Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.188863.497ON1105110556950.0
KLTH0G02442g3.497ON1113111543070.0
SAKL0F02596g3.497ON1132114729010.0
Ecym_12323.497ON1204116025270.0
AFR316W3.497ON1191115625050.0
ZYRO0D09790g3.497ON1180110220850.0
Suva_7.4223.497ON1127115719700.0
TDEL0D056503.497ON1077110319350.0
Skud_7.4453.497ON1123115518800.0
KAFR0C020003.497ON1066107018680.0
YGR134W (CAF130)3.497ON1122111318540.0
Smik_6.2303.497ON1124110718190.0
NCAS0E007703.497ON1150113718190.0
KNAG0B007703.497ON1038110217150.0
NDAI0G009003.497ON1279119116770.0
Kpol_480.123.497ON1114111416610.0
CAGL0I10428g3.497ON116397015470.0
TPHA0A056803.497ON107480513801e-172
KLLA0E03961g3.497ON1132115412291e-149
TBLA0C045103.497ON130765310331e-120
NCAS0A093901.281ON62148771.8
TBLA0C028701.281ON62549762.5
Smik_6.3328.642ON45082762.6
Skud_10.1281.281ON62348762.6
Smik_10.2875.156ON33869718.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18886
         (1105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...  2198   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...  1663   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...  1122   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   978   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   969   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   807   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   763   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   749   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   728   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   724   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   718   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   705   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   705   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   665   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   650   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   644   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   600   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   536   e-172
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   478   e-149
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   402   e-120
NCAS0A09390 Chr1 complement(1862500..1864365) [1866 bp, 621 aa] ...    34   1.8  
TBLA0C02870 Chr3 complement(690489..692366) [1878 bp, 625 aa] {O...    34   2.5  
Smik_6.332 Chr6 (522940..524292) [1353 bp, 450 aa] {ON} YPL133C ...    34   2.6  
Skud_10.128 Chr10 (240794..242665) [1872 bp, 623 aa] {ON} YJL085...    34   2.6  
Smik_10.287 Chr10 (449576..450592) [1017 bp, 338 aa] {ON} YJR008...    32   8.2  

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score = 2198 bits (5695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1105 (96%), Positives = 1067/1105 (96%)

Query: 1    MVKTKKSSLVNDPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQEKLVIGLFTTKPG 60
            MVKTKKSSLVNDPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQEKLVIGLFTTKPG
Sbjct: 1    MVKTKKSSLVNDPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQEKLVIGLFTTKPG 60

Query: 61   LSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRN 120
            LSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRN
Sbjct: 61   LSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRN 120

Query: 121  DSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLSQADLP 180
            DSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLSQADLP
Sbjct: 121  DSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLSQADLP 180

Query: 181  SLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240
            SLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP
Sbjct: 181  SLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240

Query: 241  LFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESP 300
            LFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESP
Sbjct: 241  LFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESP 300

Query: 301  NVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSD 360
            NVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSD
Sbjct: 301  NVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSD 360

Query: 361  MFIGLLHSEIKQLPFNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNL 420
            MFIGLLHSEIKQLPFNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNL
Sbjct: 361  MFIGLLHSEIKQLPFNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNL 420

Query: 421  HKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGL 480
            HKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGL
Sbjct: 421  HKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGL 480

Query: 481  EIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHG 540
            EIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHG
Sbjct: 481  EIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHG 540

Query: 541  RKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXX 600
            RKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYN  
Sbjct: 541  RKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEV 600

Query: 601  XXXXXXXXXXXXXXXXXRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGIPISHTRISKELP 660
                             RIKEMRAYYKRCHCQF            SGIPISHTRISKELP
Sbjct: 601  GTEDMDEEELEDVESRERIKEMRAYYKRCHCQFDDDELLPEEEEESGIPISHTRISKELP 660

Query: 661  PDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHT 720
            PDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHT
Sbjct: 661  PDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHT 720

Query: 721  LMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLT 780
            LMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLT
Sbjct: 721  LMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLT 780

Query: 781  TDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIY 840
            TDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIY
Sbjct: 781  TDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIY 840

Query: 841  SLVMGNRGEKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG 900
            SLVMGNRGEKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG
Sbjct: 841  SLVMGNRGEKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG 900

Query: 901  DXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE 960
            D       NLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE
Sbjct: 901  DEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE 960

Query: 961  ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIY 1020
            ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIY
Sbjct: 961  ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIY 1020

Query: 1021 NKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDID 1080
            NKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDID
Sbjct: 1021 NKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDID 1080

Query: 1081 NRNFLAEFGIDYNDFVDGAYDSDFA 1105
            NRNFLAEFGIDYNDFVDGAYDSDFA
Sbjct: 1081 NRNFLAEFGIDYNDFVDGAYDSDFA 1105

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score = 1663 bits (4307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/1115 (71%), Positives = 929/1115 (83%), Gaps = 14/1115 (1%)

Query: 1    MVKTKKSSLVNDPERRSSLETLPKLVDPK-----PNESEARGTNSYASLSIQEKLVIGLF 55
            MV+ K+S++++DP RR S   LP   +P      P    +R   ++  +  QEKLV+GLF
Sbjct: 1    MVRKKRSAVISDPPRRPS--ALPAPAEPNGTPGSPVGQPSREPRAFTDIDAQEKLVLGLF 58

Query: 56   TTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALME 115
            TT+PGLS L+LYYELSCGR+NLLRYKKWQQSK Q + DA YK++VK+WT S++++  LM+
Sbjct: 59   TTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSSTEHVGLLMD 118

Query: 116  YLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLS 175
            + LRND+ +LDY SFYS  +KLS+AFLLD +TE+L+IDDEYNLLLDF LQ RA VE+LL+
Sbjct: 119  HFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVLVIDDEYNLLLDFALQCRALVEQLLN 178

Query: 176  QADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLI 235
            Q DLPSL+AK A  H RLFQL GRYVWYTFS E+F EAQDICYKYLSVLTDKLTAQQDLI
Sbjct: 179  QIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKYLSVLTDKLTAQQDLI 238

Query: 236  PQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDDG 295
            PQIQPLF+ ++SS+ +H   GD L++E  ESDSNSDSDHWPQK+LSA ER+YSFDLKDDG
Sbjct: 239  PQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQKRLSAQERVYSFDLKDDG 298

Query: 296  TLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISI 355
            TLE+ NVF RTRRRHQALYQVL LQ+QN++P L +QFFTLCALVDPVTQPTPNDSHI+SI
Sbjct: 299  TLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCALVDPVTQPTPNDSHIVSI 358

Query: 356  DLLSDMFIGLLHSEIKQLPFNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSID 415
            DLLSDMF+GLL+SEI +L  +WRFH+CFNLQKI+Q+TLPRLNCHDFQ+LNSVNNSDDSID
Sbjct: 359  DLLSDMFLGLLYSEINELHIDWRFHVCFNLQKIVQATLPRLNCHDFQRLNSVNNSDDSID 418

Query: 416  WRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFV 475
            WRRNLHKWLPQGLNTQDLEL+YMIDILAIYIIHKLYRD P QMNPFLASMISLWKNLTFV
Sbjct: 419  WRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLYRDLPAQMNPFLASMISLWKNLTFV 478

Query: 476  VLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIF 535
            VLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVAT+LNGHVEYKRHDFQHEPINIF
Sbjct: 479  VLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATILNGHVEYKRHDFQHEPINIF 538

Query: 536  MSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYD 595
            MSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYD
Sbjct: 539  MSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYD 598

Query: 596  NYNXXXXXXXXXXXXXXXXXXXRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGIPISHTRI 655
            NYN                   RIKEMRAYYKRCHCQF                 S  R+
Sbjct: 599  NYNEVDTEELDEDELEDVESRERIKEMRAYYKRCHCQFDDDELLPEDEEDGRPDASPYRV 658

Query: 656  SKELPPDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKR 715
            +++ PPD NVKLSNT+KP+ALR++KD++EFDFNGRDWR IPRGLNFYFNENY+FEK +  
Sbjct: 659  TRDAPPDNNVKLSNTSKPMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSS 718

Query: 716  GAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVA 775
            G AH+LM +AAE++L  EE   LLR+++TCVAKEQE TVLRSA    ++      STLVA
Sbjct: 719  GQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVA 778

Query: 776  DGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSM 835
            DGDLTTD++YE WC++S+F+K+LFHNETLVWR+MDEMLMCSGYRRVLIWFITHLEV++SM
Sbjct: 779  DGDLTTDFVYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSM 838

Query: 836  IEYIYSLVMGNRGEKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQL 895
            IEYIY+LV+GNRGEK A++   + K+PFSRQG IVLS+IEIKMLLQEFFTNAAIFFSKQL
Sbjct: 839  IEYIYTLVLGNRGEKAASDGD-YAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQL 897

Query: 896  RESLGDXXXXXXXNL-----GISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETL 950
            RESLGD              GISP++VGLM+LVC+MVKSL+Q+EMFDFKDPDYIFEL+TL
Sbjct: 898  RESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYIFELQTL 957

Query: 951  LMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSD 1010
            LMSWICILPEARDLFFALRS VD+QS+   K + +++A+A   +   + +         +
Sbjct: 958  LMSWICILPEARDLFFALRSLVDEQSQN-IKLESESIASACEPDSQSEPQLPQGTHAELE 1016

Query: 1011 SEETNSVSIYNKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIM 1070
             E T++VSIYNKKL+SLLPP  GTEN+A+TALRSFISKHSLT  TA+FGRRVI+ DD IM
Sbjct: 1017 PEATHAVSIYNKKLMSLLPPAAGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIM 1076

Query: 1071 SMYMSDKDIDNRNFLAEFGIDYNDFVDGAYDSDFA 1105
             MYMSD+++DNR FLAEFGIDYNDFVDGAYDSDF 
Sbjct: 1077 PMYMSDREMDNRQFLAEFGIDYNDFVDGAYDSDFV 1111

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1147 (51%), Positives = 756/1147 (65%), Gaps = 63/1147 (5%)

Query: 1    MVKTKKSSLVN---DPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQEKLVIGLFTT 57
            M K KK+  V+   +  +  +L  L K   P            +    +QE L++ LF T
Sbjct: 1    MTKKKKAVSVDSHDETHKGMALSRLCKDYYPDQRNLTIPHVEEFPDAVVQEMLILSLFVT 60

Query: 58   KPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYL 117
             PG SIL+LYY+LSCGR++L  YK+WQ S+ +S     YKKLVK+W+ S+  +    + L
Sbjct: 61   LPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDG--YKKLVKRWSTSTLVLLRFTDLL 118

Query: 118  LRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLSQA 177
            L+N +  L+Y    +AEYKLS+ FLLD+  E LI+D +YNLLLD+LL  +  +E +L   
Sbjct: 119  LQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFLILDPDYNLLLDYLLHAKPMIESIL-LG 177

Query: 178  DLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQ 237
            ++P L+      +++L + +G + WYTF    +   Q+I +K+   LTDK TA ++++P+
Sbjct: 178  NIPGLLKALVYQYNKLPEFNGCHTWYTFR-THYHGTQEIFHKFFIALTDKFTASKEIMPE 236

Query: 238  IQPLFDSVNSSRLAHLSQ---GDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDD 294
            ++  F     SR +   +   GD   S     D N D  +W Q+K +  E++YSF+L +D
Sbjct: 237  LEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNED--YWTQQKTNTQEQVYSFELNED 294

Query: 295  GTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIIS 354
            GTLE PNVF  T+RRH ALY+VL L   + +P LK+ F T C L DPVTQP PND HI+S
Sbjct: 295  GTLEIPNVFAHTKRRHDALYKVLGLND-DPTPLLKSCFLTFCCLADPVTQPPPNDKHIVS 353

Query: 355  IDLLSDMFIGLLHSEIKQ---LPFN---WRFHICFNLQKILQSTLPRLNCHDFQQLNSVN 408
            +DLLSDMF+GL++ EI      P N   W  HICFNLQKI+ +TL RLNC DF +LN +N
Sbjct: 354  LDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEIN 413

Query: 409  NSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISL 468
            NSDDS+DWR+NL+KWLPQGLNTQDLEL+YM+DILA Y I+KLY +RP+QMNPFL  MISL
Sbjct: 414  NSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISL 473

Query: 469  WKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQ 528
            WKNLT VVLLGLEIDR EEEQETF+TPV+VRA IRG+SALRSV+AT++NGH  YK HDF+
Sbjct: 474  WKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFK 533

Query: 529  HEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKY 588
            HEPIN+FMSPHGRKLC+GALY D+RSHAA MLALGIELE +T+LLSDLQPGDRFDEDVKY
Sbjct: 534  HEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKY 593

Query: 589  MFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGI 648
            MFDYE+D+YN                   RIKE+R YYKRCHC F             G 
Sbjct: 594  MFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENEDGGGE 653

Query: 649  PISHTRISK--------ELPPDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLN 700
                    K        +LPP  NV +S T+KP+A+R+ +DT+EFDFNGRDWRDIPRGLN
Sbjct: 654  EGDQEDTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRS-RDTVEFDFNGRDWRDIPRGLN 712

Query: 701  FYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFA 760
            FY+ + Y F   +     H LM  A  ++L +  A  +LR ++TCV  EQE  ++R A  
Sbjct: 713  FYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALG 772

Query: 761  ADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRR 820
              D    S  +T+  + +LT+D+IYE WC+DSLF+KM++HN  LVWR+MDEMLMCSGYRR
Sbjct: 773  NQDGDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRR 832

Query: 821  VLIWFITHLEVTSSMIEYIYSLVMGNRG--------EKLANEETPFG----------KLP 862
            VLIWFITHLE+  S+I YI+ LVMG RG        EK  N +   G           LP
Sbjct: 833  VLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLP 892

Query: 863  FSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXXXXXXXN------LGISPYI 916
            FSRQG I+LS IE+ MLLQEFFTNAAIFFS +LRES          N        + P++
Sbjct: 893  FSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHV 952

Query: 917  VGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQS 976
            +GLM+LVCFMV +L+Q++ FDF D +YIFEL+TLLM+WI I+PEARDLFF L+S++   S
Sbjct: 953  IGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATS 1012

Query: 977  RKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKLISLLPPVVGTEN 1036
            +       D     + V  S      D+ D     E  +++S +NKKL+ L+PP    E 
Sbjct: 1013 Q-------DTQEQGTPVKES----EKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNER 1061

Query: 1037 TAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFGIDYNDFV 1096
             A+TALR FI K+SLT  TAVFGR++I  DD IM MYM+DK++  R FLAEFGIDYND V
Sbjct: 1062 NALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIV 1121

Query: 1097 DGAYDSD 1103
            +G Y+ D
Sbjct: 1122 EGVYEED 1128

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1160 (46%), Positives = 716/1160 (61%), Gaps = 117/1160 (10%)

Query: 46   IQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTG 105
            I EK+V+ LF T+ G S+L + Y+L CGRI L  YK  Q  K +S   + +K   K W  
Sbjct: 48   ITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYK--QSLKVRS-NHSYWKSCYKDWGS 104

Query: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQ 165
              D +S  +++ LRN++ +LDY+ + SA  KL + FLL +     +IDDEYNLLLD+++Q
Sbjct: 105  RRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQ 164

Query: 166  TRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWY---TFSDERF-AEAQDICYKYL 221
            +R   E LL+Q  +P  + +    ++R ++ +G YVWY   T S  +  +  +++  K+ 
Sbjct: 165  SRPMWEMLLTQG-IPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFF 223

Query: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSN----SDSDHWPQ 277
              L DKLT  ++L+P++     S +S   ++  Q     S   +   +    S++DHWPQ
Sbjct: 224  YTLFDKLTVTKELLPKLNVALWS-HSWPASYTKQTLLDLSNDDDDHYDQDVDSENDHWPQ 282

Query: 278  KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCA 337
            +KLS+ E++++FDL  DGTLE PNVF   ++RH+ LY+VL L      P LKAQF TL A
Sbjct: 283  QKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDA-EGPLLKAQFMTLAA 341

Query: 338  LVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLPF----NWRFHICFNLQKILQSTL 393
            LVDP+TQP P + HIISIDL+  MF+G   + I+ +      +WRFH+C+N+QKI+ +T+
Sbjct: 342  LVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATM 401

Query: 394  PRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRD 453
             RLNCHD   LN+VNNSD+S+ W  NL KW P+GLNTQDLEL+YM+D+L+IY +++LY  
Sbjct: 402  KRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSY 461

Query: 454  RPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVA 513
             PVQMNPFL   + LWKNLT V+L GLEIDRFEE++ETF+TP++VRAAIRG++ALRSVVA
Sbjct: 462  LPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVA 521

Query: 514  TVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLL 573
            T++N H   K HDF+HEPIN+FMSPHGRKLCHGALY DVRSHAAAML+LGI+L DVT+LL
Sbjct: 522  TMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLL 581

Query: 574  SDLQPGDRFDEDVKYMFDYEYDNYNXX------XXXXXXXXXXXXXXXXXRIKEMRAYYK 627
            SDLQPGDRFD+DVKYMFDYEYD+YN                         RIK+MR YYK
Sbjct: 582  SDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYYK 641

Query: 628  RCHCQF----XXXXXXXXXXXXSGI---PISHTRISKELPP---DTNVKLSNTAKPVALR 677
            RCHC F                S I     SH  ++  LP     T     N+ K  A+R
Sbjct: 642  RCHCVFDDDELLSDEEEGETASSNIDRPKYSHNSLN--LPSSMLSTTFNGPNSQK-FAIR 698

Query: 678  NKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVH 737
            + +D ++FDFNG+DWRDIPRGLNFY+ E+Y F   +     + LM  A  +++    A  
Sbjct: 699  S-RDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASF 757

Query: 738  LLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKM 797
            +LR ++TC+  EQE +++         +  S  S      +LT+D+IYE WC++SLF KM
Sbjct: 758  ILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKM 817

Query: 798  LFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLANEETP 857
            +++N  LVWR+MDEMLMCSGYRRVLIWFITHLE++ S+I YI+ LVMG RG    +EE  
Sbjct: 818  MYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAE 877

Query: 858  FG---------------------KLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLR 896
                                   K+PFSRQG I+LS IEI MLL EFF NA I+FS  ++
Sbjct: 878  DDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMK 937

Query: 897  E--------------------SLGDXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMF 936
                                   G         LG+SP+++GLM+LVCFMV  L++++ F
Sbjct: 938  NLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKF 997

Query: 937  DFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATAS----- 991
            DF D +YIFEL+TLLM+WI I+PEAR+LFF L+S + + S +      D   T +     
Sbjct: 998  DFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKS 1057

Query: 992  --------------VVNL-----------SPDFRTTD--------ENDGSSDSEETNSVS 1018
                          +VN+             DF  T         EN GS + +  N++S
Sbjct: 1058 SQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLS 1117

Query: 1019 IYNKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKD 1078
             YNK LI LLP  V  ENTAVTALRSFI+KHSLT  TAVFGRRVI  D  IM +YM+DK+
Sbjct: 1118 KYNKMLIELLPLHVDNENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKE 1177

Query: 1079 IDNRNFLAEFGIDYNDFVDG 1098
            +  R FLAEFGIDYN  V+ 
Sbjct: 1178 MRQREFLAEFGIDYNSVVNN 1197

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/1156 (46%), Positives = 707/1156 (61%), Gaps = 105/1156 (9%)

Query: 44   LSIQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKW 103
            L I EK+V+ LF T+ G SIL L Y+LSCGRI L  Y+  Q  K +S     +K   K+W
Sbjct: 46   LMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYR--QSLKVRSNVHQ-WKTCYKEW 102

Query: 104  TGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFL 163
                D +S  +++ LRN+  +LDY  +     KL + FLL       ++D+ YNLLLD++
Sbjct: 103  GSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLHAYVLDEGYNLLLDYI 162

Query: 164  LQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFA---EAQDICYKY 220
            + +R   EELL Q  +P L+ +    ++R+F+ +G Y WY  +          +++  K 
Sbjct: 163  INSRLMWEELLIQG-IPRLLPELIEDYNRVFEFNGYYTWYGGAPSGAGAANSTRELHTKV 221

Query: 221  LSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVES----DSNSDSDHWP 276
            L  L DKLT  ++L+P++     S +   + H   G + +S   E     DS  + D WP
Sbjct: 222  LYALFDKLTVAKELLPRLNATVWSHSWPPMYH-KHGINEFSNEEEDLYDFDSELEGDSWP 280

Query: 277  QKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLC 336
            Q K SA E++Y+F+L  DG+LE PNVF  TRRRH+ LY++L L  +   P L+AQF TLC
Sbjct: 281  QHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYRILGLPNR-ECPLLRAQFMTLC 339

Query: 337  ALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLPF--NWRFHICFNLQKILQSTLP 394
            ALVDP+TQP P + HIISIDL+  MF+G + S ++      +WRFH+C NLQKI+ +T+ 
Sbjct: 340  ALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRGQDWRFHVCHNLQKIILATMK 399

Query: 395  RLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDR 454
            RLNCHD + LNS+NNSD+++ W  N+ KW P+GLNTQDLEL+YM+D+L IY I++LY D 
Sbjct: 400  RLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDL 459

Query: 455  PVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVAT 514
            PVQMNPFL     LWKNLT V+LLGLEIDRFEE++ETFSTP++VRA IRGS+ALRSVVAT
Sbjct: 460  PVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVAT 519

Query: 515  VLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLS 574
            ++N H   K HDF+HEPIN+FMSPHGRKLC GALY DVRSHAAAMLALGIEL DVT+LLS
Sbjct: 520  MINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLS 579

Query: 575  DLQPGDRFDEDVKYMFDYEYDNYNXX------XXXXXXXXXXXXXXXXXRIKEMRAYYKR 628
            DLQPGDRFD+DVKYMFDYEYD+YN                         RIK+MR YYKR
Sbjct: 580  DLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYYKR 639

Query: 629  CHCQF-----XXXXXXXXXXXXSGIPISHTRISKELPPDTNVKLSNTAKPVALRNKKDTI 683
            CHC F                 +   I+ T  S  L   T V  S   K VA+R+ +D +
Sbjct: 640  CHCVFDDDELLSDEEGTDTGEHTDNHITETVQSAPLNLVTGVSTSGPQK-VAVRS-RDYV 697

Query: 684  EFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVS 743
            EFDFNG+DWRDIPRG+NFY+ E+Y F   +     H LM  A  ++L   ++  +LR V+
Sbjct: 698  EFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVA 757

Query: 744  TCVAKEQEHTVLRSA-FAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNE 802
            TC+  EQE T++  A F + D   LS   +  ++G LT+D+IYE WC+D+LF+KM+++N 
Sbjct: 758  TCIKLEQEKTMVHDAIFKSKDKSPLSASGSEGSNG-LTSDFIYEKWCEDALFEKMMYYNN 816

Query: 803  TLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGE------------- 849
             LVWR+MDEMLMCSGYRRVLIWFITHLE++ S+I YI+ LVMG RG              
Sbjct: 817  DLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIIN 876

Query: 850  ---------KLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG 900
                      L +   P   +PFSRQG IVLS IE+ MLLQEFF NAAI+FS  LR++  
Sbjct: 877  RNLDLLDSFSLGSSCIP-ASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTAS 935

Query: 901  -------------------DXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDP 941
                                        L  S +++GLM+L+CFMV  LI+++  DF D 
Sbjct: 936  YEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDS 995

Query: 942  DYIFELETLLMSWICILPEARDLFFALRSRV---------------------DQQSRKPA 980
            +Y+FEL+TLLM+WI ++PEAR LFF L+S +                     D    +P 
Sbjct: 996  EYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLEGELASNDNDDSEPV 1055

Query: 981  KRDPDA-----------MATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKLISLLP 1029
                DA           +    +  L+    T+  N   +   E+N +S  N+ LI LLP
Sbjct: 1056 DTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESN-ISYCNQMLIKLLP 1114

Query: 1030 PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFG 1089
            P    EN AVTALRSFI+KH LT  TA+FGRRVI  D+ IM +YM+DK++  R FLAEFG
Sbjct: 1115 PHSADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQREFLAEFG 1174

Query: 1090 IDYNDFVDGAYDSDFA 1105
            IDYN   +   D++ +
Sbjct: 1175 IDYNAVANNNSDAEVS 1190

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1102 (41%), Positives = 653/1102 (59%), Gaps = 83/1102 (7%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRIN------LLRYKKWQQSKFQSLPDAVYKKLVK 101
            E +++ L TT+ GLS+L L   L     N      +   +KW     +     ++  L+ 
Sbjct: 90   EMVIVALLTTRAGLSVLAL---LKPSGSNPSIPKCISNQRKWLAQVERK--GKLHSDLIS 144

Query: 102  KWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLL 159
            +W    D     + +LL+N+   L   +    E+K+ ++FL+        LI+D  YNLL
Sbjct: 145  QWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLL 204

Query: 160  LDFLLQTRASVEELLSQA---DLPSLIAKSALSHHRLFQLSGRYVWYTF----SDERFAE 212
            +D+ L      E+ L +A        + ++ ++++R++  SG + WYT     S+  F  
Sbjct: 205  VDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFV- 263

Query: 213  AQDICYKYLSVLTDKLTA--------QQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGV 264
            +Q I +  +     ++ A        Q++ I  I  +  ++     A L+ G   Y +  
Sbjct: 264  SQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNSG--FYGDED 321

Query: 265  ESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNS 324
             S     SD++   +++ +E+++SFDL  DG+LE PN+      RH+ L +VL+L   +S
Sbjct: 322  RSALEEYSDNY-HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLNN-SS 379

Query: 325  SPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQ-LPF----NWRF 379
            SP L+ QF  +  LVDP+TQP PND H+IS+DLL  MF+G L  EI+Q L F    +WRF
Sbjct: 380  SPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRF 439

Query: 380  HICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMI 439
            H+CFN+QKI+ ++L RLN  DF++LNS+NNSDD++DWR  L KWLP G NTQDLEL+ M+
Sbjct: 440  HVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMV 499

Query: 440  DILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVR 499
            DI+A+Y I+KLY   P+Q+NPFL+S+ISLWKNLT V+LLGLEIDR EEE ETF TP++VR
Sbjct: 500  DIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVR 559

Query: 500  AAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAM 559
            A IRG++ALR++VATVLNGHVE  +HD +HE +N FMSPHGRKLC GALY ++RSHAAA+
Sbjct: 560  ATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAAAL 619

Query: 560  LALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXX---XXXX 616
            LALG ELEDVT+L SDLQPGDRFDEDV+YMF+YE+++YN                     
Sbjct: 620  LALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDS 679

Query: 617  XRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGIPISHTRISKELP---PDTNVKLSNTAKP 673
             +    + + +RC+C F            +     H    + LP   P T+V +S T KP
Sbjct: 680  SKTHARKGFGRRCNCIFDDDEMLEDEDYENEY-EGHKAPKQILPQQNPTTSVSMSTTGKP 738

Query: 674  VALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKE 733
             A+R+   + EFD++G+DWRDIPR  N Y++ NY F + +      +L N A ++ LSK 
Sbjct: 739  HAIRSGG-SFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKI 797

Query: 734  EAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSL 793
            E++ LL  V+TCV  EQ+  VL +               +    D++ D IYE WC+DS 
Sbjct: 798  ESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDST 857

Query: 794  FDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLAN 853
            F+KM++ N  + WR+MDEMLMCSG+RRVLIWFITH+E+  S+I YI+ LVMG R     N
Sbjct: 858  FEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFDEN 917

Query: 854  EETPFG----------------KLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRE 897
             E   G                 LPFSRQG I LS IE KMLLQEFFTNAAIF +++ +E
Sbjct: 918  NENDNGDESISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKE 977

Query: 898  SLG------DXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951
             +G      +       N  +S Y VGLM+L+C MV++ I++  FDF++ + +FEL+TLL
Sbjct: 978  WIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLL 1037

Query: 952  MSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPD----FRTTDENDG 1007
            M+WI I+PEA+DLFF L++ V       A+   D M    + N  PD      +  END 
Sbjct: 1038 MNWIAIIPEAKDLFFELKALV-------AEVHSDPMDDEELSNNPPDSNKKLSSMVENDN 1090

Query: 1008 SSDSEETNSVSIYNKKLISLLPPVV--GTENTAVTALRSFISKHSLTMGTAVFGRRVINH 1065
             + +E  +S   YN+KLISLL PV+    EN AV ALR+FI K+S      + GR+V+  
Sbjct: 1091 INGNEAVDSE--YNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYE 1148

Query: 1066 DDRIMSMYMSDKDIDNRNFLAE 1087
             + I+ +  S+  +   ++L +
Sbjct: 1149 GNEILPLPESETPMSLLDYLVD 1170

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1157 (39%), Positives = 656/1157 (56%), Gaps = 141/1157 (12%)

Query: 9    LVNDPERRSSLETLPKLV--DPKPNESEARGTNSYASLSIQEKLVIGLFTTKPGLSILKL 66
            L+ D     S+E L KL+  +   N+ E R    + +LS+       LFTTK G SIL+ 
Sbjct: 39   LLKDRHYTPSVENLEKLLYDETILNDQEIRFPLLFEALSVT------LFTTKSGKSILQT 92

Query: 67   YYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRNDSTSLD 126
              + S  +      K W++S F++  D+ Y  +++ W      +   + ++L N +T L 
Sbjct: 93   M-KASTSK----ERKAWEKS-FEN-HDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQ 145

Query: 127  YVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQTRASVEELL---SQADLPS 181
               +   +YKL ++FL+     L  +I+++ YN+L D+L      +E L+   S  D  +
Sbjct: 146  IDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSA 205

Query: 182  LIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240
             I K  L  + R+ +    Y WY+FS E+ A             T KL    +L      
Sbjct: 206  RIFKGTLQQYDRMIEFRNFYFWYSFSAEKNA-------------TPKLNHNINL------ 246

Query: 241  LFDSVNSSRLAHLSQGDSLYSEGVES--DSNSDSDHWPQKK-------LSAHERIYSFDL 291
            L DS            D+L  +GV S  D+    +H  Q K       ++  E+IYSF+L
Sbjct: 247  LMDSYE----------DNL--DGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFEL 294

Query: 292  KDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSH 351
              DGTL+ PNV   +  RH+ L+++L L     +P L+ QF TLC LVDP+TQPTPND H
Sbjct: 295  NQDGTLQIPNVMEHSLLRHELLFKILNLTPV-LTPLLEQQFSTLCGLVDPLTQPTPNDKH 353

Query: 352  IISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNS 406
            IISID L  +F+GL++  IK        ++W+F+ICFN+QKI+ +T+ RLNC  F++LNS
Sbjct: 354  IISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNS 413

Query: 407  VNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMI 466
            +NN+DD++ WR  LH WLP GLNTQDLEL+YMIDILA+Y I+KLY + P+Q+NPFL S++
Sbjct: 414  INNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLL 473

Query: 467  SLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHD 526
            SLWKNL+ V+LL LEIDR EEE+ T+ TP++VRA IRG++ALRSV+A VLNG V+   HD
Sbjct: 474  SLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHD 533

Query: 527  FQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDV 586
            F+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+L +DLQ GDRFDED+
Sbjct: 534  FKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDI 593

Query: 587  KYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIK---EMRAYYKRCHCQFXXXXXXXXXX 643
            +YMFDYE ++YN                   + K       Y +RC+C F          
Sbjct: 594  RYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDG 653

Query: 644  XXSGIPISHTRISKELPPDTNVKLSNTA-----------KPVALRNKKDTIEFDFNGRDW 692
              +    ++  I  E+  D N   SNTA            P ++R++  T EFD++G DW
Sbjct: 654  ANAS--TNNDSIKNEIRSDGNAG-SNTAITNANHATSSINPYSVRSRS-TFEFDYSGEDW 709

Query: 693  RDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEH 752
            RD+P+  N Y++ +Y F +  K      L    A  +LS+EE+V L+R V++CV  EQ+ 
Sbjct: 710  RDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQ 769

Query: 753  TVLR----------SAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNE 802
             +L             F   D+   S ++        T D IYE W ++S F++ML+ N 
Sbjct: 770  MILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNH 829

Query: 803  TLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRG-------------- 848
             + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ L+MG RG              
Sbjct: 830  DVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKD 889

Query: 849  --------EKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG 900
                    +K  NE T    LPFSRQG IVLS+IE KMLLQEFF NAAIF S +  E  G
Sbjct: 890  DMIYEILKKKQKNENT--SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEG 947

Query: 901  DXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE 960
            +          +S Y +GL++L+C+MV++LI  + F F   +  FEL+TLLM+WI ILPE
Sbjct: 948  EDADK------VSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPE 1001

Query: 961  ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFR-TTDENDGSSDSEETNSVSI 1019
            A+DLFF ++SR+             AM    + + +   +  TD +  S     T S+S 
Sbjct: 1002 AKDLFFQIKSRL-------------AMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISK 1048

Query: 1020 YNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDK 1077
             N K++SL P  P    +N+A++ LRSFI+ +S        GRRV+ HDD+I+ +  +DK
Sbjct: 1049 LNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADK 1108

Query: 1078 DIDNRNFLAEFGIDYND 1094
             I    ++    +D  D
Sbjct: 1109 PIPLHEYITLAELDMGD 1125

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1103 (40%), Positives = 638/1103 (57%), Gaps = 130/1103 (11%)

Query: 46   IQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTG 105
            I E L+I LFTT+ G+S+L L+ E S  R  +                      V +W  
Sbjct: 50   ICETLIIALFTTRAGISLLPLFSE-SAKRKRV-------------------GPRVLEWHN 89

Query: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQD--TELLIIDDEYNLLLDFL 163
              + +     Y+L N S+ ++   F  A +KL + FL++       +++D  YNLLLD++
Sbjct: 90   DEELMLRFFSYILENRSSRIEPRLFEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYV 149

Query: 164  LQTRASVEELLSQA-DLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLS 222
                  ++  + +A    +    + + ++R+++L     WY+F  ++  E +    ++L 
Sbjct: 150  HTITPMIKRWVHRAFTQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLR 209

Query: 223  VLTDKL--TAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKL 280
              ++++  T  + + P  +    ++N +   H                          ++
Sbjct: 210  ENSEQVLDTYHEMVRPSNE---RAINDTASYH-------------------------HRI 241

Query: 281  SAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVD 340
            S HE +YSFD+  DG+LE PN+      RH  L  ++RL   + SP L+ QF  +  LVD
Sbjct: 242  SQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRLPLCD-SPLLQWQFKLMAGLVD 300

Query: 341  PVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQL----PFNWRFHICFNLQKILQSTLPRL 396
            P+TQP PND HIIS+DLL  M +GL+   I         +W+FH+CFN+QKI+Q++L RL
Sbjct: 301  PLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTLGSDGCDWKFHLCFNMQKIIQASLKRL 360

Query: 397  NCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPV 456
            N  DF  LNS+NNSD+ + WR NLH WLP GLNTQ+LEL+YMIDILA+Y I+KLY D PV
Sbjct: 361  NLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPV 420

Query: 457  QMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVL 516
            Q+NPFL+ MISLWKNLT V+LLGLEIDRFEEE ETF TPVLVRA IRG++ALR+VVAT+L
Sbjct: 421  QLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATIL 480

Query: 517  NGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDL 576
            NGHV+  +HDF HEP+N FMSPHGRKLC GALY D+RSHAAA+LALG ELEDVTNLL+DL
Sbjct: 481  NGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADL 540

Query: 577  QPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKEMRAYYKRCHCQFXXX 636
            Q GDRFDEDV+YMF+YE DNYN                    +++ +   +RC+C F   
Sbjct: 541  QAGDRFDEDVRYMFEYECDNYNEGDSESEKDGKLA-------VEQPKILQRRCNCIFDDD 593

Query: 637  XXXXXXXXXSGIPISHTRISKEL----PPDTNVKLSNTAKPVALRNKKDTIEFDFNGRDW 692
                               SK L       T++ +S++ KP A+R+     EFD++G+DW
Sbjct: 594  EMAEDEDFDG--ENDEAFFSKHLILQQNAQTSLSMSSSGKPRAVRS-GGAFEFDYSGKDW 650

Query: 693  RDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEH 752
            RDIPRG NFY++ +++F +S    +   L   A+  +L ++E++ LLR V++CV  EQ+ 
Sbjct: 651  RDIPRGSNFYYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDE 710

Query: 753  TVLRSAF-AADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDE 811
              L +      DSQA   + +  AD  +  D IYE WC++S F+K+++ N TL W++MDE
Sbjct: 711  ITLGNLIDPHQDSQA--DEESRNAD-KIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDE 767

Query: 812  MLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLANEE------TPF------- 858
            ML+C GYRRVLIWFITH+E+  S+I YI+ LVMG RG    N+        P        
Sbjct: 768  MLLCIGYRRVLIWFITHMELNHSLIHYIFELVMGLRGNSDENDRDVDLAGPPLQDVDKVK 827

Query: 859  GKLP--FSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESL--------GDXXXXXXX 908
            G+L   FSRQG + LS IE KMLLQEFFTNAAIF SK+  ES          +       
Sbjct: 828  GELSVGFSRQGALQLSTIETKMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGN 887

Query: 909  NLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFAL 968
            +  +S Y +GLM+L+CFMV++ I +E FDF + + +FEL+ LLM+WI I+PEA+ LFF L
Sbjct: 888  SENVSLYAMGLMKLICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFEL 947

Query: 969  RSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSD-SEETNSVSI-------Y 1020
            +S +               +TA+ V    +     +ND   D  +E + V +       +
Sbjct: 948  KSLI------------AGFSTATSVQEQKNAEV--KNDTQEDVPKEQSPVRVSNTAGFEF 993

Query: 1021 NKKLISLLPPVVGT--ENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSD-- 1076
            N+KL++LLPP+V    EN A+  LRSFI   S      V GR+++  DD+I+ +  SD  
Sbjct: 994  NRKLMTLLPPLVKNKEENAAMQTLRSFIKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVP 1053

Query: 1077 ----KDID-NRNFLAEFGIDYND 1094
                + ID + N+    G DY D
Sbjct: 1054 LALHEYIDYDGNYAYASGDDYED 1076

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1155 (38%), Positives = 648/1155 (56%), Gaps = 145/1155 (12%)

Query: 9    LVNDPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQ-EKLVIGLFTTKPGLSILKLY 67
            L+ D     SLE L KL+      +E+   +    LSI  E L I LFTTK G SIL+  
Sbjct: 37   LLKDKNYVPSLENLEKLL-----YNESILDDQKIRLSILFEALSIILFTTKSGKSILQ-- 89

Query: 68   YELSCGRINLLRYKK-WQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRNDSTSLD 126
                  + + L+ KK W QS      D+ Y  +V+ W  +       + +LL N +TSL 
Sbjct: 90   ----AVQASTLKEKKLWAQSLRDD--DSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQ 143

Query: 127  YVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQTRASVEELLSQADLPS--- 181
               +   EYKL ++FL+        +I+++ +N+L D+L      ++ L+    + S   
Sbjct: 144  IDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSA 203

Query: 182  LIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240
            L+ K  L  + R+ +    Y WY+F+ E      D+ +++    +D              
Sbjct: 204  LVVKKILKDYDRIVEFHNLYFWYSFNVE-----NDVNFEF----SDN------------- 241

Query: 241  LFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQK---------KLSAHERIYSFDL 291
             FD + +S   H        ++G   D    SD+ PQK          ++  E+IYSF+L
Sbjct: 242  -FDLLMNSPEDH--------ADGGVIDDRCKSDN-PQKHAKNTIIKRTINDQEQIYSFEL 291

Query: 292  KDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSH 351
              DGTL+ PN+   +  RH+ L+++L L     +P L+ QF  LC LVDP+ QP+PND  
Sbjct: 292  DQDGTLQIPNIMEHSLMRHELLFKILNLPSV-LTPLLELQFCNLCGLVDPLMQPSPNDEQ 350

Query: 352  IISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNS 406
            +ISID L  +F+GL++  IK        ++W+F+ CFN+QKI+ +T+ RLNC DF++LNS
Sbjct: 351  VISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNS 410

Query: 407  VNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMI 466
            VNN+D  I WR  LHKWLP GLNTQDLEL+YMIDILAIY I+KLY   P+Q+NPFL S++
Sbjct: 411  VNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLL 470

Query: 467  SLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHD 526
            SLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV+A+VLNG V+   HD
Sbjct: 471  SLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHD 530

Query: 527  FQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDV 586
            F+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+L +DLQ GDRFDED+
Sbjct: 531  FKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDI 590

Query: 587  KYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKEMRA---YYKRCHCQFXXXXXXXXXX 643
            +YMFDYE ++YN                   +IK   +   Y +RC+C F          
Sbjct: 591  RYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDG 650

Query: 644  XXSGIPIS-HTRISKELPPDTNV----------KLSNTAKPVALRNKKDTIEFDFNGRDW 692
                  IS ++ +  E+P + NV          + +++  P+++R++  T EFD++G DW
Sbjct: 651  TNEAFEISGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRS-TFEFDYSGEDW 709

Query: 693  RDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEH 752
            RD+P+  N Y++ +Y F +  K      L    A  +L++++++ L+  V++CV  EQ+ 
Sbjct: 710  RDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQ 769

Query: 753  TVLR---SAFAADDSQALSCQSTLVADGD------LTTDYIYENWCQDSLFDKMLFHNET 803
             +L    S FA  D    +  S  +   +       T D IYE W ++S F++ML  N  
Sbjct: 770  MILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHD 829

Query: 804  LVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLANEET------- 856
            + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ LVMG RG+  + E +       
Sbjct: 830  VAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDD 889

Query: 857  -------------PFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXX 903
                             LPFSRQG IVLS+IE KMLLQEFF NAAIF S +  E      
Sbjct: 890  MIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEE----- 944

Query: 904  XXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARD 963
                    IS Y +GL++L+C+MV++LI  + F F   +  FEL+TLLM+WI +LPEA+D
Sbjct: 945  -ENEDGEKISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKD 1003

Query: 964  LFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSE-----ETNSVS 1018
            LFF +++R+        + D D              +   +ND + D E      T S S
Sbjct: 1004 LFFQIKTRL------AMEEDSD--------------KDGQQNDDNKDLEVERRPHTKSNS 1043

Query: 1019 IYNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSD 1076
              N KL++L P  P    +N+A++ LRSFI+ +         GR+V+ +D +I+ +  +D
Sbjct: 1044 ELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKAD 1103

Query: 1077 KDIDNRNFLAEFGID 1091
            K I    ++    ID
Sbjct: 1104 KPIPLHEYITLAEID 1118

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1070 (40%), Positives = 620/1070 (57%), Gaps = 117/1070 (10%)

Query: 37   GTNSYASLSIQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVY 96
            G N+  S+ + E LVI LFTTK G SIL +            RY  W +S   S  D  Y
Sbjct: 45   GQNNEPSV-LLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES---SSGDLNY 100

Query: 97   KKLVKK-WTGSSDY-ISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTE---LLI 151
            K L  + W  + +Y +S   ++LL+N+       +++  +YKL +  L++ ++    L++
Sbjct: 101  KYLKHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLIL 160

Query: 152  IDDEYNLLLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFA 211
              D YNLLLDF++  +  + +L+S     +   +    ++R+++L+G + WYT +    A
Sbjct: 161  NSDNYNLLLDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLT---IA 217

Query: 212  EAQDICYKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSD 271
                I  +YL+   D L+      P I   F S    +    S+   L S          
Sbjct: 218  SNTSIAVRYLN---DVLSID----PMITDQFTSNYRDKAFQESEETLLMS---------- 260

Query: 272  SDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331
                 Q++ +  + I+SFDL + G L  PN+   +  RHQ +Y +L L Q +S P LK Q
Sbjct: 261  -----QQQTAKDDIIFSFDLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDS-PFLKKQ 312

Query: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLH--------SEIKQLPFNWRFHICF 383
            F  +C LVDP+TQP PN+ HIISIDL+  +F+GL++         + K+L     F ICF
Sbjct: 313  FLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQ---HFTICF 369

Query: 384  NLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILA 443
            N+QKI+  +L  LNC+D+  L+++ N D   D++  L+KWLP G+NTQDLEL+YMI+I+A
Sbjct: 370  NMQKIISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIA 428

Query: 444  IYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIR 503
            IY I+KLY + P+Q+NPFL +++SLWK L+ +VL+GLEIDR EE  ET+ TP++VRA IR
Sbjct: 429  IYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIR 488

Query: 504  GSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG 563
            G++ALR+V+AT+LN HV  K HDF+HE  N FMSPHGRKLC GAL  D+RSHAAA+LALG
Sbjct: 489  GAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALG 548

Query: 564  -IELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKEM 622
              EL DVT LL+DLQ GDRFDEDVKY+F+YEY +YN                    +++ 
Sbjct: 549  DGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYN------ELGEEDEQTNELEELEKR 602

Query: 623  RAYYKRCHCQFXXXXXXXXXXXXSGIPISHTRISKELPPDTNVKLSNTAKPVALRNKKDT 682
                +RC+C F              +     R    L  D      +   P ++R     
Sbjct: 603  SVKKRRCNCIFEDDKMLEDYEYYE-VGNESRREDMNLESD-----KSRTNPYSVR-VNSI 655

Query: 683  IEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLV 742
             EFD++G+DWRD+PRG N Y++ +Y+F K+ K G        A   +LS E+++ LL+ V
Sbjct: 656  FEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSV 715

Query: 743  STCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNE 802
            ++CV  EQE  +L +      S   +C +    D ++T D +YE WC++S F++M++ N+
Sbjct: 716  ASCVKLEQEKMILENY-----SNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNK 770

Query: 803  TLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEK------------ 850
             + WR+MDEMLMC+GYRRVL+WFITH+E+  S++ YI+ LVMG RG++            
Sbjct: 771  EVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLK 830

Query: 851  ------LANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXXX 904
                  +  ++    K+PFSRQG I+LSEIE KMLLQEFFTNAAIFFS     ++     
Sbjct: 831  SLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDS 890

Query: 905  XXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDL 964
                   +S Y +GL++L+CFMVK+L+  + FDF   +  FEL+TLLM+WI I+PEA++L
Sbjct: 891  E-----NVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQEL 945

Query: 965  FFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKL 1024
            FF L++ V + S +  K D D                TD N+G         +S YN KL
Sbjct: 946  FFTLKANVGEPSME-GKSDSDG---------------TDSNEG--------ELSWYNSKL 981

Query: 1025 ISLLPPVV--GTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSM 1072
            ++LLP     G EN A+  LRSF+ K+S T    V GR+VI  DD+I+ +
Sbjct: 982  LALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPI 1031

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1113 (39%), Positives = 630/1113 (56%), Gaps = 130/1113 (11%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSS 107
            E L+I LFTT  G S L+L    S     L   K W QS F++   + Y  +V  W  + 
Sbjct: 72   EALIITLFTTISGKSALRLIQTSS-----LKERKSWAQS-FEN-NSSSYASIVLSWKDND 124

Query: 108  DYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQ 165
              +   + +LL N +  L    +   EYKL ++FL+     +  +++++ YNLL D+L  
Sbjct: 125  ILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184

Query: 166  TRASVEELLSQA---DLPSLIAKSALS-HHRLFQLSGRYVWYTFSDERFAEAQDICYKYL 221
                +E L+S +   D P+L+ +  L  ++R+ +    Y WY+F+ E             
Sbjct: 185  ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAEN------------ 232

Query: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQ---- 277
                           ++   F S N S L    +G++    G++ DS  D    P+    
Sbjct: 233  ---------------RVNLTF-SDNISLLMENDEGNA--GSGLD-DSRFDHQKQPREAIM 273

Query: 278  -KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLC 336
             + ++  E+IYSF+L  DGTLE PNV   +  RH+ L+++L L     +P L+ QF TLC
Sbjct: 274  GRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTV-LTPLLELQFSTLC 332

Query: 337  ALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQS 391
             LVDP+ QPTPND HIISID L  +F+GL+   IK        ++W+F++CFN+QKI+ +
Sbjct: 333  GLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDA 392

Query: 392  TLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLY 451
            T+ RLNC DF  LNSVNN+D+++ W+  LH+WLP GLNTQDLEL+YMIDILA+Y I+KLY
Sbjct: 393  TMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLY 452

Query: 452  RDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSV 511
               P+Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV
Sbjct: 453  EKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSV 512

Query: 512  VATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTN 571
            +ATVLNG V+   HDF+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+
Sbjct: 513  IATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTD 572

Query: 572  LLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKEMRA----YYK 627
            L +DLQ GDRFDED++YMFDYE ++Y+                         +    + +
Sbjct: 573  LFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRR 632

Query: 628  RCHCQFXXXXXXXXXXXXSGIPISHTR-ISKELPPDTN-VKLSNTA---------KPVAL 676
            RC+C F                 +++  +   +  + N V  + TA          P+++
Sbjct: 633  RCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSV 692

Query: 677  RNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAV 736
            R++  T EFD++G DWRD+PR  N Y++ +Y F    K     +L    A  +L+KEE++
Sbjct: 693  RSRS-TFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESI 751

Query: 737  HLLRLVSTCVAKEQEHTV---LRSAFAA----DDSQALSCQSTLVADGDL---TTDYIYE 786
             L+R V++CV  EQ+  +   L S F+A    D     + + + + + DL   T D IYE
Sbjct: 752  LLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYE 811

Query: 787  NWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGN 846
             W ++S F++ML  N  + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ L+MG 
Sbjct: 812  IWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGL 871

Query: 847  RGEKLANEETPFGK--------------------LPFSRQGDIVLSEIEIKMLLQEFFTN 886
            RG+  + E +   K                    LPFSRQG IVLS+IE KMLLQEFF N
Sbjct: 872  RGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMN 931

Query: 887  AAIFFSKQLRESLGDXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFE 946
            AAIF S +  E   +          IS Y +GL+RL+C+MV++LI  + F F   +  FE
Sbjct: 932  AAIFLSSKNNEEENEDGEK------ISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFE 985

Query: 947  LETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDEND 1006
            L+TLLM+WI ILPEA+DLFF +++R+  +    A    D M                E  
Sbjct: 986  LQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSA----DTMQ--------------HEGR 1027

Query: 1007 GSSDSEE---TNSVSIYNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRR 1061
             +SD E+       S  N KL++L P  P    +++ +  LRSFI+ +S        GRR
Sbjct: 1028 KNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRR 1087

Query: 1062 VINHDDRIMSMYMSDKDIDNRNFLAEFGIDYND 1094
            V+ +D +I+ +  +DK I    ++    +D  D
Sbjct: 1088 VVFYDGKILPLPKADKPIPLHEYITLAELDVGD 1120

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1107 (38%), Positives = 605/1107 (54%), Gaps = 116/1107 (10%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSS 107
            E L I LFTT  G SIL+     S       + K W QS F++  ++ Y  +V  W  + 
Sbjct: 72   EALAITLFTTNSGKSILQ-----SIQTFTSKKRKLWAQS-FEN-NNSNYASIVFSWKDND 124

Query: 108  DYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQ 165
              +   + +LL N +  L    +   E+KL ++FL+     +  +++++ YNLL D+L  
Sbjct: 125  ILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLYS 184

Query: 166  TRASVEELL---SQADLPSLIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYL 221
                +EELL    + + P+L+ K  L  + R+ +    Y WY F+ E             
Sbjct: 185  ITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAEN------------ 232

Query: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLS 281
                   +A       I  L  S N++       GDS  +    +      D    + ++
Sbjct: 233  -------SAHLKFDDNIACLMGSENNTENG---LGDSRVNNN--NYHKQPKDVVMSRTIN 280

Query: 282  AHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDP 341
              E+IYSF+L  DGTLE PNV   +  RH+ L+++L L    S+P L+ QF TLC LVDP
Sbjct: 281  DQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPV-STPLLELQFSTLCGLVDP 339

Query: 342  VTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRL 396
            + QPTPND HIISID L  +F+GL++  IK        ++W+F+ CFN+QKI+ +T+ RL
Sbjct: 340  LMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRL 399

Query: 397  NCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPV 456
            NC DF  LNSVNN+D S+ WR  LH+WLP GLNTQDLEL+YMIDILA+Y I+KLY   P+
Sbjct: 400  NCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPI 459

Query: 457  QMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVL 516
            Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV+AT+L
Sbjct: 460  QLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATIL 519

Query: 517  NGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDL 576
            NG V+   HDF+HE +N FMSP+GRKL HGALY D+RSH+A++LA G  +EDVT+L +DL
Sbjct: 520  NGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADL 579

Query: 577  QPGDRFDEDVKYMFDYEYDNYNXX-XXXXXXXXXXXXXXXXXRIKEMRA----YYKRCHC 631
            Q GDRFDED++YMFDYE  +Y+                    +IK          +RC+C
Sbjct: 580  QSGDRFDEDIRYMFDYECADYDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNC 639

Query: 632  QFXXXXXXXXXXXXSGIPISHTRISKELPPDTNVKLSNTA-----------KPVALRNKK 680
             F                 +  R  +    +    +SNTA            P ++R  +
Sbjct: 640  IFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVR-AR 698

Query: 681  DTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLR 740
             T EFD++G DWRD+PR  N Y++ +Y F    K      L    A  +L++EE++ L+R
Sbjct: 699  STFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVR 758

Query: 741  LVSTCVAKEQEHTV---LRSAFAADDSQALSCQSTLVADGD------LTTDYIYENWCQD 791
             V++CV  EQ+  V   L++        A    ST ++  D       T D IYE W ++
Sbjct: 759  SVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEE 818

Query: 792  SLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKL 851
            S F++ML  N  + WR+MDEMLMC+GYRR+LIWF THLE+  S+I Y++ L+MG RG+  
Sbjct: 819  SAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAF 878

Query: 852  ANEETPFGK--------------------LPFSRQGDIVLSEIEIKMLLQEFFTNAAIFF 891
            + + +   K                    LPFSRQG I+LS+IE KMLLQEFF NAAIF 
Sbjct: 879  SGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFL 938

Query: 892  SKQLRESLGDXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951
            S    E   +          IS Y +GL+RL+C+MV++LI  + F F   +  FEL+TLL
Sbjct: 939  SSNNSEEENEDGEK------ISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLL 992

Query: 952  MSWICILPEARDLFFALRSRV----DQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDG 1007
            M+WI ILPEA+DLFF +++R+    D  +         ++     +N  P  +   +   
Sbjct: 993  MTWIGILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLS 1052

Query: 1008 SSDSEETNSVSIYNKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDD 1067
               S   ++                  EN+A+  LR+FI+ +S        GR+V+ +D 
Sbjct: 1053 LFPSNSADN-----------------GENSAINTLRNFITDYSFDTQVNPPGRKVVFYDG 1095

Query: 1068 RIMSMYMSDKDIDNRNFLAEFGIDYND 1094
            +I+ +  +DK I    ++    +D  D
Sbjct: 1096 KILPLTKADKPIPLHEYITLAELDVGD 1122

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1137 (36%), Positives = 619/1137 (54%), Gaps = 172/1137 (15%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLL--RYKKWQQSKFQSLPDAVYKKLVKKWTG 105
            E ++IG  +T+ G  +    +     +   L  +YKKW  S    +    ++ L KKW+ 
Sbjct: 74   ECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTST--DISKTAHQYLRKKWSS 131

Query: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELL---IIDDEYNLLLDF 162
            +  Y     ++LL N   +++   +    YKL + FL D +T L+   I+D++YNLL D+
Sbjct: 132  NKLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDY 191

Query: 163  LLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLS 222
            +               L   + K  L +     L G Y              D+ + Y  
Sbjct: 192  IYAC----------GPLLKCVMKDTLENGICLDLPGIYKLDI----------DLQFPY-- 229

Query: 223  VLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWP------ 276
                             P +D +      HL+           +  N++S++ P      
Sbjct: 230  -----------------PWYDLLPPMHEGHLNA----------TKQNNNSNNIPLTMQPS 262

Query: 277  -----QKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331
                     + ++ +YSFDL  D T E  NV   T +RH+ L Q++      ++P L  Q
Sbjct: 263  IKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQ 322

Query: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQL-----PFNWRFHICFNLQ 386
            F  +  LVDP++QP PN+  +IS+ LL  MFIGL++  +K+       FNW+FHICFN+ 
Sbjct: 323  FTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMV 382

Query: 387  KILQSTLPRLNCHDFQQL------------NSVNNSDDSIDWRRNLHKWLPQGLNTQDLE 434
            K++ +++  L C +F +L             + N+ DD+  W+  L++W+P G+NTQDLE
Sbjct: 383  KLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDDA--WKLKLNEWIPHGINTQDLE 440

Query: 435  LVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFST 494
            L+YMI+I+A+Y I++LY D P+QMNPFL+ +I+LWKNL+ ++LLGL+IDR EE ++TFST
Sbjct: 441  LIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFST 500

Query: 495  PVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRS 554
            P+LVRA IRG+++LR+VVAT+LN HV+   HDF+HEP+N FMSPHGRKLC GALY D+RS
Sbjct: 501  PLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRS 560

Query: 555  HAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXX 614
            HAAA+LALG ELEDVT+LL+DLQ GDRFDED++YMFDYEYD+YN                
Sbjct: 561  HAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYN---------DFKDDVE 611

Query: 615  XXXRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGIPISHTR------------ISKELP-- 660
                ++ M ++ +RC+C F                                 ++K+ P  
Sbjct: 612  EQEEMEIMGSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAIEGVTKDTPHN 671

Query: 661  ---PDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGA 717
               P   ++  N + P + R+K  + EFD+ G+DWRDIPRG N Y++ +Y F KS     
Sbjct: 672  NLNPHDAIRTRN-SHPNSKRSKS-SFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMET 729

Query: 718  AHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQE---------HTVLRSAFAADDSQALS 768
              TL + A   +L+ E++  L+  V++C+  EQ+         H  ++   AA++     
Sbjct: 730  ISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENED--- 786

Query: 769  CQSTLVADGDL---TTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWF 825
                   D D    T D IY+ W ++S F++ML+ N+ + WR+MDEMLMC+GYRRVLIWF
Sbjct: 787  -------DADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWF 839

Query: 826  ITHLEVTSSMIEYIYSLVMGNRGEKLANE------------ETPFGK------------L 861
            ITH+E+  S+I+YI+ LVMG RG   + E            E  +G+            L
Sbjct: 840  ITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYL 899

Query: 862  PFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQ------LRESLGDXXXXXXXNLGISPY 915
            PFSRQG ++LSEIE KMLLQEFFTNAAI+FS +           G+       N  +  Y
Sbjct: 900  PFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNNDNGEGIDEEAVNFSV--Y 957

Query: 916  IVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQ 975
              GL++L+CFMV+SL++   FDF   +  FEL+TLLM+WI I+PEA DLFF L+S V   
Sbjct: 958  STGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSS 1017

Query: 976  SRKPAKRDPDAMAT-ASVVNLSPDFRTTDENDGSSDSEET-NSVSIYNKKLISLLPPVVG 1033
            S K  +   D   T A  ++ S D  T        D++++  + SI+NK+L+SLLP  + 
Sbjct: 1018 STKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRIN 1077

Query: 1034 --TENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEF 1088
               EN AV+ LR FI ++S      V+GR+V+  D+ ++ +  +D+ I    +L E 
Sbjct: 1078 DKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1102 (36%), Positives = 612/1102 (55%), Gaps = 136/1102 (12%)

Query: 45   SIQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWT 104
            S+ E+ V+ LFTT  G  + ++  +L  G  +L +            P  + +++   WT
Sbjct: 10   SLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSK-----------TPSRIVQQVRTAWT 58

Query: 105  --GSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQD--TELLIIDDEYNLLL 160
                S YI    +++ R+       + +    +KL ++ L   +     L+++ +Y++LL
Sbjct: 59   EEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLL 118

Query: 161  DFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAE-------- 212
            DF+   R  ++ L+ QA   SL+      + R+++    + W+  S ++FA         
Sbjct: 119  DFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNK 178

Query: 213  -AQDICYKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSD 271
               D+ + Y++    K  A  D+ P + P         L  L +G+              
Sbjct: 179  GTPDLFHYYINSFCSK--APYDVHP-LHPF--------LGELFEGN-------------- 213

Query: 272  SDHWPQKKLSAHERIYSFDLKDDGTLESPN------VFGRTRRRHQALYQVLRLQQQNSS 325
             ++   ++L  +E +Y FDL ++    S N      +  ++ +RH+ L ++L L++ + S
Sbjct: 214  -NNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEID-S 271

Query: 326  PCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLL--HSEIKQLPFNWRFHICF 383
            P L  QF  + +LVDP+TQP P+D++++S+DLL  +F+  L  + + +Q   N  F +CF
Sbjct: 272  PHLYEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDTEQ---NDTFLLCF 328

Query: 384  NLQKILQSTLPRLNCHDFQQLNSVNNSDDSID-----WRRNLHKWLPQGLNTQDLELVYM 438
            N+QKI+  TL RL C D+ +L S++      D     +R +L +W+P GLNTQDLEL+YM
Sbjct: 329  NMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYM 388

Query: 439  IDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLV 498
            +DI+A+Y I+  Y   P+Q+NPFL+ +ISLWKNL+ V+LL LE+DR EE  +TF TP+LV
Sbjct: 389  VDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLV 448

Query: 499  RAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAA 558
            RA IRG+SALR+VVA VLNGHV    HDF+HEP+N FMSPHGRKLC G+LY D+RSHAAA
Sbjct: 449  RATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAA 508

Query: 559  MLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXR 618
            ML+LG++LEDVT LLSDLQPGDRFDED++YMF+YEY++YN                    
Sbjct: 509  MLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATA 568

Query: 619  IKEMR---------AYYKRCHCQFXXXXXXXXXXXXSGIPISHTRISKELPPDTNVKLSN 669
                          +  +RC+C F              I    +++S             
Sbjct: 569  SAAAITAANEGTGASQKRRCNCIFTDDKI---------IQSDESKVSLG---------GG 610

Query: 670  TAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQ 729
              +P ++R K  + EFD++G DWRD+PRGLN YF  +Y+F           + + AA  +
Sbjct: 611  KNRPYSVRTKS-SFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGK 669

Query: 730  LSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWC 789
            L+  E+  LL+LV++ +  EQE  ++ + +   +  A+        DG LT D IY+ W 
Sbjct: 670  LNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVG------DDGLLTPDNIYDAWF 723

Query: 790  QDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGE 849
            QD +FD++LF N+ L W++MDE+LMC GYRRVL+WF+TH+E+  S+I YI+ LVMG RG+
Sbjct: 724  QDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQ 783

Query: 850  KLANE-----------------ETP-FGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFF 891
            +L+ +                 +TP  G L FSRQG++ LSEIE+KMLLQEFFTNAAIF 
Sbjct: 784  ELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIFL 843

Query: 892  SKQLRESLGDXXXXXXXNLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951
            S    E              +S Y +GL++L+CFMVK+LI    F+F   +  FEL+TLL
Sbjct: 844  SASESEE------PESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLL 897

Query: 952  MSWICILPEARDLFFALRSRV-DQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSD 1010
            M+W+ I+P+A++LFF L+  + D ++         A+     +     F T  + D  ++
Sbjct: 898  MNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDI-----FPTLTDADDDNN 952

Query: 1011 SEETNSVSIYNKKLISLLPPVVGTENT----AVTALRSFISKHSLTMGTAVFGRRVINHD 1066
            +   N +S +NKKL+ LLP    +E      A+ ALR+F+ KHSL+    V GRR++   
Sbjct: 953  AVAEN-LSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRG 1011

Query: 1067 DRIMSMYMSDKDIDNRNFLAEF 1088
             +I+     ++ +  R +L  +
Sbjct: 1012 SQILPQATPERTVTLREYLGSY 1033

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1191 (34%), Positives = 626/1191 (52%), Gaps = 186/1191 (15%)

Query: 34   EARGTNSYASLSIQ-EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLP 92
            E R        SI  E LVI  FTTK G SIL   ++                   +  P
Sbjct: 104  EMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDT------------------KRKP 145

Query: 93   DAVYKKLVKK-WTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLL------DQ 145
              V  K+++K W  +       +++L+RN +  ++   F   E KLS+ FLL      + 
Sbjct: 146  PTVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNI 205

Query: 146  DTELLIIDDEYNLLLDFLLQTRASVEELLSQA--DLPSLIAKSALSHHRLFQLSGRYVWY 203
            +T  +I+D  YN+L D+L  T   +  L+     ++      + + ++R+ Q +G + WY
Sbjct: 206  ETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265

Query: 204  T-FSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQI-------------------QPLFD 243
            T   +++    ++      +  ++K+ + +  I  I                   +P+  
Sbjct: 266  TSLPNDKPLYIKESSNSCNTSSSNKILSSESFIEIITRSNHDFEDDKSFKMSKTSKPVVL 325

Query: 244  SVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSF-------------- 289
                  L+ LS  DS  S   +++ N +  ++PQ + + ++   ++              
Sbjct: 326  WAIEEILSRLSFKDS--SRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDY 383

Query: 290  -----DLKD------------DGTLESP-NVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331
                 DLKD            DG++  P N+   T++RHQ L ++L     +SSP L+ Q
Sbjct: 384  LHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQ 443

Query: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHS--EIKQ--LPFNWRFHICFNLQK 387
            F  +  LVDP++QP PND HIIS+DLL  +FI +L+   EI Q  L FNW+ H+CF + K
Sbjct: 444  FKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVK 503

Query: 388  ILQSTLPRLNCHDFQQLNSV------NNSDDSI-------------------DWRRNLHK 422
            I+ + + +LNC+D Q+L  +      NN ++ +                   +WR  L +
Sbjct: 504  IINNCMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQ 563

Query: 423  WLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEI 482
            WLP GLNTQDLEL+YM+ ILA Y + KL  + P+Q+NPFL ++I+LWK LT +++LGL+I
Sbjct: 564  WLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDI 623

Query: 483  DRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRK 542
            DR EE  ET+ TP+LV+A IRG+SALRSVVAT+LN ++EY  HDF+HE +N FMSPHGRK
Sbjct: 624  DRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRK 683

Query: 543  LCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXX 602
            LC+GALY D++  AA++ ALG++L ++ NLLS L+PGDRFDED+ YMF+YEYD+YN    
Sbjct: 684  LCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALK 743

Query: 603  XXXXXXXXXXXXXXXR-----IKEMR--AYYKRCHCQFXXXXXXXXXXXXSGIPISHTRI 655
                                 + E++   Y +RC+C F            +G      + 
Sbjct: 744  ENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGDEQQGEQE 803

Query: 656  SKELPPDTNVKLSNTAKPVALRN------KKDTIEFDFNGRDWRDIPRGLNFYFNENYDF 709
             +E  P     +++   P+  RN       K T EFD++G+DWRDIPRG N Y++ +Y F
Sbjct: 804  EQEGTPKN---VASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSF 860

Query: 710  EKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADD------ 763
                       L + A+ ++L+ ++++ LL+L+++ + +EQ   +++      D      
Sbjct: 861  IDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNI 920

Query: 764  ------SQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSG 817
                  S+    +ST+VA    T D I++ W    +F +ML  NE L WR+MDEMLMC+G
Sbjct: 921  INPLVNSKEEKERSTVVA----TPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNG 976

Query: 818  YRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLAN---------EETPFGK-------L 861
            YRRVLIW+ITH+++  S+I+YI+ L+MG RG   AN          E   GK        
Sbjct: 977  YRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHTY 1036

Query: 862  PFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXXXXXXX------------- 908
            PFSRQG ++LS+IE KMLLQEFF+NAAI+F   L  + GD                    
Sbjct: 1037 PFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENN 1096

Query: 909  -NLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFA 967
             N G+S Y +GLM+L+C MV SLI+ + FDF   D  FEL+TLLM+WI IL EA++LFF 
Sbjct: 1097 ENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFK 1156

Query: 968  LRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKLISL 1027
            L+S +++ S      D D          S D R + E++G  +      ++ +NK+L+ L
Sbjct: 1157 LKSDIEETSESTDGGDDDDFE-------SIDSRKSSESNGKWEGSRIGKMNDFNKRLLRL 1209

Query: 1028 LPPVVGTE-----NTAVTALRSFISKHSLTMG-TAVFGRRVINHDDRIMSM 1072
            L P+   +     +T  T  R  +  +S T     V GR+V+  DD I+ +
Sbjct: 1210 LAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1114 (36%), Positives = 606/1114 (54%), Gaps = 124/1114 (11%)

Query: 46   IQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTG 105
            I E  VI LFTT+PG+S+L      +C   N    +  +     SL   +  +L  KW  
Sbjct: 52   ITEVTVIALFTTRPGISLL------NCLTDNFGIDEDNKDFNPNSLLPRM-PQLALKWMH 104

Query: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTE----LLIIDDEYNLLLD 161
                +   + +++ N +  +++ +      KL + FL+  +T     L ++ +E +++ +
Sbjct: 105  DELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVRE 164

Query: 162  FLLQTRASVEELLSQA--------DLP-SLIAKSALSHHRLFQLSGRYVWYTFSDERFAE 212
            +L      ++ ++  +        D   S   ++ LS+ RL++    + +Y +S  +   
Sbjct: 165  YLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMK-TN 223

Query: 213  AQDICYKYLSVLTDKLTAQQDLIPQIQPLF---------DSVNSSRLAHLSQGDSLYSEG 263
              DI   Y+  L   LT   +   Q+  L           S N S+   +    S+  + 
Sbjct: 224  GSDI---YVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPL--SVDPDD 278

Query: 264  VESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVL---RLQ 320
             E + N ++D+  Q  L                L+ P++   T +RH AL +++   +L+
Sbjct: 279  GEVEENQETDNILQPSL----------------LDFPDLMNETAKRHLALSKLIIDSKLE 322

Query: 321  QQ-NSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEI-KQL----P 374
            +Q ++SP L+ Q+ TL AL+DP+TQP PND+H+ISIDLL +MF+GL+   I  QL     
Sbjct: 323  KQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDG 382

Query: 375  FNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLE 434
             +WRFHICFN+Q+I+ ++L  LNC+DF++L +V   D+S DWR  LH WLP+GLNTQ+LE
Sbjct: 383  VDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLE 439

Query: 435  LVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFST 494
            LVYM  ILA+Y I+KLY D PV  NPFL+S+ISLWK+LT VVL GL+IDR EE  ++F T
Sbjct: 440  LVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDT 499

Query: 495  PVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRS 554
            P++VRA IRG++ALRS+VATVLN  +E KRHDF HE +N FMSPHGRKLC GALY D+++
Sbjct: 500  PIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKA 559

Query: 555  HAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXX 614
            + A++LALG E ++VT+L+S LQ GD+FDEDVKYMF+YEY++YN                
Sbjct: 560  YTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEIYEDSSNENEENEEI 619

Query: 615  XXXRIKEMRAYYKRCHCQFX------------XXXXXXXXXXXSGIPISHTRISKELPPD 662
                 K      +RC+C F                         G   + ++   E   +
Sbjct: 620  DYAFNK------RRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTEKTIE 673

Query: 663  TNVKLSNT-AKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTL 721
            ++  LSN  +KP A+R+K +  EFD++G+DWRDIPR  N Y++  Y+F           L
Sbjct: 674  SDSGLSNQLSKPHAVRSKSN-FEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVL 732

Query: 722  MNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTT 781
               A   +L+KEEA  LL  V++ V  EQ+  +  +    D S           +   T 
Sbjct: 733  TLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEA--TP 790

Query: 782  DYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYS 841
            D IYE WC++S F+++L  N  L W++MDEMLMCSGYRRVLIWFITH+E++ S+I YI+ 
Sbjct: 791  DDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFD 850

Query: 842  LVMGNRG----EKLANEETPF----------GKLPFSRQGDIVLSEIEIKMLLQEFFTNA 887
            L+MG+RG    +   N ++ F            L FSR G + LSE+E +M+LQE FTNA
Sbjct: 851  LMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELFTNA 910

Query: 888  AIFFSKQLRESLGDXXXXXXXNL----------GISPYIVGLMRLVCFMVKSLIQEEMFD 937
            AI+FS + R+S                      G S Y VGLM+L+C MV  LI+   F+
Sbjct: 911  AIYFSDKARKSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFN 970

Query: 938  FKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSP 997
              + D +FEL+TLLM WI ILPEA++L F + S + + S      +   +A+    +   
Sbjct: 971  VNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSH----VENSELASIEGASTKS 1026

Query: 998  DFRTTDENDGSSDSEETNSVSIYNKKLISLLPPVVG--TENTAVTALRSFISKHSLTMGT 1055
              +  D+N  S           YN+ L+ L+PP  G   EN      R +I  +S     
Sbjct: 1027 HKQLVDKNSESYK---------YNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEV 1077

Query: 1056 AVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFG 1089
            +   R++I+  D I+ +  S+K     ++L E+G
Sbjct: 1078 STMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/970 (35%), Positives = 545/970 (56%), Gaps = 71/970 (7%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSS 107
            E L I LFTTKPG  IL  +   + G  + + +     + F S     Y+ L   W    
Sbjct: 118  ELLTIALFTTKPGNKILHFFK--NTGLDSAIEHNDSDDTLFHS---PAYEHLKMLWKWED 172

Query: 108  DYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLL----DQDTELLIIDDEYNLLLDFL 163
            +Y+  L++++L+N +  +D  ++    YK  + FLL    +      ++ +E+N+L ++L
Sbjct: 173  EYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSEEFNILEEYL 232

Query: 164  LQTRASVEELLSQADLPSLIAKS----ALSHH---RLFQLSGRYVWYTFSDERFAEAQ-- 214
               +++++  ++ A + S I K      ++ H   R+ + +  Y+ Y  +D+  A  Q  
Sbjct: 233  YAAQSNIKSKIAIA-IQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRYEITDDENALCQFD 291

Query: 215  ----DICYKYLS-VLTDKLTA---QQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVES 266
                D+  ++   V TD + A   Q   I +++ +  ++         +GD  + +G   
Sbjct: 292  ESLLDVLLEFERYVTTDDIEAILLQSGRINKVKDISSAI--------ERGDYKWEQGTLR 343

Query: 267  DSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNS-S 325
             S + ++H   K  +  E I SFD+ ++G  E PN+   +  RH  L++ L L Q+N+ +
Sbjct: 344  -SLTPNNH---KADNEEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRNTLA 399

Query: 326  PCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEI----KQLPFNWRFHI 381
            P L+ QF TL  LVDP+TQPTPND+HIISIDLL  ++ GL+H  +    K   ++W++  
Sbjct: 400  PYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARNYDWKYLC 459

Query: 382  CFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDI 441
             FNL KI+  +L +L+C  +  LN++ N ++  DWR+ L  W+P+ LNTQDLEL+YMIDI
Sbjct: 460  GFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLELLYMIDI 519

Query: 442  LAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAA 501
            L++Y I+KLY D+P+Q NPFL  + S+WK +T ++ LGL++DR EE+ ++  TP+++RA 
Sbjct: 520  LSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRAT 579

Query: 502  IRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLA 561
            +RG+SA R+ + T+LN  +E   HDF+HEPIN FMSPHGRKLC G+LY D+R      + 
Sbjct: 580  VRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRVSTKIFVE 639

Query: 562  LGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXXXXXXXXXXXXXRIKE 621
             G+EL+D+TNLL+DLQPGDRFDEDV+YMFDYEY++YN                   R   
Sbjct: 640  NGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDEKADNESDGVRPAP 699

Query: 622  MRAYYKRCHCQF-----XXXXXXXXXXXXSGIPISHTRISKELPPDTNVKLSNTAKPVAL 676
            +   ++RC+C F                 + + + +  IS +   D  +K+ +  +P  +
Sbjct: 700  I---FRRCNCVFEDDKIMDESTIDHQSLITDMELENNAISTKDEND-KIKIISQPEPFTV 755

Query: 677  RNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAV 736
            R  +   +F++ G+DWRDIPRG N Y+N  + F +        +  + A    L   E+ 
Sbjct: 756  R-MRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKAVNSVLDISESN 814

Query: 737  HLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDK 796
             L++LV++C+ +EQ+  V+    +      L   +  V    LT D IY+     + F K
Sbjct: 815  RLIQLVASCIREEQDRMVIYHGMS-----QLPLANGDVNKSKLTVDEIYDQISSSNNFAK 869

Query: 797  MLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNR-----GEKL 851
            ML+ +  L   +MDE+LM  GYRRVLIWF+TH+ +T  +I YI+ LVMG R     G+  
Sbjct: 870  MLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHYIFELVMGYRVGFSDGDAN 929

Query: 852  A--NEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXXXXXXXN 909
               N+++  GK  FSR G + LS IE +MLLQEFF NA +  S +  ES G        N
Sbjct: 930  GDNNKKSSTGKCGFSRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDN 989

Query: 910  LG-----ISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDL 964
                   IS Y VG++ L+C MVK+L++    D    +Y  EL+TLL++WI ++PEA++L
Sbjct: 990  ADEDNEYISSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKEL 1049

Query: 965  FFALRSRVDQ 974
            FF L+    +
Sbjct: 1050 FFFLKQEAHE 1059

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  536 bits (1380), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 321/805 (39%), Positives = 461/805 (57%), Gaps = 57/805 (7%)

Query: 306  TRRRHQALYQVL---RLQQ--QNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSD 360
            T RR   LY+VL   +L+Q    S   +   F  +CALVDP+TQP PND H+IS+DLL  
Sbjct: 285  TERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYK 344

Query: 361  MFIGLLHSEIKQL-----PFNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSID 415
            +F+ ++   ++ L      ++WR+ I  NLQKIL      LNC+D ++LN V   D++  
Sbjct: 345  IFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV---DETKH 401

Query: 416  WRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFV 475
            W+  LH WLP GLN Q+LEL+YMI I  +Y I KLY D+P+  NPFL +++S WK LT+V
Sbjct: 402  WKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTYV 461

Query: 476  VLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIF 535
            +L GL++DRFEEE E+F+TP++VRA IRG+SALRSVVA++LN  ++ K+HDFQHEP+N F
Sbjct: 462  MLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNTF 521

Query: 536  MSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYD 595
            MSPHGRKLC GALY D++S+ A+MLA G+E +D+T LLS LQPGD FDEDVKYMF+YEYD
Sbjct: 522  MSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEYD 581

Query: 596  NYNXXXXXXXXXXXXXXXXXXXRIKEMRAYYKRCHCQFXXXXXXXXXXXXSGIPISHTRI 655
            +YN                    IK      +RC C F                 S    
Sbjct: 582  DYN-EPEEDESDEDGERNNSEENIK-FNFNRRRCRCVFSDDDVLEHGDFNDA--NSEYSN 637

Query: 656  SKELPPDT-NVKLSNTA--KPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKS 712
            S+E   D  N  L N    KP      K+ +EFDF+G+DWR +PR LN +++ +Y F ++
Sbjct: 638  SEENSNDVDNFVLPNDGIDKP------KNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIEN 691

Query: 713  VKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQST 772
                   +L++ A+   LSK+++  LLR +++ +   Q+  +L S  + + + +   Q+ 
Sbjct: 692  PLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRILGSKRSPNGTDSSKSQNG 751

Query: 773  LVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVT 832
            L + GDL      +       F+ +L  N  L   +MDE+LM  GYRRVL+WF+THL ++
Sbjct: 752  L-STGDLI-----KLITAGDTFENILKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLS 805

Query: 833  SSMIEYIYSLVMGNRGEKLANEETPFGKLP--FSRQGDIVLSEIEIKMLLQEFFTNAAIF 890
             ++I YI+ L+M +RG+ +++ E    +L   FSRQG++ LS++E +MLLQEFFTNA +F
Sbjct: 806  HTIIYYIFELLMHHRGQ-VSDTEREQSELSYTFSRQGELRLSDLEREMLLQEFFTNATMF 864

Query: 891  FSKQLRESLGDXXXXXXXNLGI-------SPYIVGLMRLVCFMVKSLIQEEMFDFKDPDY 943
            FS +      D       N  +       S Y VGLMR+ C M+ SL     FD    + 
Sbjct: 865  FSSKSVLFASDTGDNNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSES 924

Query: 944  IFELETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTD 1003
            IFEL+TLLM WI I+PEA+ LFF L+  V    +     D   + +    + +    T D
Sbjct: 925  IFELQTLLMGWINIIPEAKLLFFKLKESV----KSFNGIDNPELKSIEESSTTTKKTTID 980

Query: 1004 ENDGSSDSEETNSVSIYNKKLISLLPPVVGTENTAV--TALRSFISKHSLTMGTAVFGRR 1061
            EN     SE+      +NKKL+   P     ++  +     + F+  +S        GR+
Sbjct: 981  EN-----SEQYR----FNKKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRK 1031

Query: 1062 VINHDDRIMSMYMSDKDIDNRNFLA 1086
            VI   D I+ +   +K I    FL+
Sbjct: 1032 VIYESDEILQLTDIEKPISLHKFLS 1056

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  478 bits (1229), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 354/1154 (30%), Positives = 557/1154 (48%), Gaps = 167/1154 (14%)

Query: 48   EKLVIGLFTTKPGLSILKLYYELSCGRIN-------LLRYKKWQQSKFQSLPDAVYKKLV 100
            EKLVI LFTT PG +++         R N       L+R           + D  +  L 
Sbjct: 25   EKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECLIR-----------MNDPYWVALF 72

Query: 101  KKWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLL-DQDTELLI-IDDEYNL 158
              W      +S  + ++LRN++  +D   +    +K++M FLL +QD +    + D  N+
Sbjct: 73   GTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNI 132

Query: 159  LLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDE-RFAEAQDIC 217
            LLD+L   +  +E +L + D  S   +  + ++RL++ +G Y W+T       AE+    
Sbjct: 133  LLDYLHNAKPLIESVLKKLD-GSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTI 191

Query: 218  YKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQ 277
             +  S     L             F +     L+ L  GD   +       NS  ++ P 
Sbjct: 192  LERNSTFLSTLGN-----------FGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPL 240

Query: 278  KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCA 337
             K   H  +              N+ G++ R +  L+  L L ++   P L  QF +LC 
Sbjct: 241  SKQDDHNPL--------------NLNGKSDRFN--LFFKLGLHKE-PHPLLAEQFNSLCL 283

Query: 338  LVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLPFN----WRFHICFNLQKILQSTL 393
              DP+TQP PNDSHIIS+DLL D+++G L + I +L  N    W+ H+  NL+ I  + L
Sbjct: 284  FADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVKLIPNYQKVWKIHLSANLETITLAIL 343

Query: 394  PRLNCHDFQQLNSVNN----SDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHK 449
              L   D++ L+++ +    S D+  + + +  W+P  L+  ++E++YMI  L+ Y +HK
Sbjct: 344  QMLQIWDYRSLDNLKDIQARSPDA--YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHK 401

Query: 450  LYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALR 509
            ++ D+P ++NPFL  M+  W+ L+  ++LGL+IDRFEE Q  + TPV+V A IRG+SALR
Sbjct: 402  MHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALR 461

Query: 510  SVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDV 569
            S++AT+LNGHV+ K HDF+H+P   FMSPHGRKLC+GALYT    + AA+L  G++ +++
Sbjct: 462  SIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEI 521

Query: 570  TNLLSDLQPGDRFDEDVKYMFDYEYDNYNXXXXXXXX------XXXXXXXXXXXRIKEMR 623
              LL+D+Q GDR DEDV+YMFDYEY +YN                         R + +R
Sbjct: 522  VELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLR 581

Query: 624  AYYKRCHCQFXXXXXXXXXXXXSGIPI-----------SHTRISKELPPDTNVKLSNTAK 672
              YKRC C+F                             + +I++   P T  + SN   
Sbjct: 582  GLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVA 641

Query: 673  PVALRNKKD---------TIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMN 723
              +L   +D         T  +D NG DWRDIPRGLN Y+ ++Y F   + + +   L+ 
Sbjct: 642  FTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLR 701

Query: 724  SAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLR--SAFAAD-DSQAL--SCQSTLVA--- 775
               +R ++  +A  +LR ++TCV  EQE  +L+  +A +A+ D + L  S    + A   
Sbjct: 702  RLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEVITAIFN 761

Query: 776  -DGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSS 834
             DG +   + +   C DS           L W+I DE++M  G+RR+LI+ +TH   T S
Sbjct: 762  DDGGIIKPFPFSG-CNDS-----------LGWKIFDELMMSHGHRRLLIYHLTHRSYTFS 809

Query: 835  MIEYIYSLVMGNRG--------EKLANEE------TPFGK------LPFSRQGDIVLSEI 874
             I Y+Y L+ G RG        E   N++      TP G+      + FSRQG I LS I
Sbjct: 810  SIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAI 869

Query: 875  EIKMLLQEFFT----------NAAIFFSKQLRES----LGDXXXXXXXNLGISPYIVGLM 920
            E KMLLQEFF           N A F +  ++      + D              + G +
Sbjct: 870  EKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKV 929

Query: 921  RLVCFMVKSLIQEEMFDF-KDPDYIFELETLLMSWICILPEARDLFFALRSRV------- 972
            ++VCF+++ ++ ++ F+F    DY++EL+  LM W     EA  ++  L+S+        
Sbjct: 930  KMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDL 989

Query: 973  ------DQQSRKPAKR----DPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNK 1022
                  D+ +  P  +    D D +  + +     D R   E D S   E  +  SI ++
Sbjct: 990  GTEGLDDRPNTDPDDQLLPVDFDKLKLSDI-----DDRWDTETDTS--IENGDKTSIMSE 1042

Query: 1023 KLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNR 1082
            +   +LP             R  + K+ LT GT + GR  + + D I+ + +      +R
Sbjct: 1043 RFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHR 1102

Query: 1083 NFLAEFGIDYNDFV 1096
             FLA F IDY D +
Sbjct: 1103 EFLAVFDIDYLDIL 1116

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1307

 Score =  402 bits (1033), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 254/653 (38%), Positives = 365/653 (55%), Gaps = 93/653 (14%)

Query: 20  ETLPKLVDPKPNES-------EARGTNSYASLSIQEKLVIGLFTTKPGLSILKLYYELSC 72
           ++LP  +D KPN          A+  + Y    + E L++ LFTT  GLS+L +   L  
Sbjct: 12  DSLP--IDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKS 69

Query: 73  ------GRINLLRYKKW-----QQSKFQSLPDAVYK----------------------KL 99
                  + NL+          + +K ++L   V +                      KL
Sbjct: 70  FTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKL 129

Query: 100 VKKWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQD------------- 146
           ++KW      +    +++L+N +  L+Y +F+    KL + FLL  D             
Sbjct: 130 LEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQK 189

Query: 147 -----TELLIIDDEYNLLLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSG--R 199
                   L++D  YNLLLD+L  +   +  LL     P L      S+++ F+L+   +
Sbjct: 190 LFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNK 249

Query: 200 YVWYTFSDER-------FAEAQDICYKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAH 252
            +WY F D +            DI   +L +    +     L  +I     +++SS    
Sbjct: 250 CLWYDFIDSKDTTNFGTITNCIDIINNFLEIF--DMHKNFTLNAEISNSLFNISSSS--- 304

Query: 253 LSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDD----GTLESPNVFGRTRR 308
            +   ++++E   +D N   D     + S  E   SF+L ++    G L  P++     +
Sbjct: 305 -TTKSNMHNENEGADLNLLMD-----ENSMGEHTLSFNLFENNINHGILH-PDLMAHISK 357

Query: 309 RHQALYQVLRLQQQN---SSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGL 365
           RH  L ++L +   +   +SP L  QF  LCALVDP+TQPTPN  +IISIDLL  +F+G 
Sbjct: 358 RHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGF 417

Query: 366 LHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNL 420
           L  E+ +        NW+F +CFN++KI+ S + +LNC DF  LNS+NNSD+S+ WR  L
Sbjct: 418 LKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQL 477

Query: 421 HKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGL 480
           HKWLP+G NTQDLEL+YM++ILA Y I+KL  D P+Q+NPFL+SM+S WKNL+  +LLGL
Sbjct: 478 HKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGL 537

Query: 481 EIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHG 540
           EIDR EEE ETF TP++VRA +R S+ALRS++AT+LN HV    HDF+HE +N FMSP+G
Sbjct: 538 EIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYG 597

Query: 541 RKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYE 593
           RKLC+GALYTD RSHA+ +LAL  +LE VT L+SDLQPGDRFDEDVKYMF++E
Sbjct: 598 RKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFE 650

 Score =  270 bits (691), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 172/498 (34%), Positives = 257/498 (51%), Gaps = 74/498 (14%)

Query: 667  LSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAA 726
            L+N    V  +N ++  +FD+NG+DWRD PRG+N Y+N NY+F +         L   A 
Sbjct: 807  LNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKAT 866

Query: 727  ERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADD-------------SQALSCQSTL 773
              +L K+++  LLRLV++ V  EQ+  +      + +             ++ L      
Sbjct: 867  NMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNR 926

Query: 774  VADGD-------LTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFI 826
            + +G+       +T D IYE WC++S F++M+  N  + +R+MDEMLMC GYRRVLIWFI
Sbjct: 927  IENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFI 986

Query: 827  THLEVTSSMIEYIYSLVMGNRGEKLANEETP----------------------------F 858
            THLE++ S+I YI+ LVMG RG    N  T                             +
Sbjct: 987  THLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLNDY 1046

Query: 859  GK-----LPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDXXXXXXXNLG-- 911
             K     LPFSRQG+I LSEIE KML+QEF TNAAI F++  R +L         +    
Sbjct: 1047 SKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNE--RNNLKHNPNSNDNSNSNE 1104

Query: 912  -----------ISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE 960
                       IS Y +GLMRL+CFM+++ +       +  D IFEL+TLLM+WI I+PE
Sbjct: 1105 DNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPE 1164

Query: 961  ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTT-DENDGSSDSEETNSVSI 1019
            A+ LFF ++  +          + + +      N + + +T+ D ND   +S + +S S 
Sbjct: 1165 AKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSKDNNDKMDESSKVDSNSS 1224

Query: 1020 YNKKLISLLPPVVGT---ENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSD 1076
            +NKKLI L P +  T   ENTA+  L++++ K        + GR+VI  D +I+ + ++ 
Sbjct: 1225 FNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKIPIN- 1283

Query: 1077 KDIDNRNFLAEFGIDYND 1094
              ID  N   +   DYND
Sbjct: 1284 -IIDEYNQWNDQIYDYND 1300

>NCAS0A09390 Chr1 complement(1862500..1864365) [1866 bp, 621 aa]
           {ON} Anc_1.281 YJL085W
          Length = 621

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 162 FLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDER 209
           F+L     VEE++ +++L SL+   A  H RL +L  RYV Y  SD R
Sbjct: 473 FILTNIILVEEIIEKSELNSLLG--AEGHQRLDKLKKRYVSYLVSDWR 518

>TBLA0C02870 Chr3 complement(690489..692366) [1878 bp, 625 aa] {ON}
           Anc_1.281 YJL085W
          Length = 625

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 161 DFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDER 209
           +FL+   A V +++ ++DL SL+  +   H RL +L  RY+ Y  SD R
Sbjct: 474 NFLISNLAMVGQIVEKSDLNSLLGMTG--HSRLDKLQKRYINYIVSDWR 520

>Smik_6.332 Chr6 (522940..524292) [1353 bp, 450 aa] {ON} YPL133C
           (REAL)
          Length = 450

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 298 ESPNVFGRTRRRHQALYQVLRL--QQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIISI 355
           +SPN   +  R+ Q   + L L    +NS+P  K QFF   A  DP T+ TP D   + I
Sbjct: 204 DSPNNASKANRQDQQKEESLTLTNANENSAPTPKEQFFLTAA--DPSTEMTPEDRLKLVI 261

Query: 356 DLLSDMFIGLLHSEIKQLPFNW 377
           +  + +  GLL       P+N+
Sbjct: 262 N--AKLEAGLLK------PYNY 275

>Skud_10.128 Chr10 (240794..242665) [1872 bp, 623 aa] {ON} YJL085W
           (REAL)
          Length = 623

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 162 FLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDER 209
           F+L     VE+++ +++L S+IA     H RL +L  RYV Y  SD R
Sbjct: 475 FILMNLTLVEQIVEKSELNSMIAGEG--HSRLERLKKRYVSYMVSDWR 520

>Smik_10.287 Chr10 (449576..450592) [1017 bp, 338 aa] {ON} YJR008W
           (REAL)
          Length = 338

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 171 EELLSQADLPSLIAKSALSHHRL-----FQLSGRYVWYTFSDERFAEAQDICYKYLSVLT 225
           E +  + ++  L A+S LSHH++      ++  RY   T SD   AE  D   +YL +  
Sbjct: 221 EAIQEETEVEMLTARSKLSHHQVPIWQSIEIMDRYAMKTLSDTPNAERYDAWKQYLEITG 280

Query: 226 DKLTAQQDL 234
           + +  ++ +
Sbjct: 281 NTICGEKPI 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,039,364
Number of extensions: 5058056
Number of successful extensions: 15575
Number of sequences better than 10.0: 43
Number of HSP's gapped: 15774
Number of HSP's successfully gapped: 59
Length of query: 1105
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 985
Effective length of database: 39,721,479
Effective search space: 39125656815
Effective search space used: 39125656815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)