPQINQIE 180

Query: 175 LNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFSDPQLQEL----IKTSYPNQTPAQI 228
            N +L  +   + +YC K  + LEAF PL   ++ ++  L  L    +   Y ++T  QI
Sbjct: 181 FNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLLPLYVKQLAQKY-SKTENQI 239

Query: 229 LIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           ++RW  Q   IP+  SS  +R         FE++  +++ +T
Sbjct: 240 MLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEFIT 281

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  103 bits (256), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 140/283 (49%), Gaps = 44/283 (15%)

Query: 17  IPVLALGV---YEAPKEETE----------HTVFTALKSGYRHVDCAQLYGNEREVGLGI 63
           IPVL  G    +   K E E            + TA+  G+ H+D A+ Y    EVG  +
Sbjct: 18  IPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEVGEAL 77

Query: 64  AKFLKETPNVSRSEIFYTTKVSG------DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
            +       + R ++F T K +       D  G  +A K  +++L     I+Y DL ++H
Sbjct: 78  RR-----SQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALG----IKYFDLYMLH 128

Query: 118 NPIAATEERLG-----TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQ 172
            P   T+E  G      W+ ++E Y  G  +AIGVSN+ ++ L+++ ++   +  PMV+Q
Sbjct: 129 RP-DITKENAGIDLQEAWRQVEELYEAGIAKAIGVSNFPLETLKQMESY--CRYLPMVHQ 185

Query: 173 FELNPWLTRKE--LCEYCEKKGMVLEAFSPLT---RGQKFS-DPQLQELIKTSYPNQTPA 226
            E +P+L  +   + E+C+ K +V+EA+SPL    R +    D  L  L+K    ++T  
Sbjct: 186 VEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAPLFRARPGPLDDILPNLMKKYGKSET-- 243

Query: 227 QILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           QI++RW +  G + L  SS  +R    L  LDFE+   D++ +
Sbjct: 244 QIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVELI 286

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  102 bits (255), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 145/289 (50%), Gaps = 39/289 (13%)

Query: 10  TLTNGVKIPVLAL---------GVYEAPK---EETEHTVFTALKSGYRHVDCAQLYGNER 57
           TL NG KIP +++         G  E+ K   E  +   +     G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEMYNTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLI 116
           EV     K LK T  V R EIF T K  SG     E     + KSL+++ E++Y+DL L+
Sbjct: 69  EVN----KALKSTSKV-RDEIFITDKYYSGSPKLTENPIAGLTKSLKEL-ELDYVDLYLL 122

Query: 117 HNPIAATEERLG-----TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVN 171
           H+P   T+E  G      WK +++ Y +GK + IGVSN+S+  L+ +      +++P +N
Sbjct: 123 HSPFI-TKESCGYTMEEAWKQMEKLYKDGKAKNIGVSNFSVDDLKRILKI--CEIKPQIN 179

Query: 172 QFELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKF---SDP-----QLQELIKTSYP 221
           Q E N +L  +   + ++C+   +++EA+SPL   +K     DP      ++EL K    
Sbjct: 180 QIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPTDRDPGPFYQYIEELAKKY-- 237

Query: 222 NQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
            ++  Q+L+RW  +   +P+  S   +R         F+++ ++++ +T
Sbjct: 238 GKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTSEEVEKIT 286

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  102 bits (255), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 130/248 (52%), Gaps = 21/248 (8%)

Query: 36  VFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAK 95
           V  A++ G+ H+D A+ Y   +EVG GI+        V R  ++ T K +  +  + K  
Sbjct: 50  VTNAIQCGFNHIDTAEAYKTYKEVGTGIS-----NAQVPRETLWITDKYTPWSWEWRKGS 104

Query: 96  ---KSIIKSLEDVKEIEYIDLLLIHNPIAATE----ERLGTWKALQEAYAEGKVRAIGVS 148
              +S+  SL+++  ++Y+DL +IH P   T+    +    W  ++E Y     R IGVS
Sbjct: 105 GPLESLTLSLKEMN-LDYVDLYMIHVPNITTKTAGIDLKEAWLQMEEIYTRKMARNIGVS 163

Query: 149 NYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPL---TR 203
           N+ ++ LE + ++   K +P+VNQ E + ++ ++   + +YC +  +V+E +SPL   T+
Sbjct: 164 NFDVESLEYIKSFA--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTK 221

Query: 204 GQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263
           G+     ++   I   Y  ++  Q+L+RW  Q G + +  +   +R   +L   DFE+S 
Sbjct: 222 GKPGPLDEILPGIAAKY-GKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSK 280

Query: 264 KDMKALTH 271
           +D   +T+
Sbjct: 281 EDFDQITN 288

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 139/285 (48%), Gaps = 32/285 (11%)

Query: 10  TLTNGVKIPVLAL---GVYEAPKEETEHTVFTALKS---------GYRHVDCAQLYGNER 57
           TL NG KIP +A+   G     KEET+     AL           G  HVD A++Y    
Sbjct: 9   TLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH 117
           E     ++ LK T    R+EIF T K S         ++ +   L+    +EY+DL L+H
Sbjct: 69  E----FSEALKNTKK-PRNEIFVTDKYSVQEKITNDPREGLDTGLKRTG-LEYVDLYLLH 122

Query: 118 NPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           +P A+ E+   T    W  L+E Y EGK + IGVSN+ ++ LE++   +  KV+P VNQ 
Sbjct: 123 SPFASKEKNGFTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEKIL--KVAKVKPQVNQI 180

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPL----TRGQKFSDPQLQELIK--TSYPNQTP 225
           E + +L  +   + ++ +   + LEA++PL     R +        + IK  T   ++T 
Sbjct: 181 EFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPFYDYIKKLTEKYSKTE 240

Query: 226 AQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           AQIL+RW  + G +P+  S   KR         F+++  ++  +T
Sbjct: 241 AQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEIT 285

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 139/285 (48%), Gaps = 35/285 (12%)

Query: 10  TLTNGVKIPVLAL-----------GVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNERE 58
           TL NG KI  +A+             +    E  +   F     G  HVD A+ Y    E
Sbjct: 9   TLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYYRTYPE 68

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLE---DVKEIEYIDLLL 115
           +     K LKE+    R+EIF T K S       K   + I++L    D   ++Y+DL +
Sbjct: 69  LN----KALKESSK-PRNEIFITDKFST----LLKITANPIEALNTALDSLGLDYVDLYV 119

Query: 116 IHNPIAATEER-LGTWKALQEA-YAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQF 173
           +H P    E + L    A  E  Y EGK + IGVSN+SI+HLE +     +K  P VNQ 
Sbjct: 120 LHFPEFDPEYKDLSIETAWMELLYKEGKAKNIGVSNFSIEHLERVMKIADVK--PQVNQI 177

Query: 174 ELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQK----FSDPQLQELIK--TSYPNQTP 225
           E N +L  +   + +YC++ G  LEA+SPL   Q+    F++    + I   ++   +T 
Sbjct: 178 EFNAFLQNQTPGIVKYCQQNGFQLEAYSPLAPLQRKPKNFNELPFYKYIDEVSAKYGKTD 237

Query: 226 AQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           ++IL+RW  + G +P+  SS  +R ++      F+++D+++  +T
Sbjct: 238 SEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVDKIT 282

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score = 96.3 bits (238), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 120/240 (50%), Gaps = 20/240 (8%)

Query: 43  GYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSL 102
           G  H+D A+ Y   REVG  +A+  K      R EIF T K    +   E     +   L
Sbjct: 53  GVVHLDAAEFYMTYREVGRALAETSK-----PRDEIFITDKYWTLSKVTENPIVGLETGL 107

Query: 103 EDVKEIEYIDLLLIHNPIAATEERLGT----WKALQEAYAEGKVRAIGVSNYSIKHLEEL 158
           + +  +EY+DL L+H+P  + E    +    W  ++E Y  GK + IGVSN++ + LE +
Sbjct: 108 KRLG-LEYVDLYLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERV 166

Query: 159 YNWEGLKVEPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQK-----FSDPQ 211
              +  KV+P VNQ E N +L  +   +  +C++  + L A+SPL   QK      S P 
Sbjct: 167 L--KVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQPF 224

Query: 212 LQELIKTS-YPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
              + K + + N+TP Q+L+RW  + G + +  S   +R     +  +F++ D ++  +T
Sbjct: 225 YSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVTEIT 284

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 91.3 bits (225), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60
           +++   T   L NG +IPV+  GVYE PKE+T   V++ALK GYRH+D A LY N++E  
Sbjct: 5   IDINRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAA 64

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDV 105
            G+ K+L ET   +R  I++TTK+     G E+ KK++ +   DV
Sbjct: 65  QGVRKYLDETGE-ARENIWFTTKLWDSQFGREETKKALQEVAADV 108

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 137/294 (46%), Gaps = 50/294 (17%)

Query: 10  TLTNGVKIPVLAL------------GVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNER 57
           TL NG KIP +A+               +   E  +   +     G  H+D A++Y    
Sbjct: 9   TLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYP 68

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVS-----GDNH--GYEKAKKSIIKSLEDVKEIEY 110
           E+G    K L+ET    R+EI+ T K S      DN   G+E   K +         ++Y
Sbjct: 69  ELG----KALRETKK-PRNEIWITDKYSTSLKLSDNPIVGFENGLKEL--------GVDY 115

Query: 111 IDLLLIHNPIAATEERLG-----TWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLK 165
           IDL L+H+P   TE R G      WK L+E Y  GK + IGVSN++ + LE +     +K
Sbjct: 116 IDLYLLHSPFI-TEGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILKIAEIK 174

Query: 166 VEPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQ 223
             P VNQ E + +L  +   +  + ++  ++LEA+SPL   Q+  + +   L    Y N+
Sbjct: 175 --PQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPE-EADSLPFYKYINE 231

Query: 224 -------TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
                  + AQ+L+RW  + G +P+  SS   R         F+++  +++ +T
Sbjct: 232 LAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKIT 285

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 86.7 bits (213), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 130/287 (45%), Gaps = 38/287 (13%)

Query: 10  TLTNGVKIPVLA-----------LGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNERE 58
           TL NG  IP +             G+ +  K   E+        G+ H+  A+ Y N   
Sbjct: 10  TLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNN-- 67

Query: 59  VGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLE---DVKEIEYIDLLL 115
              G+     +     R EI+ T K         K   S I++LE   D    +Y+DL L
Sbjct: 68  ---GLLSAALKASQKPRHEIWITDKYCSQC----KLSSSPIEALERSLDRLGFDYVDLYL 120

Query: 116 IHNPIAATEERL----GTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVN 171
           IHNP   +          WK ++  Y  GKV+ IGVSN+ I+ LE L + E   ++P VN
Sbjct: 121 IHNPCLDSSPNGISLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERLKDAE---IKPQVN 177

Query: 172 QFELNPWLTRK--ELCEYCEKKGMVLEAFSPL----TRGQKFSD-PQLQELIKTSYP-NQ 223
           + E + +L  +   + EY +   ++L  +SPL    T+ + F D P  + +I  +   N+
Sbjct: 178 EIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFYRYIIGLAEKYNK 237

Query: 224 TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALT 270
           T AQIL+ W   +G +P+  ++  K        + FE++ +++  +T
Sbjct: 238 TEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMIT 284

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 132/306 (43%), Gaps = 68/306 (22%)

Query: 31  ETEHTVFTALK----SGYRHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFYTT 82
           E +  +F+ LK    +G R  D A +Y N   ER +G  + K+ ++    V  ++IFY  
Sbjct: 37  EDKEKIFSILKHCYDNGLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPV 96

Query: 83  KVSGD-NHGYEK--------------AKKSIIKSLEDVKEI--EYIDLLLIHNPIAAT-- 123
             + D +HG                 ++K II  +++  E    YID+L IH     T  
Sbjct: 97  DETLDLHHGNSTNERNALDLVNQNGLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPK 156

Query: 124 EERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY------NWEGLKVEPMVNQFELNP 177
           EE +   +AL +   EG VR IG S+       EL        W   K     + + L  
Sbjct: 157 EEIM---RALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGW--FKFVSSQSYYNLLN 211

Query: 178 WLTRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDPQL------------QE 214
               +EL  +C+K G+ L  +SP  RG           +K +DP              +E
Sbjct: 212 REDERELIPFCKKHGVGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKE 271

Query: 215 LIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           +++      +  N + A + I W+L  G  P+   ++ +R    ++A+D E+++ D+K L
Sbjct: 272 IVRRVEHLAAKKNISMAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYL 331

Query: 270 THDDTY 275
             ++TY
Sbjct: 332 --EETY 335

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 131/307 (42%), Gaps = 70/307 (22%)

Query: 31  ETEHTVFTALK----SGYRHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFYTT 82
           E +  +F  LK    +G R  D A +Y N   ER +G  + K+ +K    V  ++IFY  
Sbjct: 37  EDKEKIFNILKHCYDNGLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIFYAV 96

Query: 83  KVSGD----------------NHGYEKAKKSIIKSLEDVKEI--EYIDLLLIHNPIAAT- 123
             + D                N G   ++K II  +++  E    YID+L IH     T 
Sbjct: 97  DETLDLPRSNVPNERNDLDLANQG-GLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTP 155

Query: 124 -EERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY------NWEGLKVEPMVNQFELN 176
            EE +   +AL +   EG VR IG S+       EL        W   K     + + L 
Sbjct: 156 KEEIM---RALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGW--FKFVSSQSYYNLL 210

Query: 177 PWLTRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDPQL------------Q 213
                +EL  +C++ G+ L  +SP  RG           +K SDP +            +
Sbjct: 211 NREDERELIPFCKRHGVGLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQK 270

Query: 214 ELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKA 268
           E++K      +  N + A + I W+L  G  P+   ++ +R    ++A+D ++++ D+K 
Sbjct: 271 EIVKRVEHLATKKNISMAMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKY 330

Query: 269 LTHDDTY 275
           L  ++TY
Sbjct: 331 L--EETY 335

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 96/209 (45%), Gaps = 39/209 (18%)

Query: 15  VKIPVLALGVY---EAPKEETEHTVFTALKSGYRHVDCAQLY-GNEREVG-LGIAKFLK- 68
            ++P +  G Y     PK+E         ++G    D A++Y G+E+ +G LGIA  L  
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSEKSIGDLGIADDLVI 61

Query: 69  -------ETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH--NP 119
                  E   ++R  IF                +SI +S +++K ++ +++  +H  +P
Sbjct: 62  DTKARSFEEGALTRDGIF----------------ESIKQSFDELK-VDSVEIYYLHAPDP 104

Query: 120 IAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLK--VEPMVNQFELNP 177
           I   EE   T  A+ E Y +GK +  G+SNY+   ++++Y +   K  V P V Q   N 
Sbjct: 105 ITPIEE---TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNA 161

Query: 178 W--LTRKELCEYCEKKGMVLEAFSPLTRG 204
           +     K+L     K G+   A+SP+  G
Sbjct: 162 FSRSIEKDLFPVLRKYGISFYAYSPIAGG 190

>KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 131/326 (40%), Gaps = 80/326 (24%)

Query: 12  TNGVKIPVLALGVYE------AP-----KEETEHTVFTALKSGYRHVDCAQLYGN---ER 57
           ++G+KI  + +G         AP     KEE    +     +G R  D A +Y N   ER
Sbjct: 11  SSGLKISPIIVGCMSFGSKSWAPWLLDDKEEIFKILKYCYDNGLRTFDTADIYSNGLSER 70

Query: 58  EVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLL--- 114
            +G    +FL+   N++R  +   +KV   N   +++    +KS+ +V E+  + L    
Sbjct: 71  LIG----EFLRNY-NINRETVVILSKV---NFPVDESLDLSVKSIFNVDEVTALTLTNQR 122

Query: 115 -----LIHNPIAATEERLGTW-------------------KALQEAYAEGKVRAIGVSNY 150
                 I + +A + ERLGT+                   +AL +    G  R IG S+ 
Sbjct: 123 GLSRKHIIDGVAKSVERLGTYIDVLQIHRFDSETTMEETMRALNDVVESGHARYIGASSM 182

Query: 151 SIKHLEELY------NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG 204
                 +L        W   K     +Q+ L      +EL  Y ++ G+ L  +SP  RG
Sbjct: 183 LATEFSDLQFTVERNGW--FKFISSQSQYNLLYREDERELIPYAKRHGIGLIPWSPNARG 240

Query: 205 -----------QKFSDPQLQELIKTSY---------PNQTPAQILIR---WSLQMGFIPL 241
                      +  SDP+ Q+L               N+    +++    W L  G  P+
Sbjct: 241 LLTRPVGVATERSSSDPRFQKLTNAGMEIINRVEEVANRRNVSMVVASNAWVLHKGCHPI 300

Query: 242 PKSSNSKRQISNLQALDFEISDKDMK 267
              S++ R    +QAL F+++D+++K
Sbjct: 301 VGMSSTARVDEAVQALTFKLTDEEVK 326

>NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 136/331 (41%), Gaps = 86/331 (25%)

Query: 14  GVKIPVLALGVYEAPK-------EETEHTVFTALKS----GYRHVDCAQLYGN---EREV 59
           G+K+  L +G             E+ +  VF  LK     G+R  D A +Y N   ER +
Sbjct: 14  GIKVSPLIVGCMSYGSKTWAEWVEDDKEKVFQILKHCYDIGFRTFDTADVYSNGKSERLL 73

Query: 60  GLGIAKFLKETPNVSRSEIFYTTKVS-----------GDNHGYEK-----------AKKS 97
           G  + KF     N+ R  +   TK +           GD +  E            ++K 
Sbjct: 74  GEFLRKF-----NIRRETVVILTKTNFPVDETLVLPIGDANRSENDTLDLVNQQGLSRKH 128

Query: 98  IIKSLEDVKEI--EYIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNY--- 150
           I++S+++  E    YID+L IH  +P    +E   T KAL +   +G VR IG S+    
Sbjct: 129 ILQSVKNSVERLGTYIDVLQIHRFDPNTPIKE---TMKALNDVVEKGDVRYIGASSMLPT 185

Query: 151 ---SIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG--- 204
               ++ + + Y+W   +   + +Q+ L      ++L +YC+K  + L  +SP  +G   
Sbjct: 186 QFVEMQGVADKYDW--FQFVNVQSQYNLLYREDERDLMKYCKKHNIALTPWSPNYQGLLT 243

Query: 205 ---------------------QKFSDPQLQELI----KTSYPNQTP-AQILIRWSLQMGF 238
                                +KF DP  + +I    + S     P A I   W L  G 
Sbjct: 244 RPVGVESVRSTKDKFINAWDLKKF-DPAQKAIIDRVEELSKKKGVPMAAISTAWVLAKGC 302

Query: 239 IPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
            P+   S+ KR     +ALD + +++++  L
Sbjct: 303 YPIVGMSSIKRVDEAKEALDVKFTEEELAYL 333

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 127/300 (42%), Gaps = 64/300 (21%)

Query: 29  KEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKV---- 84
           K+++   +  A   G R  D A LY N +   + + +FLKE  N+SR  +   TK+    
Sbjct: 16  KQKSYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEY-NISRETVVIMTKLFAPV 74

Query: 85  ---------SGDNHGYEK---------AKKSIIKSLED-VKEI-EYIDLLLIH--NPIAA 122
                    +G  HG +          +KK II++ ++ ++ +  YID+  +H  +P   
Sbjct: 75  DDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGTYIDVYQVHRADPDTP 134

Query: 123 TEERLGTWKALQEAYAEGKVRAIGVSNY-SIKHLEELYNWEGLKVEPMVNQFELNPWLTR 181
            EE   T +AL +   +G  R IG S+    K  E  +  E       VN  +    L R
Sbjct: 135 MEE---TMRALNDVVQQGLTRYIGASSMLGTKFAEYQFIAEKNGWSKFVNMQDCYNLLYR 191

Query: 182 ---KELCEYCEKKGMVLEAFSPLTRG------------------------QKFSDPQLQE 214
              +E+  Y +K G+    +SPL RG                         ++ D ++ E
Sbjct: 192 EEEREMIPYIKKHGIAQTPWSPLQRGLLSRPVEGSSYREDNDRVLKGQRLNQYEDFEI-E 250

Query: 215 LIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           +IK     +   N   A I   W L  G  P+   ++ +R    ++AL+ E++++++K L
Sbjct: 251 IIKRVEEISKKRNNPMAVISTAWVLSKGTFPILGLNSVERMEDAVRALNIELTEEELKYL 310

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 123/300 (41%), Gaps = 67/300 (22%)

Query: 29  KEETEHTVFTALKSGYRHVDCAQLYGN-EREVGLGIAKFLKETPNVSRSEIFYTTKV--- 84
           KEE    +  A   G R  D A +Y N + E+ LG  +FL++  N+ R  +   TK+   
Sbjct: 39  KEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILG--EFLRKY-NIPRETVVIMTKLRFP 95

Query: 85  SGDNHGYE-----------------KAKKSIIKSLE-DVKEI-EYIDLLLIH--NPIAAT 123
           + +N   +                  ++KSI  S    VK +  YID+L IH  +P    
Sbjct: 96  ADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLGTYIDILQIHRGDPDTPF 155

Query: 124 EERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQFELNP 177
           EE +G   AL +   EG  R +G S         ++ + E + W   K     + + L  
Sbjct: 156 EETMG---ALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHGW--FKFVNSQSCYHLMY 210

Query: 178 WLTRKELCEYCEKKGMVLEAFSPLTRG------------------------QKFSDPQ-- 211
               +EL  + ++  + L  FSPL RG                        + ++D +  
Sbjct: 211 REDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTETTRSNSDSVIKTKNLKNYTDWEAS 270

Query: 212 -LQELIKTSYPNQTP-AQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
            +  + K S     P + I + W LQ G  P+   S+ +R    + ALD  +++++MK L
Sbjct: 271 IINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFSSIERVEEAIDALDVNLTEEEMKYL 330

>SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 93/202 (46%), Gaps = 24/202 (11%)

Query: 13  NGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLY-GNEREVGLGIAKFLKETP 71
           N VKI   A  +   PK++ E  +    K   + +D A++Y G+E+ +G           
Sbjct: 4   NHVKIIYGAFPITHLPKDQLEDVLQLLEKYNVKDLDTARIYPGSEKSIG---------EL 54

Query: 72  NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLED---VKEIEYIDLLLIHNPIAAT--EER 126
           N+S S   +T  V+        +K+SI++S+ +   + + E ++   +H P  AT  EE 
Sbjct: 55  NLSASYTIHTKAVAFQERSL--SKESIVESIGESLSLLKTEKVETFYLHCPDPATPIEE- 111

Query: 127 LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLK--VEPMVNQFELNPWLTR--K 182
             T +A+ E Y +GK    G+SNY    + ++Y +   K  V P V Q   N    +  K
Sbjct: 112 --TLEAINELYKDGKFVHFGLSNYPASDVRKIYEYAASKGYVLPTVYQGNYNAVSRKIEK 169

Query: 183 ELCEYCEKKGMVLEAFSPLTRG 204
           +L     +  +   A+SP+  G
Sbjct: 170 DLFPVLRELKITFYAYSPIAGG 191

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 89/186 (47%), Gaps = 28/186 (15%)

Query: 31  ETEHTVFTALKSGYRHVDCAQLY-GNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNH 89
           +  + + T LK+G + +D A++Y  NE+ +G        E     R  I   TK SG + 
Sbjct: 16  QNSNEIVTVLKAGVKDIDTARIYPDNEKAIG--------ELQLPDRFTIH--TKASGFSG 65

Query: 90  G---YEKAKKSIIKSLEDVKEIEYIDLLLIHNP---IAATEERLGTWKALQEAYAEGKVR 143
           G    +   KSI +SL  +  +  ++  L+H+P   I   E    T  A+   Y +GK  
Sbjct: 66  GCLTRDNINKSIEESLS-LLGVPSVETFLLHSPDPEIPLEE----TLDAINSLYEQGKFE 120

Query: 144 AIGVSNYSIKHLEELYNWEGLK--VEPMVNQFELNPWLTR---KELCEYCEKKGMVLEAF 198
             G+SN+S + ++ +Y++   K  V P V Q   N  L+R    +L    ++  + L A+
Sbjct: 121 KFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNA-LSRAIVNDLFPLLKELHISLYAY 179

Query: 199 SPLTRG 204
           SP+ RG
Sbjct: 180 SPIARG 185

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 25  YEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREV-GLGIAKFLKETPNVSRSEIFYTTK 83
           YE P   T   V  AL++G   +D +  YG   E+ G  +A    E P   R   F  TK
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP---RETYFICTK 105

Query: 84  VSGD-----NHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGTWKALQEAYA 138
           V  +     ++     + S+ +S   +   EY+DL+ +H+      E  G W+ALQE   
Sbjct: 106 VGREGPSDFDYSAAHVRASVHRSCARL-HTEYLDLVYLHD--IEFVEAAGIWEALQELRR 162

Query: 139 ---EGKVRAIGVSNYSIKHLEEL 158
              EG +R  G+S Y ++ L+E+
Sbjct: 163 LKDEGVIRFFGISGYPVELLQEV 185

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 117/301 (38%), Gaps = 67/301 (22%)

Query: 30  EETEHTVFTALKSGY----RHVDCAQLYGN-EREVGLGIAKFLKETPNVSRSEIFYTTKV 84
           E+    +F  LK  Y    R  D A +Y N E E+ LG  +FLK    + R  +   TK+
Sbjct: 36  EDDREKIFKILKYAYDKGLRTYDTANVYSNGESEIILG--EFLKNY-KIPRETVIIMTKL 92

Query: 85  ---SGDNHGYE-----------------KAKKSIIKSLED-VKEI-EYIDLLLIH--NPI 120
              + DN  Y+                  ++K+II S  D V+ +  Y D++ IH  +P 
Sbjct: 93  YFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGTYADIIQIHRADPD 152

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNY-SIKHLEELYNWEGLKVEPMVNQFELNPWL 179
              EE   T +AL +   +G  R IG S+  + + +E  +  E       +N       L
Sbjct: 153 TPFEE---TMRALNDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLL 209

Query: 180 TR---KELCEYCEKKGMVLEAFSPLTRG----------QKFSDPQLQELIKTSYPNQTPA 226
            R   +EL  + ++  + L  +SPL RG           +F   Q   +      N +  
Sbjct: 210 YREDERELIPFAKRHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDE 269

Query: 227 QILIR------------------WSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKA 268
           +I+ R                  W +Q G  P+   S   R    + AL+  ++  +M  
Sbjct: 270 EIITRVEEIAKKRNTKMATVALYWVIQKGCFPIVGMSKIDRIDEAIAALEINLTKDEMTY 329

Query: 269 L 269
           L
Sbjct: 330 L 330

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 137/326 (42%), Gaps = 74/326 (22%)

Query: 13  NGVKIPVLALGV--YEAPK-----EETEHTVFTALK----SGYRHVDCAQLYGN---ERE 58
           +G+KI  + +G   Y + K      E +  +F  LK     G R  D A +Y N   ER 
Sbjct: 12  SGLKISPILIGCMSYGSKKWADWVMEDKDEIFKILKHCYDRGLRTFDTADVYSNGISERL 71

Query: 59  VGLGIAKF-LKETPNVSRSEIFYTTKVSGD-NHGYEK---------------AKKSIIKS 101
           VG  + K+ +K    V  ++IF+    S D +HG                  ++K II  
Sbjct: 72  VGEFLKKYNIKRETVVIMTKIFFPVDESLDLHHGSNVNQEAMELQLTLQRGLSRKHIIDG 131

Query: 102 LEDVKEI--EYIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNY------S 151
           + +  E    YID+L IH  +   + EE +   ++L +    G+VR IG S+        
Sbjct: 132 VANSVERLGTYIDVLQIHRLDEETSMEEIM---RSLNDVVMSGQVRYIGASSMLATEFAE 188

Query: 152 IKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG------- 204
           ++ + E   W   K     + + L      +EL  +C+K G+ L  +SP  RG       
Sbjct: 189 LQFIAEKNGW--FKFISAQSYYNLINREDERELIPFCKKHGVGLIPWSPNARGVLTRPVE 246

Query: 205 ----QKFSDP-----QLQEL------------IKTSYPNQTPAQILIRWSLQMGFIPLPK 243
               +  +DP     +L EL            +     + T A I + W+L  G  P+  
Sbjct: 247 KNTERMLTDPTFNRMRLNELGDDEKEIVRRIQMVAERRSVTMAIISMAWTLHKGCNPIVG 306

Query: 244 SSNSKRQISNLQALDFEISDKDMKAL 269
            ++ +R    ++A++F +++ ++K L
Sbjct: 307 LNSVERVDEAVKAIEFTLTEDEIKLL 332

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 84/218 (38%), Gaps = 59/218 (27%)

Query: 31  ETEHTVFTALK----SGYRHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFYTT 82
           E +  +F  LK    +G R  D A +Y N   ER +G  + +F +K    V  S+IF+  
Sbjct: 37  EDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPV 96

Query: 83  KVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLL----------IHNPIAATEERLGTW-- 130
             S D H   K  +            EYIDL L          I   +A + ERLGT+  
Sbjct: 97  DESLDLHQGSKVDQ------------EYIDLQLSFQQGLNRKHIMAGVANSVERLGTYID 144

Query: 131 -----------------KALQEAYAEGKVRAIGVSNYSIKHLEELY------NW-EGLKV 166
                            ++L +    G+VR IG S+       EL        W + + V
Sbjct: 145 ILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINV 204

Query: 167 EPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG 204
           +   N           EL  +C+K G+ L  +SP  RG
Sbjct: 205 QSYYNVLNRED---ENELIPFCKKHGVGLTVWSPNARG 239

>ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} similar
           to uniprot|Q02895 Saccharomyces cerevisiae YPL088W
           Putative aryl alcohol dehydrogenase transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 343

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 125/305 (40%), Gaps = 76/305 (24%)

Query: 31  ETEHTVFTALK----SGYRHVDCAQLYGN---EREVGLGIAKFLKETPNVSRSEIFYTTK 83
           E +  +F+ LK     G R  D A +Y N   ER VG    +FL+   N++R  +   TK
Sbjct: 38  EDKQRIFSILKHCYDRGLRTFDTADVYSNGMSERLVG----EFLRHY-NINRETVVILTK 92

Query: 84  V----------------SGDN-----HGYEKAKKSIIKSLEDVKEI--EYIDLLLIHNPI 120
           V                S DN     +    ++K II  ++   E    YID+L +H   
Sbjct: 93  VYFPVDESIQLTHSNIASTDNGLTLANQRGLSRKHIIAGVKGSVERLGTYIDVLQLHRLD 152

Query: 121 AAT--EERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQ 172
             T  EE +   +AL +   +G  R IG S+        ++ + E ++W  +K     + 
Sbjct: 153 HDTPMEEIM---RALNDVVTQGDARYIGASSMLATEFAELQFIAEKHDW--VKFVSSQSC 207

Query: 173 FELNPWLTRKELCEYCEKKGMVLEAFSPLTRG-------------------QKFSDPQL- 212
           + L      +EL  +  +  + L  +SPL RG                   Q+F   +L 
Sbjct: 208 YNLLYREDERELYPFAHRHNIALIPWSPLARGALSRPLGANTQRGSTDKGFQRFGFAELE 267

Query: 213 ---QELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDK 264
              QE++K           + A +   W L  G  P+   S+ +R    L+ALD +++D+
Sbjct: 268 AHEQEIVKRVEKVAKDKGISMATLGTAWVLSKGCYPIGGFSSEERVDEALKALDVKLTDE 327

Query: 265 DMKAL 269
           ++K L
Sbjct: 328 EIKYL 332

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 136/326 (41%), Gaps = 76/326 (23%)

Query: 14  GVKIPVLALGV--YEAPK-----EETEHTVFTALK----SGYRHVDCAQLYGN---EREV 59
           G+KI  + +G   Y + +     ++ +  VF  LK     G R  D A +Y N   ER +
Sbjct: 14  GIKISPIIVGCMSYGSKQWAEWVQDDKEKVFEILKHCYDRGLRTFDTADVYSNGISERLL 73

Query: 60  GLGIAKF----------------LKETPNVSRSEIFYTTKVSGD-NHGYEKAKKSIIKSL 102
           G  + KF                + E+ +++  E+ ++   + D  +    ++K I++S+
Sbjct: 74  GEFLKKFNIKRETVVILTKTFFPVDESLSLALGEMSFSESDTLDLTNQRGLSRKHILQSV 133

Query: 103 EDVKEI--EYIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNY------SI 152
           ++  E    YID+L IH  +P    +E   T KAL +    G VR IG S+        +
Sbjct: 134 KNSVERLGTYIDVLQIHRFDPTTPIKE---TMKALNDVVESGDVRYIGASSMLPTQFVEM 190

Query: 153 KHLEELYNW-EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTR--- 203
           + + + ++W + + V+   N          ++L +YCEK  + L  +SP     LTR   
Sbjct: 191 QSVADKHDWFQFVNVQSCYNLLYRED---ERDLMQYCEKHNIALTPWSPNHQGLLTRPIG 247

Query: 204 -------------GQKFSD--PQLQELIK-----TSYPNQTPAQILIRWSLQMGFIPLPK 243
                        G    D  P   E+I      +   N + A I   W L  G  P+  
Sbjct: 248 VESERSTTDKIINGWNMKDLKPSEIEIINRVEELSKKKNVSMAVISTAWVLSKGCAPIVG 307

Query: 244 SSNSKRQISNLQALDFEISDKDMKAL 269
            S+  R    + ALD + ++++ K L
Sbjct: 308 MSSISRVDEVITALDVKFTEEETKQL 333

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 29  KEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDN 88
           +EE    V    K     +D A++Y    E    I KF  E P          TK  G  
Sbjct: 19  QEEASKFVDVLEKYKVEELDTARIYPGSEEA---IGKF--ELPK----SFIIDTKARGFG 69

Query: 89  HGYEKAKKSIIKSLED---VKEIEYIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVR 143
            G    K+SI +S+E+   +  +E +++  +H P  AT  EE L    AL   Y EGK +
Sbjct: 70  EG-TLTKESINESIEESFGLLGVESVEIFYLHCPDPATPLEETLDAIDAL---YKEGKFK 125

Query: 144 AIGVSNYSIKHLEELYNWEGLK--VEPMVNQFELNPWLTRK---ELCEYCEKKGMVLEAF 198
             GVSN+S + + ++Y++   K  V P V Q   N  + RK    L     + G+   A+
Sbjct: 126 KFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNA-VGRKIETSLFPVLRELGLSFYAY 184

Query: 199 SPLTRG 204
           SP+  G
Sbjct: 185 SPIAGG 190

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 118/302 (39%), Gaps = 68/302 (22%)

Query: 30  EETEHTVFTALK----SGYRHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFY- 80
           E+ ++T+F  LK     G R  D A  Y N   E+ +G  + K+ +K    V  ++IF+ 
Sbjct: 37  EDDKNTIFGILKYCYDKGLRTFDTADYYSNGLSEKLLGEFLVKYNIKRETVVIMTKIFFP 96

Query: 81  ---TTKVSGDNHGYEK-----------AKKSIIKSLEDV--KEIEYIDLLLIH--NPIAA 122
              T  +  +    E            ++K I+  +E    +   YID+L IH  +P   
Sbjct: 97  FDETLNLKSNTPLSELQELDVVNQRGLSRKHILDGVEKAIARLGTYIDVLQIHRFDPETP 156

Query: 123 TEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL------YNW-EGLKVEPMVNQFEL 175
            +E   T KAL +    G VR IG S+       E+      YNW + +  + M N   L
Sbjct: 157 IKE---TMKALNDVIESGHVRYIGASSMLATQFAEMQFIADKYNWFQFVNAQSMYN---L 210

Query: 176 NPWLTRKELCEYCEKKGMVLEAFSPLTRG--------------------QKFSDPQLQEL 215
                 +EL  +C++  + L  +SP  RG                     K  D  L+  
Sbjct: 211 VYREDERELIPFCKRHNIALTPWSPNHRGFLTRPIGTKSLRSESDRFTINKLRDNVLESD 270

Query: 216 IK--------TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMK 267
           IK              + A I   W +  G  P+   S ++R    + AL    +D+++K
Sbjct: 271 IKIVKRVEELAEKKGVSMAAISTAWVVSKGCQPIIGLSKTERVDDAISALSVTFTDEELK 330

Query: 268 AL 269
            L
Sbjct: 331 YL 332

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 41  KSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKV-----SGDNHGYEKAK 95
           +  +  VD +  YG+     L + + L+E   + R EI+  TKV     S  ++  E  +
Sbjct: 38  RRCFNAVDTSPYYGDSE---LLVGQALREL-QIPRGEIYVCTKVGRVGVSEFDYSRENVR 93

Query: 96  KSIIKSLED-VKEIEYIDLLLIHN-PIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIK 153
            S+++S+E  V E  Y+D++ +H+      E  L     LQ+    G VR +GVS Y + 
Sbjct: 94  MSVMRSVERLVGEGGYLDVVYLHDVEFQPQEACLAALDELQKLKRAGIVRNVGVSGYPLS 153

Query: 154 HLEEL 158
            L  L
Sbjct: 154 KLYSL 158

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 122/312 (39%), Gaps = 87/312 (27%)

Query: 30  EETEHTVFTALK----SGYRHVDCAQLYGNEREVGLGIAKFLKE---TPNVSRSEIFYTT 82
           E+ +  VF  LK     G R  D A +Y N    GL   K LKE     N+ R  +   +
Sbjct: 36  EDDKEKVFKILKHCYDQGLRTFDTADVYSN----GLS-EKLLKEFMQKYNIRRETVVIMS 90

Query: 83  KVS---------GDNHGYEK-------------AKKSIIKSLEDVKEIE----YIDLLLI 116
           KV          G   G E              ++K II + +  K +E    Y+D+L I
Sbjct: 91  KVFFPVDETLDLGLGSGLEDELAQLDLTNQQGLSRKHIIDAAK--KSVERLGTYMDVLQI 148

Query: 117 H--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL------YNW-EGLKVE 167
           H  +P    +E   T +AL +    G  R IG S+     L EL      YNW + + V+
Sbjct: 149 HRFDPNTPVKE---TMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNWFQFVNVQ 205

Query: 168 PMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTR------------------G 204
              N          +E   + +K  ++L  +SP     LTR                  G
Sbjct: 206 SCYNLVYRE---DERETIPFAKKHNLMLTPWSPNHQGLLTRPVGVESTRSSSDIIINAWG 262

Query: 205 QKFSDP-------QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQAL 257
            K   P       +++E+ K    N + A I   W +Q G  P+   S+  R   N++AL
Sbjct: 263 LKNLKPWEVTVINRVEEMAKKK--NVSMAVIATAWVIQKGCAPILGMSSIARVDDNIKAL 320

Query: 258 DFEISDKDMKAL 269
           D   ++++MK L
Sbjct: 321 DVSFTEEEMKYL 332

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 130/325 (40%), Gaps = 74/325 (22%)

Query: 14  GVKIPVLALGV-------YEAPKEETEHTVFTALKS----GYRHVDCAQLYGN---EREV 59
           G+KI  L +G        +    E+ +  +F   K     G+R  D A +Y N   ER +
Sbjct: 14  GIKISPLIVGCMSYGSKAWAQWVEDDKEKIFQIFKHCYDIGFRTFDTADVYSNGKSERLL 73

Query: 60  GLGIAKF----------------LKETPNVSRSEIFYTTKVSGDNHGYEK-AKKSIIKSL 102
           G  + KF                + ET ++   E  ++     D    +  ++K I+ S+
Sbjct: 74  GEFLRKFEIRRETVVILTKTYFRVDETLDLPLGEFPHSENDVLDLVNQQGLSRKHILDSV 133

Query: 103 EDV--KEIEYIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNY------SI 152
           ++   +   YID+L IH  +P    +E   T KAL +    G VR IG S+        +
Sbjct: 134 KNSVGRLGTYIDVLQIHRFDPTTPIKE---TMKALNDVVENGDVRYIGASSMLPTEFVEM 190

Query: 153 KHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTR---- 203
           + + + Y+W   +   + +Q+ L      ++L +YC+K  + L  +SP     LTR    
Sbjct: 191 QAIADKYDW--FQFVNVQSQYNLLYREDERDLMKYCKKHNIALTPWSPNYQGLLTRPVGV 248

Query: 204 --------------GQKFSDPQLQELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKS 244
                           K  DP  +E+I      +       A I   W +  G  P+   
Sbjct: 249 ESTRSKTDKVIDAWHLKNLDPAQKEIINRVEELSKKKGVAMAAISTAWVMAKGCQPILGM 308

Query: 245 SNSKRQISNLQALDFEISDKDMKAL 269
           S+ KR      ALD + +++++  L
Sbjct: 309 SSIKRVDEAKDALDVKFTEEELAYL 333

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 83/199 (41%), Gaps = 47/199 (23%)

Query: 110 YIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL------YNW 161
           YID+L IH  +P    +E   T +AL +    G  R IG S+     L EL      YNW
Sbjct: 142 YIDVLQIHRFDPNTPVKE---TMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNW 198

Query: 162 -EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTR------------ 203
            + + V+   N          +E+  + ++  ++L  +SP     LTR            
Sbjct: 199 FQFVNVQSCYNLIYRED---EREIIPFAKRHNLMLTPWSPNHGGLLTRPVGVESARSSTD 255

Query: 204 ------GQKFSDP-------QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQ 250
                 G K   P       +++EL K    N + A I   W +  G  P+   S+  R 
Sbjct: 256 IILNDWGMKHLKPWEITIVNRIEELAKKK--NVSMAVISAAWVISKGCAPIIGMSSIARV 313

Query: 251 ISNLQALDFEISDKDMKAL 269
             N++ALD + ++++MK L
Sbjct: 314 DDNIKALDVQFTNEEMKYL 332

>SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON}
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 139/336 (41%), Gaps = 81/336 (24%)

Query: 1   MNLTPSTTKTLTNGVKIPVLALGV--YEAPKE-----ETEHTVFTALK----SGYRHVDC 49
           +NL PS       G+KI  + +G   Y + K      E +  +F  LK    +G R  D 
Sbjct: 7   VNLGPS-------GLKISSIIVGCTSYGSKKWTPWVIEDKEEIFKILKHCYDNGLRTFDT 59

Query: 50  AQLYGN---EREVGLGIAKF----------------LKETPNVSRSEIFYTTKVSG---D 87
           A +Y N   ER +G  + ++                + E+  +  S I+ T +V+     
Sbjct: 60  ADVYSNGLSERLLGEFLKRYKINRETVVILSKVRFPVDESLELPLSTIYGTDEVTALTLA 119

Query: 88  NHGYEKAKK---SIIKSLEDVKEIEYIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKV 142
           N G    K     + KS+E +    YID+L IH     T  EE   T KAL +   +G  
Sbjct: 120 NQGGLSRKHIMDGVAKSVERLGT--YIDVLQIHRFDHETPMEE---TMKALNDVVEKGYT 174

Query: 143 RAIGVSNYSIKHLEEL------YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLE 196
           R IG S+       EL      ++W   K     + + L      +EL  + ++  + L 
Sbjct: 175 RYIGASSMLATEFAELQFVAEKHSW--FKFISSQSCYNLLYREDERELIPFAKRHRIGLI 232

Query: 197 AFSPLTRG-----------QKFSDPQL-------QELIK-----TSYPNQTPAQILIRWS 233
            +SP +RG           +  +D +L       QE+I+         + T A +   W 
Sbjct: 233 PWSPNSRGLLTRPLGLTTARYEADSRLHNIAPDEQEIIRRVEEVAKKRDTTMAIVSTAWV 292

Query: 234 LQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           L  G  P+   S+++R    L+A+DFE+++++ K L
Sbjct: 293 LSKGCYPIVGLSSTERVDEALKAIDFELTEEESKYL 328

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 125/302 (41%), Gaps = 70/302 (23%)

Query: 29  KEETEHTVFTALKSGYRHVDCAQLYGN-EREVGLGIAKFLKETPNVSRSEIFYTTKV--- 84
           KEE    +  A   G R  D A +Y N   E  LG  +FL+ T N+ R  +   TKV   
Sbjct: 39  KEEIFGILKHAYDRGLRTYDTADVYSNGMSETILG--EFLR-TYNIPRETVVIMTKVFFP 95

Query: 85  -------SGDNHGYEK-----------AKKSIIKSLED-VKEI-EYIDLLLIHNPIAAT- 123
                  S +    E+           ++K I+ ++++ VK +  YID+  IH     T 
Sbjct: 96  VDDKMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLGTYIDVYQIHRCDHETP 155

Query: 124 -EERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQFELN 176
            EE   T +AL +   +G VR +G S+        ++ + E + W   K   M + + L 
Sbjct: 156 FEE---TMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWH--KFVNMQSCYNLV 210

Query: 177 PWLTRKELCEYCEKKGMVLEAFSPLTRG------------------------QKFSDPQL 212
                +E+  +C++ G+ L  +SP+ +G                         +F++ + 
Sbjct: 211 YREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIARKLNQFTESE- 269

Query: 213 QELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMK 267
           +E+I          N     I + W +Q G +P+   S+ +R    ++ L  ++++ DM 
Sbjct: 270 KEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLTTKLTEDDMY 329

Query: 268 AL 269
            L
Sbjct: 330 YL 331

>Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {ON}
           YDL124W - Hypothetical ORF [contig 219] FULL
          Length = 313

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 111/256 (43%), Gaps = 41/256 (16%)

Query: 34  HTVFTALKS-GYRHVDCAQLY-GNEREVGLGIAKFLKETPNVSRSEIFYT-TKVSGDNHG 90
           H     LK  G   +D A++Y G+E  +G            +   E F   TK  G   G
Sbjct: 23  HKYLDVLKEHGVDELDTARIYEGSEEALG-----------ELRAPETFVIDTKARGFAEG 71

Query: 91  YEKAKKSIIKSLED---VKEIEYIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVRAI 145
               + SI +S+++   + ++E +++  +H+P  AT  EE L T  +L   Y +GK +  
Sbjct: 72  -SLTRDSINQSIDESFRLLKVESVNIFYLHSPDPATLLEETLDTINSL---YVKGKFKKF 127

Query: 146 GVSNYSIKHLEELYNW--EGLKVEPMVNQFELNPWLTRKE--LCEYCEKKGMVLEAFSPL 201
           G+SNY  + + ++Y++  E   V P V Q   N +  + E  L     +  +   A+SP+
Sbjct: 128 GLSNYKPEDVRKVYSYCKEKGYVLPTVYQGNYNAFARKAESTLFPVLRELEIAFYAYSPI 187

Query: 202 TRGQKFSDP-QLQE----LIKTSYPNQ-------TPAQI--LIRWSLQMGFIPLPKSSNS 247
             G     P Q+ E      KT +  Q        P+ I  L RW+       + ++S +
Sbjct: 188 AGGFLAKTPEQILEGQGRFDKTKFVGQLYLALYDKPSLIEGLGRWAKLAEKAGISRASLA 247

Query: 248 KRQISNLQALDFEISD 263
            R I++   +D    D
Sbjct: 248 YRWIAHSSGIDGNFGD 263

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 121/301 (40%), Gaps = 66/301 (21%)

Query: 30  EETEHTVFTALK----SGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKV- 84
           E+ +  +F  LK     G R  D A +Y N     L + +FLK   N+ R  +   +K+ 
Sbjct: 36  EDDKTKIFGILKHCYDRGMRTFDTANVYSNGLSETL-LGEFLKHY-NIPRETVVIMSKLN 93

Query: 85  --SGDNHGYEK------------------AKKSIIKSL-EDVKEI-EYIDLLLIHNPIAA 122
             + D   +E                   ++K+I+ S  E V+ +  YID+L IH     
Sbjct: 94  FATDDKVSFETLKERSEELNLHFVNMSGLSRKNIMASAKESVRRLGTYIDVLQIHRADRD 153

Query: 123 T--EERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL-YNWEGLKVEPMVNQFELNPWL 179
           T  EE   T +AL +    G  R IG S+       E+ +  E       +N       L
Sbjct: 154 TPYEE---TMRALNDLVESGITRYIGASSMLATEFAEMQFTAEKYGWFKFINSQSCYNLL 210

Query: 180 TR---KELCEYCEKKGMVLEAFSPLTRG-----------QKFSDPQLQ------------ 213
            R   +EL  + ++  + L  +SPL RG           +  SD QL+            
Sbjct: 211 YREDERELMPFAKRHNIALTPWSPLQRGLLTRPVGIKTTRYDSDRQLEIRKMKNLKDSEI 270

Query: 214 ELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKA 268
           E+I       +  N T A I + W +  G  P+   S+  R    ++ALD + ++++++ 
Sbjct: 271 EIINRVEKLANDKNVTMAVIGLAWVIAKGCTPIAGLSSIARVDEAIKALDIKFTEEELQY 330

Query: 269 L 269
           L
Sbjct: 331 L 331

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 82/173 (47%), Gaps = 22/173 (12%)

Query: 41  KSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIK 100
           K+G + +D A++Y +  ++   I +   + PN  R  I   TK SG + G    K +I K
Sbjct: 31  KAGVKDIDTARIYPDSEKI---IGEL--QLPN--RFTIH--TKASGFSGGC-LTKDNINK 80

Query: 101 SLED---VKEIEYIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVRAIGVSNYSIKHL 155
           S+E+   +  +  ++   +H+P   T  EE LG   A+   Y +GK +  G+SN++ + +
Sbjct: 81  SIEESLSLLGVPSVETFFLHSPDPETPIEETLG---AINSLYEQGKFKKFGLSNFATEDV 137

Query: 156 EELYNWEGLK--VEPMVNQFELNPW--LTRKELCEYCEKKGMVLEAFSPLTRG 204
           + +Y +   K  V P V Q   N +      +L     +      A+SP+  G
Sbjct: 138 KRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHFSFYAYSPIAGG 190

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
           {ON} 
          Length = 344

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 118/304 (38%), Gaps = 74/304 (24%)

Query: 31  ETEHTVFTALKSGYRH----VDCAQLYGNEREVGLGIAKFLKETPNVSR------SEIFY 80
           E +  +F+ LK  Y H     D A +Y N    G  + +FLK+  N+ R      +++FY
Sbjct: 40  EDKEKIFSILKHCYDHGLRTFDTADVYSNGAS-GRLVGEFLKKY-NIDRETVVILTKLFY 97

Query: 81  TTKVSGD---------------NHGYEKAKKSIIKSLEDVKEI--EYIDLLLIHNPIAAT 123
               S D                H    ++K II   +   E    YID+L IH     T
Sbjct: 98  PVDESLDLKHGGTFDEEEKLQLTHHRGLSRKHIIAGAKASMERLGTYIDVLQIHRFDDET 157

Query: 124 --EERLGTWKALQEAYAEGKVRAIGVSNYS------IKHLEELYNWEGLKVEPMVNQFEL 175
             EE   T +AL     +G  R IG S         ++ + E + W   K     + + L
Sbjct: 158 PMEE---TMRALNYVVDQGFTRYIGASTMRATEFAEMQFIAEKHGW--YKFISSQSSYNL 212

Query: 176 NPWLTRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDP-------------- 210
                 +EL  + ++ G+ L  +SP  RG           +  SDP              
Sbjct: 213 LYREDERELIPFAQRHGVGLIPWSPNARGVLTRPSNQTSERIKSDPTYSRLGWNALRANQ 272

Query: 211 -----QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKD 265
                +++E+ KT     + A I I W L  G  P+   ++ +R    LQALD  ++D++
Sbjct: 273 KEIVDRVEEIAKTK--GVSMAVISIAWVLSKGAYPIVGLNSIERVNEALQALDVRLTDEE 330

Query: 266 MKAL 269
              L
Sbjct: 331 TTYL 334

>NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {ON}
           
          Length = 345

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 124/298 (41%), Gaps = 64/298 (21%)

Query: 30  EETEHTVFTALKS----GYRHVDCAQLYGN-EREVGLGIAKFLKETPNVSRSEIFYTTKV 84
           E+ +  VF  LK     G R  D A +Y N + EV LG  +FLK+  N+ R  +   TK+
Sbjct: 37  EDNKEKVFALLKHCYDVGLRTFDTADVYNNGQSEVLLG--EFLKKY-NIRRETVVILTKI 93

Query: 85  SGDNHGYEK----------------------AKKSIIKSLED-VKEI-EYIDLLLIHNPI 120
             D+    +                      ++K II+ +++ V+ +  YID+L IH  +
Sbjct: 94  YFDSDDSMEVGSNFASINESTKLDLVNQRGLSRKHIIQGVKNSVRRLGTYIDVLQIHR-L 152

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQFE 174
                     K+L +    G VR IG S+        ++ + + ++W   +     +Q+ 
Sbjct: 153 DDNVPMKSIMKSLNDVVLSGDVRYIGASSMLATEFADLQAIADKHDW--FQFVNWQSQYN 210

Query: 175 LNPWLTRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDPQL-------QELI 216
           L      +E+  Y ++  + +  +SP  RG           +K  DP+L       +E+I
Sbjct: 211 LLYREDEREVIPYAKRHNIAVTPWSPNARGLLAKPANVTSERKNFDPRLASISDDDKEII 270

Query: 217 K-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
                     + + A +   W L   F+P+   S  +R    ++A+   ++ +++K L
Sbjct: 271 GRVEKIAKDKDISMAMVSTAWVLSKRFLPIVGMSKMERIDEAVKAIKVTLTQEEIKYL 328

>SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 22/202 (10%)

Query: 12  TNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGN-EREVG-LGI-AKFLK 68
            N VKI   A  +   PK++    +    K   + +D A++Y + E+ +G L + AK+  
Sbjct: 3   NNRVKIIYGAYPIPFIPKDQLSEVLHVLEKYNVKDLDTARVYPDGEKSIGKLNLPAKYTI 62

Query: 69  ETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIH--NPIAATEER 126
            T  V+    F    +S D+       +SI +SL  +K  + ++   +H  +P    EE 
Sbjct: 63  HTKAVT----FQDGALSKDS-----IVESIGESLSLLK-TDKVETFYLHCPDPTTPIEE- 111

Query: 127 LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLK--VEPMVNQFELNPWLTR--K 182
             T KA+ E Y EGK    G+SNY    + ++Y +   K  V P V Q   N    +  K
Sbjct: 112 --TLKAINELYKEGKFVHFGLSNYPANDVRKIYEYADSKGYVLPTVYQGNYNAVSRKIEK 169

Query: 183 ELCEYCEKKGMVLEAFSPLTRG 204
           +L     +  +   A+SP+  G
Sbjct: 170 DLFPVLRELKIAFYAYSPIAGG 191

>AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR127W
          Length = 341

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 97/239 (40%), Gaps = 29/239 (12%)

Query: 31  ETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHG 90
           E      +  K G    +C + YG +      +  F +  P  +R  +    K + DN  
Sbjct: 38  ECMRKAISCCKQGKILFNCGEFYGGDFLNLHYVRDFFRLHP--ARERVILCVKGAVDNAT 95

Query: 91  YEKAKK--SIIKSLED-VKEIE-YIDLLLI--HNPIAATEERL---GTWKALQEAYAEGK 141
            +      S+ KS+++ ++EI  YID+      +P A     L    + +A+ E    GK
Sbjct: 96  LQPVGDPVSVRKSMDNCLREIGGYIDIFECARFDPKAVAPGELYPRASIEAVVEYVKAGK 155

Query: 142 VRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFE-LNPWLTRKELCEYCEKKGMVLEAFSP 200
           + AIG+S  + + +  +    G  +  +  +F  L+  +    L + C + G+ +  +SP
Sbjct: 156 IGAIGLSEVTAEQVRAISRDYGEYLACVEVEFSMLSRDILHNGLAQTCAELGIPILCYSP 215

Query: 201 LTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDF 259
           L RG       L   I T  P+  PA  L R   + G   L          +NLQA  F
Sbjct: 216 LARG------LLTNAIST--PDDVPAGDLRRLLARFGHDALA---------NNLQAATF 257

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 15/126 (11%)

Query: 39  ALKSGYRHVDCAQLYG-NEREVGLGIAKFLKETPNVSRSEIFYTTKV-----SGDNHGYE 92
           A+  G   +D +  YG +E   G  + +   E P   R E F  TKV     +  N+  E
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFP---REEYFICTKVGRVGRAEFNYSKE 106

Query: 93  KAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGTWKALQEAYA---EGKVRAIGVSN 149
             + S+ +S E +   +Y+DL+ +H+      +++  W+AL+E      EG +R IG+S 
Sbjct: 107 NVRFSVKRSCERL-HTDYLDLVYLHDIEYVEYDKI--WEALRELRKLKDEGVIRHIGISG 163

Query: 150 YSIKHL 155
           Y +  L
Sbjct: 164 YPVDLL 169

>CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 344

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 121/300 (40%), Gaps = 66/300 (22%)

Query: 31  ETEHTVFTALKSGY----RHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFYTT 82
           E +  +F  LK  Y    R  D A +Y N   ER +     K+ +K    V  S++FY  
Sbjct: 39  EDKEKIFGILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAV 98

Query: 83  KVSGD-NHGYE--------------KAKKSIIKSLEDVKEI--EYIDLLLIHNPIAATEE 125
               D +HG +               +++ I++++++  E    YID+L IH     T  
Sbjct: 99  DEDLDLHHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGTYIDVLQIHRLDKETPM 158

Query: 126 RLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQFELNPWL 179
           +    KAL +    G  R IG S+        ++ + E +NW   +   + + + L    
Sbjct: 159 K-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSFYNLLNRE 215

Query: 180 TRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDP------------------ 210
             +E+  + ++  + L  +SP  RG           +  SDP                  
Sbjct: 216 DEREIIPFAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEII 275

Query: 211 -QLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
            +++E+ K    N + A I   W L  G  P+   ++  R    + ++DFE+ ++D+K L
Sbjct: 276 NRVEEVAKKH--NTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYL 333

>TDEL0B06970 Chr2 complement(1232117..1233133) [1017 bp, 338 aa]
           {ON} Anc_2.604 YMR041C
          Length = 338

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 17/128 (13%)

Query: 39  ALKSGYRHVDCAQLYG-NEREVGLGIAKFLKETPNVSRSEIFYTTKVSG---DNHGYEK- 93
           A   G   +D +  YG +E   G  +    +E P   R   F  TKV     D   Y K 
Sbjct: 49  AFSHGITAIDTSPYYGPSELIYGNALDALKQEFP---RETYFICTKVGRVRLDEFDYSKE 105

Query: 94  -AKKSIIKSLEDVKEIEYIDLLLIHN----PIAATEERLGTWKALQEAYAEGKVRAIGVS 148
             + S+++S + ++   Y+DL+ +H+    P+  T E L   +AL+   AEG ++  G+S
Sbjct: 106 HVRFSVLRSCQRLR-TSYLDLVYLHDIEFVPLQNTLEALRELRALK---AEGIIKNFGLS 161

Query: 149 NYSIKHLE 156
            Y + +L+
Sbjct: 162 GYPVDYLK 169

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 137/333 (41%), Gaps = 73/333 (21%)

Query: 5   PSTTKTLTNGVKI-PVLALGVYEAPKEETE------HTVFTALK----SGYRHVDCAQLY 53
           P   +   +G+KI P+L   +    K+  E        +F  LK    SG R  D A +Y
Sbjct: 6   PKPVRLGNSGLKISPILVGCMSYGSKDWAEWVIDEKEKIFEILKHCYDSGMRTFDTADVY 65

Query: 54  GN---EREVGLGIAKF-LKETPNVSRSEIFY----------TTKVS-GDNHGYEK----A 94
            N   ER +G  +  + +K    V  ++++Y          + K+S  D  G       +
Sbjct: 66  SNGLSERILGEFLKHYKIKRETVVILTKVYYPVDESLKLTHSAKISESDMLGLVNQTGLS 125

Query: 95  KKSIIKSLEDVKEI--EYIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVRAIGVSNY 150
           +K I+++ ++  E    YID+L IH     T  EE +   KAL +    G  R IG S+ 
Sbjct: 126 RKHILEAAKNSVERLGTYIDVLQIHRLDHDTPMEEIM---KALNDVVGLGYTRYIGASSM 182

Query: 151 ------SIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG 204
                  ++ + E ++W         + + L      +EL  + +K G+ L  +SP  RG
Sbjct: 183 LATEFAELQFIAEKHDWTKFICSQ--SCYSLLYREDERELIPFAKKHGIGLIPWSPNARG 240

Query: 205 -----------QKFSDPQLQELIKTSYPNQ-----------------TPAQILIRWSLQM 236
                      +K SDP L+ L      +                  + A + I W L  
Sbjct: 241 VLTRPLNQETDRKISDPTLKRLKFDCLESHEKRIVNRVEEVAKKKGISMAMVSIAWVLSK 300

Query: 237 GFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           G  P+   ++ +R    ++A+D ++++++++ L
Sbjct: 301 GACPIVGLNSIERVDEAIRAVDVQLTEEEIQYL 333

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 39  ALKSGYRHVDCAQLYGN-EREVGLGIAKFLKETPNVSRSEIFYTTKVSG---DNHGYEKA 94
           A++ G R +D +  YG+ E   G  +    +E P   R   F  TKV     +   Y ++
Sbjct: 52  AMQFGVRAIDTSPYYGDSEVLYGAALESLKEELP---RENYFICTKVGRIRLEEFDYSRS 108

Query: 95  KK--SIIKSLEDVKEIEYIDLLLIHN-PIAATEERLGTWKALQEAYAEGKVRAIGVSNYS 151
               S+++S E +K  +Y+D++ +H+     TE+ L   + L++   EG +   G+S Y 
Sbjct: 109 HIHFSVLRSCERLK-TKYLDVVFLHDVEFVETEQVLEALQELRKLRDEGVILNFGISGYP 167

Query: 152 IKHL 155
           +  L
Sbjct: 168 VDFL 171

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 133/331 (40%), Gaps = 86/331 (25%)

Query: 14  GVKIPVLALGVYE------AP-KEETEHTVFTALK----SGYRHVDCAQLYGN---EREV 59
           G+KI  + +G         AP  ++ +  VFT LK     G R  D A +Y N   ER +
Sbjct: 14  GIKISPIIVGCMSYGSKEWAPWVQDDKEKVFTILKHCYDRGLRTFDTADVYSNGYSERLL 73

Query: 60  GLGIAKFLKETPNVSRSEIFYTTKVSG-----------DNHGYEK-----------AKKS 97
           G    +FLK+  N+ R  +   TK+             D    E            ++K 
Sbjct: 74  G----EFLKKY-NIRRETVVILTKLFAPVDESLKFKFADPSTSENILLDLTNQQGLSRKH 128

Query: 98  IIKSLEDVKEI--EYIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNY--- 150
           I++++++  E    YID+L IH  +P    +E   T K L +    G VR IG S+    
Sbjct: 129 IMQAVKNSVERLGTYIDVLQIHRFDPNTPIKE---TMKGLNDVIEGGDVRYIGASSMLPT 185

Query: 151 ---SIKHLEELYNW-EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----L 201
               ++ + + ++W + + V+   N   L      ++L +YC+K  + L  +SP     L
Sbjct: 186 QFVEMQGIADKHDWFQFVNVQSCYN---LVYREDERDLFQYCKKHNIALTPWSPNHQGLL 242

Query: 202 TR------------------GQKFSDPQLQELI----KTSYPNQTPAQIL-IRWSLQMGF 238
           TR                    K  DP   E+I    + S     P  +L   W L    
Sbjct: 243 TRPVGVESTRSSKDTFINATKMKEMDPAEVEIINRIEELSKKKNVPMAVLSTAWVLSKQC 302

Query: 239 IPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
            P+   S+  R    + ALD   +++++K L
Sbjct: 303 SPIVGMSSINRVDEAITALDVTFTEEEIKYL 333

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 86/199 (43%), Gaps = 47/199 (23%)

Query: 110 YIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVRAIGVSNYS------IKHLEELYNW 161
           Y+D+L IH     T  EE   T +AL +    G  + IG S         ++ + E ++W
Sbjct: 143 YMDVLQIHRCDRETPFEE---TMRALNDVVNAGYTKYIGASLMRATEFAEMQFIAEKHDW 199

Query: 162 EGLKVEPMVNQFELNPWLTR---KELCEYCEKKGMVLEAFSPLTRG-------------- 204
                   VN   L+  + R   +EL  + +K G+ L  +SPL +G              
Sbjct: 200 HKF-----VNVQSLHNLIYREDERELIPFTKKHGIALTPYSPLQKGYLAKPYGTKTVRNT 254

Query: 205 ------------QKFSDPQLQELIKTSYPNQ--TPAQILIRWSLQMGFIPLPKSSNSKRQ 250
                        + SD ++   ++    ++  + A++ + W +Q G  P+   S+++R 
Sbjct: 255 TDKHMLRIKIDNMRDSDKEIISRVEKVSKDKKVSMAEVSLAWLIQQGCNPIVGVSSTERV 314

Query: 251 ISNLQALDFEISDKDMKAL 269
              ++ALD ++++++ K L
Sbjct: 315 DEAIRALDVKLTEEETKFL 333

>CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {ON}
           similar to uniprot|Q04212 Saccharomyces cerevisiae
           YMR041c
          Length = 336

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 64/133 (48%), Gaps = 13/133 (9%)

Query: 39  ALKSGYRHVDCAQLYGNEREVGLGIAKFLKETPN-----VSRSEIFYTTKVSGD-----N 88
           A  +G   +D +  YG   E+  G A    ++P+      +R + +  TKV        +
Sbjct: 41  AFTNGINAIDTSPYYG-PSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKLEEFD 99

Query: 89  HGYEKAKKSIIKSLEDVKEIEYIDLLLIHN-PIAATEERLGTWKALQEAYAEGKVRAIGV 147
           +  +  + S+++S E + + +Y+DL+ +H+       + +   K L++   EG +R  G+
Sbjct: 100 YSPKAVRASVLRSCERL-DTDYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVIRHFGL 158

Query: 148 SNYSIKHLEELYN 160
           S Y +K+L  L N
Sbjct: 159 SGYPVKYLAFLCN 171

>Suva_16.454 Chr16 (792236..793273) [1038 bp, 345 aa] {ON} YPR127W
           (REAL)
          Length = 345

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 81/197 (41%), Gaps = 52/197 (26%)

Query: 129 TWKALQEAYAEGKVRAIGVSNYSIKHLEELY-NWEGL--KVEPMVNQFELNPWLTRKELC 185
           +++AL E  +EG +  I +S  + + +  +Y +W      VE  V+ F  +  + R  + 
Sbjct: 144 SFEALAEMISEGVIGGISLSEVTEEQIRAIYKDWGKFLTCVELEVSLFSTD--IFRNGIA 201

Query: 186 EYCEKKGMVLEAFSPLTRG---------------------QKFSDPQL-----------Q 213
           + C + G+ +  +SPL RG                     ++FSD  L           +
Sbjct: 202 KTCAELGLTVICYSPLGRGLLTGQLKSNADIPEGDFRKTLKRFSDESLKKNLALVRFLQE 261

Query: 214 ELI-KTSYPNQ-TPAQILIRWSLQMGF---------IPLPKSSNSKRQISNLQALDFEIS 262
           E+I K S  N  T  Q+ + W     F         IP+P  S+  +   N      +++
Sbjct: 262 EIIGKRSKDNSITLPQLALGWIKHWNFAPEYKGAKFIPIPSGSSISKVNENFDEKKTQLT 321

Query: 263 DKDMKALTHDDTYFLAT 279
           DK+ KA+      FLAT
Sbjct: 322 DKEFKAIND----FLAT 334

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 118/307 (38%), Gaps = 80/307 (26%)

Query: 29  KEETEHTVFTALKSGYRHVDCAQLYGN---EREVGLGIAKFLKETPNVSRSEIFYTTKVS 85
           KEE    +  A   G R  D A +Y N   ER +G    +FL+   N++R  +   TKV 
Sbjct: 76  KEEVFKILKRAYDRGLRTYDTADVYSNGLSERILG----EFLRHY-NINRETVVILTKV- 129

Query: 86  GDNHGYEKAKKSI-IKSLEDVKEIEYIDLL--------LIHNPIAATEERLGTW------ 130
                +    +SI + S  D  E E + L          I   + A+ ERLGT+      
Sbjct: 130 -----FFPTDESIHVTSKFDFSEQELLTLTNQRGLSRKHILAGVKASIERLGTYIDVLQI 184

Query: 131 -------------KALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVN 171
                        +AL +   +G VR IG S+        +  + E ++W   K     +
Sbjct: 185 HRLDHETPMEEIMRALNDVVTQGDVRYIGASSMLATEFAELNFIAERHDW--FKFVSSQS 242

Query: 172 QFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG------------------------QKF 207
            + L      +EL  + ++ G+ L  +SPL+ G                           
Sbjct: 243 YYSLLYREDERELIPFAKRHGIALIPWSPLSGGALTRPLGGTSNRSQTDNFKGILGVDNL 302

Query: 208 SDPQLQELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEIS 262
            D + +E++       +   Q+ A +   W L  G  P+   ++ KR    L AL+ ++S
Sbjct: 303 KDNE-KEIVNRLEKVANEKGQSMAAVATAWVLHKGCNPIIGFNSIKRVDQALDALEVKLS 361

Query: 263 DKDMKAL 269
           ++++  L
Sbjct: 362 EQEISYL 368

>TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {ON}
           Anc_3.393 YBR130C
          Length = 426

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 24/110 (21%)

Query: 124 EERLGTWKALQEAYAEG----------KVRAIGVSNYSIKHLEE--LYNWEGLKVEPMVN 171
           +E+LG+ K  Q +  E           K+    V + +I+ LE+  L + EG K + MVN
Sbjct: 211 KEQLGSLKKEQHSQLERHSADMDLLSEKLSEFDVKSDNIQQLEKDRLTHLEG-KCDDMVN 269

Query: 172 QFELNPWL-----TRKELCEYCEKKGMVL-EAFSPLTRGQKFSDPQLQEL 215
           Q +LN W+     + + L +Y EK  + L + F  LT+     DP L  L
Sbjct: 270 QLDLNAWVNLYKESARTLLDYAEKMNITLPQQFHQLTQ-----DPDLAAL 314

>CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 346

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 117/299 (39%), Gaps = 63/299 (21%)

Query: 31  ETEHTVFTALKSGY----RHVDCAQLYGN---EREVGLGIAKF-LKETPNVSRSEIFYTT 82
           E +  +F  LK  Y    R  D A +Y N   ER +     K+ +K    V  +++F+  
Sbjct: 40  EDKEKIFGILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKYQIKRETVVIMTKVFFGV 99

Query: 83  KVSGDNHGYEKA----------------KKSIIKSLEDVKEI--EYIDLLLIHNPIAATE 124
               + H   KA                +K I++ +++  E    YID+L IH     T 
Sbjct: 100 DEDLNLHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHRLDKETP 159

Query: 125 ERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVEPMVNQFELNPW 178
            +    KAL +    G  R IG S+        ++ + E +NW   +   + + + L   
Sbjct: 160 MK-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSFYNLLNR 216

Query: 179 LTRKELCEYCEKKGMVLEAFSPLTRG-----------QKFSDPQLQ------------EL 215
              +E+  + ++  + L  +SP  RG           +  SDP  +            E+
Sbjct: 217 EDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLTEDQKEI 276

Query: 216 IK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
           I          N + A I   W L  G  P+   ++  R    + ++DFE+SD+D+K +
Sbjct: 277 INRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYI 335

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 110/311 (35%), Gaps = 77/311 (24%)

Query: 4   TPSTTKTLTNGVKIPVLA--LGVYEAPKEETEHTVFTALKSGYRHVDCAQL------YGN 55
           T  T     NG+   +L   L  Y  P+E    TV    K  YR  D  +L      +GN
Sbjct: 56  TFDTADAYANGLSETILGSFLKHYNIPRE----TVVIMTKVFYRVDDTIELNPTDLLFGN 111

Query: 56  EREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLL 115
             E+ L +         +SR  I    K S    G                   YID+  
Sbjct: 112 NEELNLRLVN----QKGLSRKHILEAAKNSVRRLG------------------TYIDVYQ 149

Query: 116 IHNPIAAT--EERLGTWKALQEAYAEGKVRAIGVSNY------SIKHLEELYNWEGLKVE 167
           IH     T  EE   T +AL +   +G  R IG S+         + + E + W   K  
Sbjct: 150 IHRCDHETPFEE---TMRALNDVVEQGYARYIGASSMLGTEFAEYQFIAEKHGWH--KFV 204

Query: 168 PMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG----------------------- 204
            M   + L      +E+  +C+K  + +  +SPL  G                       
Sbjct: 205 NMQTCYNLLYREDEREMLPFCKKNNVAITPWSPLQMGFLARPITEKSVRQTTDLVIKAMS 264

Query: 205 -QKFSDPQLQELIK-----TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALD 258
             KFS+   +E+I       +  N   A + + W  +    P+   +   R    L+AL 
Sbjct: 265 LDKFSEAD-KEIIDRVNKLANKKNLKMATVTLAWLFKKNAFPIVGLNKESRIDDALEALK 323

Query: 259 FEISDKDMKAL 269
            E++++++K L
Sbjct: 324 VELTEEEVKYL 334

>NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 80/195 (41%), Gaps = 49/195 (25%)

Query: 110 YIDLLLIHNPIAAT--EERLGTWKALQEAYAEGKVRAIGVSNY------------SIKHL 155
           YID+L IH   A T  EE   T +AL +    G+VR +G S               +   
Sbjct: 142 YIDVLQIHRFDAETPMEE---TMRALNDVVELGQVRYLGASRMLGTQFAEYQFVAQLNGW 198

Query: 156 EELYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTR--GQ--- 205
            +  NW+        +Q+ L      +E+  + ++  + L  F P     L R  GQ   
Sbjct: 199 HQFINWQ--------SQYNLLYREDEREVIPFAKRHNIALTPFYPNAGGLLARPLGQVSA 250

Query: 206 --KFSDPQLQELIK------------TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQI 251
             K  DP++++L              +     + AQI + W L  G  P+   ++ +R  
Sbjct: 251 RTKSDDPKVKKLTARDKEIINRVEQLSVEKGVSMAQISLAWLLHKGCYPIVGVNSIQRAQ 310

Query: 252 SNLQALDFEISDKDM 266
            ++ AL  ++S++D+
Sbjct: 311 ESIDALSLQLSEQDL 325

>Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 83/212 (39%), Gaps = 39/212 (18%)

Query: 94  AKKSIIKSLEDVKEI--EYIDLLLIHNPIAATEERLGTWKALQEAYAEGKVRAIGVSNYS 151
           ++K II  +++  E    YIDLL IH     T  +    +AL +    G VR IG S+  
Sbjct: 123 SRKHIIAGVKNSVERLGTYIDLLQIHRLDHDTPMK-EIMRALNDVVEAGDVRYIGASSML 181

Query: 152 IKHLEEL------YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRG- 204
                EL      Y W   +     + + L      +EL  + ++  + L  +SP  RG 
Sbjct: 182 ATEFAELQFIADKYGW--FQFISSQSYYNLLNREDERELIPFAKRHNIGLLPWSPNARGV 239

Query: 205 ----------QKFSDPQLQELIKTSY-----------------PNQTPAQILIRWSLQMG 237
                     ++ SDP  + L   +                   N + A I I W L  G
Sbjct: 240 LTRPLDKTTDRQKSDPTFKSLKLDALEDDQMEIVNRVEKISKEKNVSMAMISIAWVLHKG 299

Query: 238 FIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269
             P+   +++ R    + AL   ++++D+K L
Sbjct: 300 CHPIVGLNSTSRVDEAIAALQLTLTEEDVKYL 331

>Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {ON}
           YJR137C (ECM17) - Putative sulfite reductase [contig
           376] FULL
          Length = 1430

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120
           L  A+FL +  + S S I+YTT     + G+  A    +KS +D +  +   LL   +P 
Sbjct: 4   LSSAQFLADVASASESTIYYTTDAKSLDSGFSSA----LKSKQDTRSTQ---LLNSTDPF 56

Query: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWE-GLKVEPMVNQFELNPWL 179
           AA  E LG  K       E  +        S+ HL  L N+   + VE   N++ + P L
Sbjct: 57  AAVVESLGKEKVTTVFTNETTLVN------SLPHLYSLKNYPVVINVELASNEYSVIPLL 110

>Kpol_1018.155 s1018 (401514..401861) [348 bp, 115 aa] {ON}
           (401514..401861) [348 nt, 116 aa]
          Length = 115

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 184 LCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQM-----GF 238
           LC   ++   ++ ++S L RG     PQ +E +K  Y N   A   +R  +Q+     G 
Sbjct: 20  LCSLLQETSQIVNSYSELKRGNSTVKPQFEEHLKEFYLNLDVATTNLRKEIQLLDENIGT 79

Query: 239 IPLPKSSNSK 248
             LP + N K
Sbjct: 80  RLLPINVNKK 89

>NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 83/202 (41%), Gaps = 43/202 (21%)

Query: 110 YIDLLLIH--NPIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY------NW 161
           Y+D+L IH  +   + EE +   ++L +    G+VR IG S+       EL        W
Sbjct: 143 YVDVLQIHRLDHETSMEEIM---RSLNDVILSGQVRYIGASSMRATEFAELQFIAEKNGW 199

Query: 162 EGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSP-----LTRGQKFSDP--QLQE 214
              K     + + L      +EL  + +K G+ L  +SP     LTR    S P  +   
Sbjct: 200 --FKFVSSQSYYNLLNREDERELIPFAKKHGIGLVPWSPNARGILTRPLDESTPTGRSDN 257

Query: 215 LIKTSYPNQ---------------------TPAQILIRWSLQMGFIPLPKSSNSKRQISN 253
           ++K  + N                      + A + I WS++ G  P+   S+  R    
Sbjct: 258 IVKKLHLNALMEDEKEIVKRVQKIAQKKSVSMAMVSIAWSIKKGCNPIVGLSSISRAAEA 317

Query: 254 LQALDFEISDKDMKALTHDDTY 275
           + ALD  ++++++  L  ++TY
Sbjct: 318 IGALDVHLTEEEVTYL--EETY 337

>TBLA0B08920 Chr2 (2116179..2117213) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 49/261 (18%), Positives = 101/261 (38%), Gaps = 60/261 (22%)

Query: 48  DCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKK--SIIKSLE-- 103
           +  + YG  R     I +F  + P++ RS I  + K   D   +    K   ++KS++  
Sbjct: 58  NAGEFYGPNRVNLQLIKEFFAKYPDL-RSCIIISVKGGLDMEKFVAQGKYDDVLKSIKNC 116

Query: 104 --------DVKEIEYIDLLLIHNPIAATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHL 155
                   D+ E+  ID  +I    +  +E   T+ AL +      + AI +S  ++  +
Sbjct: 117 YDAMGGYIDIFEVARIDATIIPEGSSYPKE---TFDALVKGIENEWIGAISLSEVTLPQI 173

Query: 156 EELYNWEGLKVEPMVNQFELNPWLTR---KELCEYCEKKGMVLEAFSPLTRG-------- 204
           ++++  +G     +  + E + + T+         C+  G+++  +SPL RG        
Sbjct: 174 KDIH--QGFAKYLVCVELEFSLFSTQIMDDGTVALCDSLGLIIICYSPLGRGLLSEQVKD 231

Query: 205 -------------QKFSDPQLQ-----------ELIKTSYPNQTPAQILIRWSLQMG--- 237
                        ++F+ P  +           +++K   P  +  Q+ + W  Q     
Sbjct: 232 GSTLPDGDIRKNMKRFNGPAYEKNMELVHFLKNDILKDRSPQISTVQLALAWIKQWNSVY 291

Query: 238 ----FIPLPKSSNSKRQISNL 254
               FIP+P  S  ++   N 
Sbjct: 292 NNCKFIPIPSGSTVEKVTENF 312

>KAFR0A02340 Chr1 complement(485299..486288) [990 bp, 329 aa] {ON}
           Anc_2.604 YMR041C
          Length = 329

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 16/144 (11%)

Query: 39  ALKSGYRHVDCAQLYG-NEREVGLGIAKFLKETPNVSRSEIFYTT-KVSGDNHGY--EKA 94
           A   G   +D +  YG +E  VG  +AK     P  S  +I     +++ +   Y  E  
Sbjct: 33  AFGDGINVIDTSPYYGPSEILVGEALAKI---KPRRSTFQICTKAGRITENEFNYSPEHI 89

Query: 95  KKSIIKSLEDV-----KEIE-YIDLLLIHN-PIAATEERLGTWKALQEAYAEGKVRAIGV 147
           + S+ +S+E +      E E Y+DL+ +H+       +  G  K L     EG ++ +G+
Sbjct: 90  RFSVKRSIERLLGWCPDETEKYLDLVYLHDVEFQTLNDITGAIKELMILKKEGFIKRVGI 149

Query: 148 SNYSIKHLEEL--YNWEGLKVEPM 169
           S Y +K L E+  Y  E   + P+
Sbjct: 150 SGYPVKFLYEVSKYCKESRDIGPL 173

>KAFR0E00730 Chr5 complement(154594..155073) [480 bp, 159 aa] {ON}
           Anc_8.579 YPL099C
          Length = 159

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 70  TPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLL---LIHNPIAATEER 126
           T N+SR    +  K + + + Y  +K S+I+SLED+ ++E +D +   LI   I    E 
Sbjct: 7   TSNLSRISGHFVIK-NANTYRYIASKPSVIRSLEDLSKLESLDGVGPKLIKRLIEKRTEE 65

Query: 127 LGTWKALQEAYA----EGKVRAIGVSNYS 151
           L     L+        EG+VR + +  ++
Sbjct: 66  LNIKNELEVLKKFQNEEGEVRKLSLRKFT 94

>ZYRO0C06468g Chr3 (493466..494491) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q06494 Saccharomyces cerevisiae YPR127W
           Hypothetical ORF
          Length = 341

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 95/243 (39%), Gaps = 26/243 (10%)

Query: 27  APKEET----EHTVFTALKSGYR-HVDCAQLYGNEREVGLGIAKFLKETPNVSRSEIFYT 81
            PKE+     +  +  A  SG +   +  + YG +      +  F    P + RS +  +
Sbjct: 30  VPKEQAWDAMQCVIGLAQASGVKAFFNVGEFYGPDYSNLKLVKSFFDAKPEL-RSHVIIS 88

Query: 82  TKVSGDNHGYEKAKKS--IIKSLEDVKEIEYIDLLLIHNPIAATEERLG------TWKAL 133
            K + D   +    KS  +I S+E  K +E++   L    +A  ++ LG      +++A+
Sbjct: 89  CKGAIDATTFTPKGKSEDVIASVE--KCVEHLGTHLEIYEVARLDKSLGGAYPRESFEAM 146

Query: 134 QEAYAEGKVRAIGVSNYSIKHLEELY-NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKG 192
                +G +  I +S      +  ++ +W    V   V     +  +    +   C   G
Sbjct: 147 ASLVDKGVIDGISLSEVDKDEIIAIHKDWAKYLVCVEVELSLFSTDILHNGIASICNDLG 206

Query: 193 MVLEAFSPLTRG---------QKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPK 243
           +++ A+SPL RG           F D   + L+K    +     +++   LQ   +    
Sbjct: 207 LIIVAYSPLGRGLLTGSIKRDSSFKDGDFRSLVKRFRGDSLQHNLILTEFLQKEIVDQRP 266

Query: 244 SSN 246
           +SN
Sbjct: 267 ASN 269

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,834,110
Number of extensions: 1367974
Number of successful extensions: 3621
Number of sequences better than 10.0: 177
Number of HSP's gapped: 3329
Number of HSP's successfully gapped: 182
Length of query: 289
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 181
Effective length of database: 41,097,471
Effective search space: 7438642251
Effective search space used: 7438642251
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)