Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_47.186505.524ON2159174172730.0
KLTH0G03696g5.524ON208590814861e-170
SAKL0G04862g5.524ON24447136156e-63
Ecym_40605.524ON22017244625e-45
TDEL0A038805.524ON16965184364e-42
ZYRO0D12496g5.524ON23853183642e-33
KLLA0A01826g5.524ON14642333442e-31
KNAG0C032605.524ON15304553076e-27
CAGL0F03003g5.524ON11852422833e-24
ADR200C5.524ON23382232728e-23
SAKL0H23188g4.150ON12622332512e-20
Ecym_73494.150ON11292552512e-20
Kwal_47.177034.150ON15681042484e-20
Suva_2.5975.524ON1797832422e-19
Kpol_363.145.524ON7612702375e-19
YDR420W (HKR1)5.524ON1802832361e-18
KLTH0E08844g4.150ON1520972351e-18
Smik_4.6955.524ON1555992234e-17
AGR019C4.150ON1105952207e-17
Skud_4.6945.524ON1504832208e-17
NDAI0K025804.150ON9851002199e-17
KAFR0E033205.524ON1190912172e-16
KLLA0C17985g4.150ON9081032144e-16
ZYRO0G11242g4.150ON14871072136e-16
TDEL0D030104.150ON1123912128e-16
NCAS0A052304.150ON785912045e-15
YGR014W (MSB2)4.150ON1306982021e-14
TPHA0K013904.150ON8261081912e-13
Smik_7.3024.150ON11891061894e-13
Suva_7.2964.150ON1135971868e-13
Skud_7.2994.150ON1169911841e-12
TPHA0L003605.524ON1161951841e-12
KNAG0D035904.150ON994891779e-12
KAFR0F034704.150ON949971761e-11
TBLA0G012104.150ON18251111707e-11
CAGL0F08833g4.150ON9362281581e-09
Kpol_1062.374.150ON9731021482e-08
TBLA0G009505.524ON2253891366e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18650
         (2159 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...  2806   0.0  
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   577   e-170
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   241   6e-63
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   182   5e-45
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   172   4e-42
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   144   2e-33
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   137   2e-31
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   122   6e-27
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   113   3e-24
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   109   8e-23
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   101   2e-20
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...   101   2e-20
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...   100   4e-20
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...    98   2e-19
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...    96   5e-19
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...    96   1e-18
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    95   1e-18
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...    91   4e-17
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    89   7e-17
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...    89   8e-17
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    89   9e-17
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...    88   2e-16
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    87   4e-16
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    87   6e-16
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    86   8e-16
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    83   5e-15
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    82   1e-14
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    78   2e-13
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    77   4e-13
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    76   8e-13
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    75   1e-12
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...    75   1e-12
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    73   9e-12
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    72   1e-11
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    70   7e-11
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    65   1e-09
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    62   2e-08
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    57   6e-07

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score = 2806 bits (7273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1455/1741 (83%), Positives = 1455/1741 (83%)

Query: 419  ESPSPSNAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPSSALSVT 478
            ESPSPSNAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPSSALSVT
Sbjct: 419  ESPSPSNAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPSSALSVT 478

Query: 479  EYSASLGTQTATKSPTSSGTRYTDEKRXXXXXXXXXXXXXXXLITESSTSRDTQDSSEST 538
            EYSASLGTQTATKSPTSSGTRYTDEKR               LITESSTSRDTQDSSEST
Sbjct: 479  EYSASLGTQTATKSPTSSGTRYTDEKRTTSDASSTTDSPTPDLITESSTSRDTQDSSEST 538

Query: 539  IESFTPTSIQSTPDITKSSGHQAXXXXXXXXXXXXXXXXXXXXXXQSKIDSYSINTGXXX 598
            IESFTPTSIQSTPDITKSSGHQA                      QSKIDSYSINTG   
Sbjct: 539  IESFTPTSIQSTPDITKSSGHQATKETSIISSTSSRVDRSSTKDTQSKIDSYSINTGKSS 598

Query: 599  XXXXXXXXXXRATPTETNNVDTSISEGLTQSTQRVTESFTSSDTQTLPDTSSVNAGXXXX 658
                      RATPTETNNVDTSISEGLTQSTQRVTESFTSSDTQTLPDTSSVNAG    
Sbjct: 599  TDLKTESSSSRATPTETNNVDTSISEGLTQSTQRVTESFTSSDTQTLPDTSSVNAGRSST 658

Query: 659  XXXXXXXXXXGVQITTENSAQTSSPTTIEGSTRSDAQAVESSTPSTLQXXXXXXXXXXXX 718
                      GVQITTENSAQTSSPTTIEGSTRSDAQAVESSTPSTLQ            
Sbjct: 659  ELSTSRSASSGVQITTENSAQTSSPTTIEGSTRSDAQAVESSTPSTLQPTTKSPTPSDTP 718

Query: 719  XXXXXLAQVTDSLSSNDGSVASGNLSPSATSSNLMSSTDSDAQSVTKSSRTTAPGSAPTS 778
                 LAQVTDSLSSNDGSVASGNLSPSATSSNLMSSTDSDAQSVTKSSRTTAPGSAPTS
Sbjct: 719  STTESLAQVTDSLSSNDGSVASGNLSPSATSSNLMSSTDSDAQSVTKSSRTTAPGSAPTS 778

Query: 779  SAMDEXXXXXXXXXXXXXXPLSTPHDYTRSSQLLTRTGSFSTTIPVTTEVSTSSDAQLPT 838
            SAMDE              PLSTPHDYTRSSQLLTRTGSFSTTIPVTTEVSTSSDAQLPT
Sbjct: 779  SAMDESITTSSAQAATGSSPLSTPHDYTRSSQLLTRTGSFSTTIPVTTEVSTSSDAQLPT 838

Query: 839  TNSVKSESAEITSSTMTKTSSQDDRNSDFLGVXXXXXXXXXXXXXQERSLMQDFNSQSSA 898
            TNSVKSESAEITSSTMTKTSSQDDRNSDFLGV             QERSLMQDFNSQSSA
Sbjct: 839  TNSVKSESAEITSSTMTKTSSQDDRNSDFLGVTTTSTPLTATRSTQERSLMQDFNSQSSA 898

Query: 899  VLTSQSFKQSETPLITQPSSARPRTTFTSSPLSGVQTSIGPTSLTEETSTDLFQSKTSSV 958
            VLTSQSFKQSETPLITQPSSARPRTTFTSSPLSGVQTSIGPTSLTEETSTDLFQSKTSSV
Sbjct: 899  VLTSQSFKQSETPLITQPSSARPRTTFTSSPLSGVQTSIGPTSLTEETSTDLFQSKTSSV 958

Query: 959  STILTSIASYTLASTPSRSQKSEAVPSSHDSILNPKSSASTTTKVLSPTSITQSLPEESS 1018
            STILTSIASYTLASTPSRSQKSEAVPSSHDSILNPKSSASTTTKVLSPTSITQSLPEESS
Sbjct: 959  STILTSIASYTLASTPSRSQKSEAVPSSHDSILNPKSSASTTTKVLSPTSITQSLPEESS 1018

Query: 1019 IMSTSKLVLTRYDSTDSTASYASNVESTSRGPETHXXXXXXXKVXXXXXXXXXXXXTQLS 1078
            IMSTSKLVLTRYDSTDSTASYASNVESTSRGPETH       KV            TQLS
Sbjct: 1019 IMSTSKLVLTRYDSTDSTASYASNVESTSRGPETHSTSSSSTKVLSALFLSSASDLTQLS 1078

Query: 1079 GSISSTTSPDEAISHLGSTSKSDTFITSGANSQSLGSFYTSRASTTQSLQQSGSAVLLTD 1138
            GSISSTTSPDEAISHLGSTSKSDTFITSGANSQSLGSFYTSRASTTQSLQQSGSAVLLTD
Sbjct: 1079 GSISSTTSPDEAISHLGSTSKSDTFITSGANSQSLGSFYTSRASTTQSLQQSGSAVLLTD 1138

Query: 1139 STQSSQLTDATLSVSSVTGSNTRLNTLRSSSRVAASTTNSFDVTATQSTVVTRSGEQSTG 1198
            STQSSQLTDATLSVSSVTGSNTRLNTLRSSSRVAASTTNSFDVTATQSTVVTRSGEQSTG
Sbjct: 1139 STQSSQLTDATLSVSSVTGSNTRLNTLRSSSRVAASTTNSFDVTATQSTVVTRSGEQSTG 1198

Query: 1199 RVSRTESRSTLTGVEXXXXXXXXXXXXXXXXXXXXXXXXXGAHTSESNLISSKYXXXXXX 1258
            RVSRTESRSTLTGVE                         GAHTSESNLISSKY      
Sbjct: 1199 RVSRTESRSTLTGVETASLASVSVTTLLSLTSPHSTTTLHGAHTSESNLISSKYGGNTGS 1258

Query: 1259 XXXXXXXXXXXXXXXXXXXXXXDAPTSTFLSKPSQSVAGSRTSSDWLPTLLVTASATESV 1318
                                  DAPTSTFLSKPSQSVAGSRTSSDWLPTLLVTASATESV
Sbjct: 1259 GTRTIISTSGSQSPSSIGVISGDAPTSTFLSKPSQSVAGSRTSSDWLPTLLVTASATESV 1318

Query: 1319 NTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFL 1378
            NTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFL
Sbjct: 1319 NTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFL 1378

Query: 1379 PDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDG 1438
            PDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDG
Sbjct: 1379 PDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDG 1438

Query: 1439 QALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQKMILNS 1498
            QALQYRMHNRTGAFSANF              GNDYIASVAIVYFPTSAVNVLQKMILNS
Sbjct: 1439 QALQYRMHNRTGAFSANFSEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNS 1498

Query: 1499 ASMLYSNPDSTQESLALLIDPKIPITGLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1558
            ASMLYSNPDSTQESLALLIDPKIPITGLV                               
Sbjct: 1499 ASMLYSNPDSTQESLALLIDPKIPITGLVDSDGSSGSGDGSGGSGSSGDGGDSGSSSSGS 1558

Query: 1559 XXXTNASTDDRNLGTLGGFDFFHMSFSVAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXS 1618
               TNASTDDRNLGTLGGFDFFHMSFSVAKKLIIFLPVFLVSIALW             S
Sbjct: 1559 GSSTNASTDDRNLGTLGGFDFFHMSFSVAKKLIIFLPVFLVSIALWVLLGLLFFGGLVGS 1618

Query: 1619 KNKNKQDPLPDKKWSVDEKALQSYFDPHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVG 1678
            KNKNKQDPLPDKKWSVDEKALQSYFDPHPDVEKYPG                EEDLLAVG
Sbjct: 1619 KNKNKQDPLPDKKWSVDEKALQSYFDPHPDVEKYPGSAWSSTSDSNSDDFRSEEDLLAVG 1678

Query: 1679 NGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEG 1738
            NGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEG
Sbjct: 1679 NGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEG 1738

Query: 1739 EVNNEALHLSQVGQDLDEIIVDEDGNVELPLADLEQLSFEENNTDTIESYNNQQYYKMNQ 1798
            EVNNEALHLSQVGQDLDEIIVDEDGNVELPLADLEQLSFEENNTDTIESYNNQQYYKMNQ
Sbjct: 1739 EVNNEALHLSQVGQDLDEIIVDEDGNVELPLADLEQLSFEENNTDTIESYNNQQYYKMNQ 1798

Query: 1799 LLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLEDYF 1858
            LLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLEDYF
Sbjct: 1799 LLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLEDYF 1858

Query: 1859 YSEIEPLEDPEEAHIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1918
            YSEIEPLEDPEEAHIAQSDSEDSNDVEDFNV                             
Sbjct: 1859 YSEIEPLEDPEEAHIAQSDSEDSNDVEDFNVDSDTEEEWEREEHYEEGDEEGDEADDVND 1918

Query: 1919 IHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVVLPHNSSTKPSSFEQSGTNST 1978
            IHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVVLPHNSSTKPSSFEQSGTNST
Sbjct: 1919 IHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVVLPHNSSTKPSSFEQSGTNST 1978

Query: 1979 ASEGRRGTGSSTLLRNVPAMYPNQNGSVDGAVTSGSGTQTDRTSSSTWLGGAKNLNSADL 2038
            ASEGRRGTGSSTLLRNVPAMYPNQNGSVDGAVTSGSGTQTDRTSSSTWLGGAKNLNSADL
Sbjct: 1979 ASEGRRGTGSSTLLRNVPAMYPNQNGSVDGAVTSGSGTQTDRTSSSTWLGGAKNLNSADL 2038

Query: 2039 LRSDKVVRPHHASKSAGLRKEKSKNIHTALRKHKKSVGGSSAQKQSAFERTRSVTVSEKE 2098
            LRSDKVVRPHHASKSAGLRKEKSKNIHTALRKHKKSVGGSSAQKQSAFERTRSVTVSEKE
Sbjct: 2039 LRSDKVVRPHHASKSAGLRKEKSKNIHTALRKHKKSVGGSSAQKQSAFERTRSVTVSEKE 2098

Query: 2099 KSKRASFRRSIADTLHSANVFGGTGRKRSSTVNEVGPRGHTREEVHNIRISGPIYSENSL 2158
            KSKRASFRRSIADTLHSANVFGGTGRKRSSTVNEVGPRGHTREEVHNIRISGPIYSENSL
Sbjct: 2099 KSKRASFRRSIADTLHSANVFGGTGRKRSSTVNEVGPRGHTREEVHNIRISGPIYSENSL 2158

Query: 2159 G 2159
            G
Sbjct: 2159 G 2159

 Score =  337 bits (864), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 194/282 (68%), Positives = 194/282 (68%)

Query: 1   MRPGVPLVQVVLLFAWALFGIERVNAGALYPRXXXXXXXXXXXXXXXXXXXXXXXQRSSS 60
           MRPGVPLVQVVLLFAWALFGIERVNAGALYPR                       QRSSS
Sbjct: 1   MRPGVPLVQVVLLFAWALFGIERVNAGALYPRVAESVNGSSASVSPSSSTAYVSSQRSSS 60

Query: 61  GSEAVLSSTSQAISEFTSTLPMTSRASGDTXXXXXXXXXXXXXXXXXXXXXXXGPDPLGS 120
           GSEAVLSSTSQAISEFTSTLPMTSRASGDT                       GPDPLGS
Sbjct: 61  GSEAVLSSTSQAISEFTSTLPMTSRASGDTSQVSSSKALKESSSPSSVKSIDSGPDPLGS 120

Query: 121 SYEPSSLYLSAEKYGSSDGSDWFSDLAFDSGIVGSVTQAKSSIPSTSENPSRNSLGIAXX 180
           SYEPSSLYLSAEKYGSSDGSDWFSDLAFDSGIVGSVTQAKSSIPSTSENPSRNSLGIA  
Sbjct: 121 SYEPSSLYLSAEKYGSSDGSDWFSDLAFDSGIVGSVTQAKSSIPSTSENPSRNSLGIATR 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAQSTTESSSPSNTQTTTEA 240
                                                   NAQSTTESSSPSNTQTTTEA
Sbjct: 181 TSISTASSSTESPSPSNTQSTTESSSPSDTQTTTESPSPSNAQSTTESSSPSNTQTTTEA 240

Query: 241 SSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTSNA 282
           SSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTSNA
Sbjct: 241 SSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTSNA 282

 Score = 76.3 bits (186), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (87%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPS 278
           N Q+TT +SSPSNTQTTTE SSADDTQTTTGTS SSDTQTTTET S +DTQ+TTE+ S
Sbjct: 293 NTQTTTGTSSPSNTQTTTETSSADDTQTTTGTSKSSDTQTTTETSSADDTQTTTETSS 350

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPS 278
           + Q+TTE+SS  +TQTTTE SSADDTQTTTGTS SSDTQTTTET S ++TQ+TTE+ S
Sbjct: 329 DTQTTTETSSADDTQTTTETSSADDTQTTTGTSKSSDTQTTTETSSADNTQTTTETSS 386

 Score = 57.4 bits (137), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTS 280
           + Q+TT +S  S+TQTTTE SSADDTQTTT TS++ DTQTTT T   +DTQ+TTE+ S  
Sbjct: 317 DTQTTTGTSKSSDTQTTTETSSADDTQTTTETSSADDTQTTTGTSKSSDTQTTTETSSAD 376

Query: 281 N 281
           N
Sbjct: 377 N 377

 Score = 56.6 bits (135), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTS 280
           + QSTTES SPSN QTTTE+SS  +TQTT  +S+ S+TQTT E PSP+ T+ TTES + S
Sbjct: 413 DTQSTTESPSPSNAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPS 472

Query: 281 NA 282
           +A
Sbjct: 473 SA 474

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 54/79 (68%)

Query: 425 NAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPSSALSVTEYSASL 484
           N Q+TTESSSPS+TQTT  S SPSN Q+T E+ SPS T+ TTE+++     + T  S S 
Sbjct: 197 NTQSTTESSSPSDTQTTTESPSPSNAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSS 256

Query: 485 GTQTATKSPTSSGTRYTDE 503
            TQT T++P+ + T+ T E
Sbjct: 257 DTQTTTETPSPNDTQSTTE 275

 Score = 47.0 bits (110), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 52/94 (55%), Gaps = 36/94 (38%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNS------------SDTQTTTETPS-- 266
           + Q+TTE+SS  NTQTTTE SSADDTQTTTGTS S            +DTQ+TTE+PS  
Sbjct: 365 DTQTTTETSSADNTQTTTETSSADDTQTTTGTSKSSDTQTTTDTPSPNDTQSTTESPSPS 424

Query: 267 ----------------------PNDTQSTTESPS 278
                                 P++TQ+T E+PS
Sbjct: 425 NAQTTTESSSPSNTQTTNVSSSPSNTQTTVEAPS 458

 Score = 34.7 bits (78), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 38/60 (63%)

Query: 221 NAQSTTESSSPSNTQTTTEASSADDTQTTTGTSNSSDTQTTTETPSPNDTQSTTESPSTS 280
           N Q+T  SSSPSNTQTT EA S   T+ TT ++  S   + TE  +   TQ+ T+SP++S
Sbjct: 437 NTQTTNVSSSPSNTQTTVEAPSPSATRYTTESATPSSALSVTEYSASLGTQTATKSPTSS 496

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  577 bits (1486), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 366/908 (40%), Positives = 490/908 (53%), Gaps = 76/908 (8%)

Query: 1291 PSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQ 1350
            PS + +   TS DWLP+ +VTAS T S +TQSSFD  ATATLPQ I+P TPV++P NYSQ
Sbjct: 1215 PSSTNSEGSTSMDWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYSQ 1274

Query: 1351 ITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPR 1410
            ITIGF+++LNYPFLI+NPLASAQIFGFLP++LRYPF  R  R+ + + S      ++   
Sbjct: 1275 ITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFSVRASRSNSSTSS----VKRDLVG 1330

Query: 1411 DGH---LENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXX 1467
            D     L+N+ L  D+   K  + N +  +    +   HN   AF ANF           
Sbjct: 1331 DSGNLLLDNSTLILDKLNWKTSIMNSLSSNVSVSRNGSHN---AFRANFSGVAVSSIVPL 1387

Query: 1468 XXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
               GNDYI SVA+VYFPT AV VLQKMI+N AS +Y NPD +   +ALLID KIPITG++
Sbjct: 1388 IVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMALLIDSKIPITGII 1447

Query: 1528 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTLGGFDFFHMSFSVA 1587
                                                   +D N GTL G+  F + F   
Sbjct: 1448 SSDGSGQGSGSSGGSGSSSGSDGTGSSGSSSESDYEDVKND-NSGTLDGYKNFQVKFFTT 1506

Query: 1588 KKLIIFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDPLPDKKWSVDEKALQSYFD--- 1644
            K+L+IFLPVF+V++ +W               +        +KKW+ D+K L +YF    
Sbjct: 1507 KRLVIFLPVFIVAVTMWISLGLLFFGSLFRKGSLQGMAGNLEKKWNTDQKTLDNYFGITE 1566

Query: 1645 -----PHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQVGPDGNF 1699
                    D+EK                   ++DLLAVGNG+FFS+STGLTY V  +GNF
Sbjct: 1567 FIGKRQSADLEK--NLAGSFHNDESSSDAFDDDDLLAVGNGMFFSKSTGLTYHVDREGNF 1624

Query: 1700 YYAGRTDD-VYP---KNQGAFQATNT---GDQDKNLNA-------------------VTT 1733
            +YAG  +  V P   K+    +A+N    G+ D    A                      
Sbjct: 1625 FYAGTANKAVLPLKSKSTSKLEASNMVPNGESDPKNEANEANEAKEEGEENEERKENEEK 1684

Query: 1734 LFKEGEVNNEALHLSQVGQDLDEIIVDEDGNVELPLADLEQLSFEENNTDTIESYNNQQY 1793
                GE  ++A        +++E  VDEDGNVEL ++DLE+LS +E+N+DTIESYNNQQY
Sbjct: 1685 PCSNGEFRDDA--------EVEEFDVDEDGNVELSVSDLERLSLDEHNSDTIESYNNQQY 1736

Query: 1794 YKMNQLLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDEN 1853
            YKM QLL  +   DI+ A ++      G  I S  NE K  PLSSESS L+ QLS  D+N
Sbjct: 1737 YKMKQLLQNLNNDDIEGAFSTENEGAAGN-ISSTGNESKLMPLSSESSKLLVQLSTDDDN 1795

Query: 1854 LEDYFYSEIEPLEDPEEAHIAQ--SDSEDSNDVEDFNVXXXXXXXXXXXXXXXXXXXXXX 1911
            LE+YFYSE   LE   +    Q   +SED++DVEDFN+                      
Sbjct: 1796 LEEYFYSEEAQLEGIGKTTSPQPEPESEDNDDVEDFNI----------------DSDSEE 1839

Query: 1912 XXXXXXXIHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVVLPHNSSTKPSSFE 1971
                   +H+GEFDELDE MYRR SS SG+T F+GGSS SNTF S++   NS+  P  F 
Sbjct: 1840 EGEDVNDVHVGEFDELDEVMYRRFSSASGLTRFQGGSSSSNTFISLMQQRNSNMLP--FS 1897

Query: 1972 QSGTNSTASEGRRGTGSSTLLRNVPAMYPNQNGSVDGAVTSGSGTQTDRTSSSTWLGGAK 2031
                 ST+SEG     +S  L+   + + +Q+   D     GS      + + +      
Sbjct: 1898 THALGSTSSEGYHEITASDGLQTDSSNFASQSSPEDPVELLGSKPPMSASHTKSAPKRPN 1957

Query: 2032 NLNSADLLRSDKVVRPHHASKSAGLRKEKSKNIHTALRKHKKSVGGSSAQKQSAFERTRS 2091
              +S   L  D ++   H+  +    +      H      +++ G  S  +  A ERT++
Sbjct: 1958 RPSSIISLEKDSIIGQAHSKAALNTVRRPKIQPHQKPSNPRETAGPPSRHETIAVERTQN 2017

Query: 2092 VTVSEKEKSKRASFRRSIADTLHSANVFGGTGRKRSSTVNEVGPRGHTREEVHNIRISGP 2151
            + +S+KEKS+R+SFR+S+A+TLHSANVF G+ R RSST+N+VGPRGHTREE++ IRISGP
Sbjct: 2018 IKISKKEKSRRSSFRKSVAETLHSANVFSGSTRGRSSTLNDVGPRGHTREELNKIRISGP 2077

Query: 2152 IYSENSLG 2159
            IYSENSLG
Sbjct: 2078 IYSENSLG 2085

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  241 bits (615), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 210/713 (29%), Positives = 310/713 (43%), Gaps = 79/713 (11%)

Query: 1303 DWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362
            +WLP  L+  S   S  + ++ D  AT+TLPQ I P T V  PA +S ITIGF++ALNYP
Sbjct: 1473 NWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYP 1532

Query: 1363 FLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRD-----GHLENT 1417
            FLI +PL+SAQIF FLP VL+YPF S    +  +   Q         R        ++  
Sbjct: 1533 FLISHPLSSAQIFSFLPRVLQYPFSSTAG-SVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591

Query: 1418 NLS---EDERKL---KNGL---TNHIFEDGQALQYR--------MHNRTGAFSANFXXXX 1460
            +LS    D+ +L   K  L   TN   ++  +L  R        M++ + + + ++    
Sbjct: 1592 SLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651

Query: 1461 XXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPK 1520
                        +YI SVA VYFP  +++ LQ+++ N  S LY NP+++ ++LA LIDP 
Sbjct: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711

Query: 1521 IPITGLVXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTLGGF 1577
            +P+TGLV                                       A+ D   LG+L   
Sbjct: 1712 VPLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGESQGGANGDGSALGSLDDG 1771

Query: 1578 DFFHMSFSVAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDPLPDKKWSVDEK 1637
             +  MS ++ K+LII+L VF     LW              +   K+    DK WS    
Sbjct: 1772 AYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPG 1831

Query: 1638 ALQSYF---------DPHPDVEKYPGXXXXXXXXXXXXXXXXEE------DLLAVGNGLF 1682
            A  ++          +P  D E+                   E+      DL+  G+   
Sbjct: 1832 AFYNHHYNSHYSDPNNPFYDPERSLREKCSFDERYDYDYDTEEQDGYLYDDLVVTGDNTV 1891

Query: 1683 FSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGE--V 1740
            +S S GL+Y +  +GN+YYAG  D +  +N+   QA    D ++ L ++  ++ EG   +
Sbjct: 1892 YSTSRGLSYFIDENGNYYYAGM-DFIVNENE---QANEFVDHNQ-LQSMEHIY-EGHDSI 1945

Query: 1741 NNEALHLSQVGQDLDEIIVDEDGNVELPLADLE----QLSFEENNTDTIESYNNQQYYKM 1796
               AL   +   D++ + VDE+GN+ELP +D          E   TDT+ESYNN QYYKM
Sbjct: 1946 AGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQYYKM 2005

Query: 1797 NQLLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLED 1856
            N L++           T S  +  G  +  +   +     S+E SN + QL   DEN ED
Sbjct: 2006 NTLIT-----------TESSEQQVGNSLSVSGAGLALVSSSNEGSNGIIQLKSHDENYED 2054

Query: 1857 YFYS---EIEPLEDPE--------EAHIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXXX 1905
            YFY    E E L + E          H A S + +SN                       
Sbjct: 2055 YFYDSSHEDEGLPNVENTGTTKYNRTH-ALSLNINSNGDGYDEKEEEEDDDDGDVEDYAI 2113

Query: 1906 XXXXXXXXXXXXXIHIGEFDELDEEMYRRLSSVSGITGFRGGSSGSNTFPSVV 1958
                           + E D   EEMYRRLS+ + + G +  SSG+NT+ S V
Sbjct: 2114 DLDDEDDVNDVIVGELDELD---EEMYRRLSNFNELHGLQNRSSGTNTYESTV 2163

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 2064 IHTALRKHKKSVGGSSAQKQSAFERTRSVTVSEKEKSK-RASFRRSIADTLHSANVFGGT 2122
            +H    K       S   +Q+ F+       S K   K R+S+ +SI +++  + V   +
Sbjct: 2340 VHATTAKTPSVALDSKDHRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTS 2399

Query: 2123 GRKR---SSTVNEVGPRGHTREEVHNIRISGPIYSENSLG 2159
              +R   S  +   GPRGHTREE+  IRISGPI+SENSLG
Sbjct: 2400 HSRRGSLSKVIPATGPRGHTREELKKIRISGPIFSENSLG 2439

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  182 bits (462), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 194/724 (26%), Positives = 288/724 (39%), Gaps = 138/724 (19%)

Query: 1282 APTSTFL---SKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVP 1338
             P+ +F+   S PS +    +T   WLPT +VTAS   S    ++  +AAT TLP+ I P
Sbjct: 1304 VPSPSFIAPKSNPSSTSIDEKTG--WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITP 1361

Query: 1339 STPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFD----RTT 1394
            +TPV+ P NY  ITIGF + LNY FL+ NP+ASAQIF FLP +L YP++   +    R  
Sbjct: 1362 ATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHI 1421

Query: 1395 NVSE--------SQPWRYFKEFPRDGHL----ENTNLSEDERKLKNGLTNHIFEDGQALQ 1442
            N S         S    YF  +   G+L    ++TN +E  ++ +N   +   E G    
Sbjct: 1422 NESNNNILGNRGSVSGSYFNIY---GNLSLEHKHTNSTEPVKRRQNNEEDTSDEHG---- 1474

Query: 1443 YRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASML 1502
                         +              G DY ASVA VYFP+ AV  L+KM+ +  S L
Sbjct: 1475 -------------YSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKL 1521

Query: 1503 YSNPDSTQESLALLIDPKIPITGLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 1562
            Y NP +T   LA L+DP+IP+  +                                   +
Sbjct: 1522 YLNPVATLNQLASLVDPRIPVLTIT-------------SGSSPSFSNTDPDHSGDTSGSS 1568

Query: 1563 NASTDDRNLGTLGGFDFFHMSFSVAKKLIIFLPVFLVSIA------------LWXXXXXX 1610
            N ++ D   GTL      HMS +  K+++IF   F   +             L+      
Sbjct: 1569 NNNSSDHKGGTLDLGAHRHMSPATRKRILIFSLAFSFGVLLWILIFLFLLKRLYKVSKIR 1628

Query: 1611 XX---------XXXXXSKNKNKQDPLPDKKWSVDEKALQSYFDPHPDVEKYPGXXXXXXX 1661
                            S N    D L D K         +++D  P+             
Sbjct: 1629 SKIVLREKSIPNNLGISYNHQFNDRLSDLK-------TDAFYDGDPERNFNSQSTNSSSN 1681

Query: 1662 XXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYA---GRTDDVYPKNQGAFQA 1718
                     ++D++  G    +S S G+TY +  +GN+YYA     ++   P+    +Q 
Sbjct: 1682 HDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQ- 1740

Query: 1719 TNTGDQDKNLNAVTTLFKEGEVNNEALHLSQVGQDLDEIIVDEDGNV---ELPLADLEQL 1775
              +G +  N+             NEA ++S  G DL++I  D++GN+   EL     E L
Sbjct: 1741 -ESGGETINI-------------NEAQYMSS-GIDLEDI--DQEGNIEISELEFHHPELL 1783

Query: 1776 SFEENNTDTIESYNNQQYYKMNQLLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAP 1835
            S  + +   IE YN  QYY M+ +++  +         SS         P     V+D  
Sbjct: 1784 SHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTVGLSSE--------PGMSVNVED-- 1833

Query: 1836 LSSESSNLVAQLSG-GDENLEDYFYS----EIEPLEDPEEAHIAQSDSEDS--------- 1881
            LS+E+S    +L G   +N +DY Y     +IE + D +   I  S S  S         
Sbjct: 1834 LSNENSVGFIRLHGSSSDNYDDYLYEGDEDDIELVND-DAIAIPISTSRGSVTRSLIITE 1892

Query: 1882 ------NDVEDF-NVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHIGEFDELDEEMYRR 1934
                   +VE    +                             I + EFD LDEEMYR 
Sbjct: 1893 PSGFRLGEVEAIEEIMPECDEFTDADYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRH 1952

Query: 1935 LSSV 1938
            LS +
Sbjct: 1953 LSVI 1956

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  172 bits (436), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 147/518 (28%), Positives = 217/518 (41%), Gaps = 57/518 (11%)

Query: 1294 SVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITI 1353
            S  G RT+  WLP+ +   S      T SSFD A TATLPQ I P T V +P N S+IT+
Sbjct: 1060 SSVGGRTTF-WLPSSIQVQSDPTRSGT-SSFDPAVTATLPQLIAPPTAVPVPENASKITV 1117

Query: 1354 GFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGH 1413
            GF+K LNY FL+ +   +AQIF FLP VL +PF           E    + F  + R G 
Sbjct: 1118 GFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPF-----------EENGTKDFS-YKRRGT 1165

Query: 1414 LENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGA-FSANFXXXXXXXXXXXXXXGN 1472
            L  ++      +  N  T    +  Q     +  R+ + F  N                 
Sbjct: 1166 LLVSSF-----EFNNTTTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDR 1220

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVXXXXX 1532
            +Y+ S+A++YFP++ V+ LQ M+ +  S L++NPD T ++LA LIDP IP+TGL+     
Sbjct: 1221 NYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTG 1280

Query: 1533 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTLGGFDFFHMSFSVAKKLII 1592
                                           + + D N G+LG      +S +V K+L+I
Sbjct: 1281 SLNGGNPSTQSHSPSSPY------------KSQSSDDNSGSLGTATNSGLSSAVKKRLVI 1328

Query: 1593 FLPVFLVSIALWXXXXXXXXXX----XXXSKNKNKQDPLPDKKW--------SVDEKALQ 1640
            +L   +    LW                 +K   ++D   ++K         SV     +
Sbjct: 1329 YLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETE 1388

Query: 1641 SYFDPHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQVGPDGNFY 1700
               D   DV +                    EDL+  G    +S S GL Y V  DG+FY
Sbjct: 1389 PANDKSDDVPQ-----EKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFY 1443

Query: 1701 YAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGEVNNEALHLSQVGQDLDEIIVD 1760
            YAG       +N+     T  GD   ++  +       +     +   Q   D+  + +D
Sbjct: 1444 YAGPLQSTSEENE-----TTKGDS-ADIEDINDYLYSADQERSIVTNEQSSCDIGSLQID 1497

Query: 1761 EDGN--VELPLADLEQLSFEENNTDTIESYNNQQYYKM 1796
            E+GN  V  P  + E+     +N+ TIE YNN   YKM
Sbjct: 1498 EEGNFVVSDPSPNEEEHEITSSNSATIELYNNNNLYKM 1535

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  144 bits (364), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/318 (32%), Positives = 143/318 (44%), Gaps = 36/318 (11%)

Query: 1289 SKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANY 1348
            S PS + A + ++++WLP  ++  S      +  SF+   TATLP  I P TPVS P N 
Sbjct: 1633 SVPSATSAPTESNTNWLPYSIIMQSTPSPS-SAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691

Query: 1349 SQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFV--SRFDRTTNVSESQPWRYFK 1406
            S ITIGF++ ++Y FL+ NPL+SAQIF FLPDVL YPF      D+ T+ +ES  ++   
Sbjct: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYK--- 1748

Query: 1407 EFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXX 1466
                             RK     T   + D      + H      +AN           
Sbjct: 1749 -----------------RKTT---TLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLS 1788

Query: 1467 XXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526
                   Y+ +VA +YFP   VN L+  + NS SMLY+N + T  +LA LIDP IP+TG+
Sbjct: 1789 RDKS---YLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGM 1845

Query: 1527 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTLGGFDFFHMSFSV 1586
            V                                   N + D+ NL T       H++  +
Sbjct: 1846 VDDNGDVNNGGSGSGSSGEGNHASQSPHSFQ-----NGNEDNGNLETANSTS--HITGVI 1898

Query: 1587 AKKLIIFLPVFLVSIALW 1604
             K+L IFL  F   + LW
Sbjct: 1899 TKRLAIFLNCFAFGVLLW 1916

 Score = 60.1 bits (144), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 1672 EDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAV 1731
            +DL+  G    +S   GL Y V  DG F+YAG         Q + ++  T D+   ++  
Sbjct: 2010 DDLIVTGENTVYSTLHGLEYFVDEDGQFHYAG-------NRQISDESGTTKDEHDEIDDF 2062

Query: 1732 TTLFKEGEVNNEALHLSQVGQ-DLDEIIVDEDGNVELPLADLEQLSFEEN--------NT 1782
                  G     ++H+S+  + D+  + VDE+GN  L + D    + +EN        N+
Sbjct: 2063 DKYMYAGS-EEMSVHVSEAPEVDMSSLEVDEEGNFVL-MNDEIYDNLQENSRSGSGNKNS 2120

Query: 1783 DTIESYNNQQYYKM 1796
            DT+ESYNN   YKM
Sbjct: 2121 DTVESYNNNHLYKM 2134

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  137 bits (344), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/233 (37%), Positives = 132/233 (56%), Gaps = 39/233 (16%)

Query: 1296 AGSRTSSDWLPT-LLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIG 1354
            +G  ++++WLPT L++  +A  + +  +S D  AT+TLPQ I P++ V +P  Y+ IT+G
Sbjct: 714  SGLTSNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVG 773

Query: 1355 FQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHL 1414
            F++ LNYPFLI NPLASAQIF FLP VL  PF         V   + W  FK+   + HL
Sbjct: 774  FKEPLNYPFLIANPLASAQIFNFLPKVLVRPFQLTTTGAAPVYR-RSWNIFKK-GINTHL 831

Query: 1415 ENTNL-SEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGND 1473
             +++L + D+ ++K+            +   + N +                        
Sbjct: 832  LSSSLPTYDDVQVKS-----------IVPLVIQNVS------------------------ 856

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526
            YI S+A VYFPT +V+ LQ+++L+S+S+LYSNP S    LA LI+P IP+TGL
Sbjct: 857  YIVSIAEVYFPTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGL 909

 Score = 67.4 bits (163), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 123/285 (43%), Gaps = 29/285 (10%)

Query: 1671 EEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNA 1730
            ++DL+  G    +S S G+TY V  DGNF++AG   DV+       +     D+ + +  
Sbjct: 1063 DDDLIITGENTVYSISQGITYYVDEDGNFFFAGVGKDVHTSEPEKLEKI-IHDKTETVTV 1121

Query: 1731 VTTLFKEGEVNNEALHLSQVGQDLDEIIVDEDGNVELPLADLEQLSFE-ENNTDTIESYN 1789
               L    E +++    ++   D+ E+ VDEDGN+ LP +DLE    +  ++ + I S +
Sbjct: 1122 EPILPYYNEKDDDLTDETE-PFDMGELEVDEDGNIALPESDLENTILQVASDREEIRSRS 1180

Query: 1790 ----NQQYYKMNQLLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVA 1845
                N   Y  +Q+       +I  ++TS+      + + +    V    LSS  S  + 
Sbjct: 1181 PIGTNDGSYLQHQI------PNIFPSVTSNSAHVNSDTMAT---AVTQTLLSSNGSGGIL 1231

Query: 1846 QLSGGDENLEDYFYSEIE-PLEDPEEAHIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXX 1904
             L+G +   ++Y Y   +  ++DP    I  S       +E+F+                
Sbjct: 1232 DLTGNNGTYDEYLYDATQDEIDDP--PIITNS------GLEEFS----SGHISSIDLDDE 1279

Query: 1905 XXXXXXXXXXXXXXIHIGEFDELDEEMYRRLSSVSGITGFRGGSS 1949
                          +++G++DE DEEMYR LS    +  F  GSS
Sbjct: 1280 IDIDIEDYDDDVSDVNVGDYDEFDEEMYRHLSRSDILQNFGSGSS 1324

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  122 bits (307), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 119/455 (26%), Positives = 181/455 (39%), Gaps = 85/455 (18%)

Query: 1285 STFLSKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSI 1344
            S+ L+  S +     T + WLPT ++ AS  +S +T  +    +TA+LP  I P+  +  
Sbjct: 869  SSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHTARA---ESTASLPAAIAPAEELQS 925

Query: 1345 PANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRY 1404
            P ++  ITIGF   LNY FL+ NPL+SAQ+F FLP VL +P     +++  +        
Sbjct: 926  PPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQ------- 978

Query: 1405 FKEFPRDGHLENTNLSEDERKLKNGLTN----HIFEDGQALQYRMH-----NRTGAFSAN 1455
                P+   +  T L    RK +  +T+    ++    +A    ++       TG+    
Sbjct: 979  ----PQSSDI-TTTLVAPLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVE 1033

Query: 1456 --FXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESL 1513
              F              GNDYI SVA VYFPT  ++ L  +I +  S LYSNP     +L
Sbjct: 1034 LIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATL 1093

Query: 1514 ALLIDPKIPITGLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDD----- 1568
            A LID  IP+T L                                   +N ST D     
Sbjct: 1094 ASLIDKAIPLTSL-----------------RKNDGQSNTSTDSSSDVNSNESTGDDAFQN 1136

Query: 1569 --RNLGTLGGFDFFHMSFS-----VAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXS--- 1618
                L   G  D  ++  S     +  ++I+FL      + LW             S   
Sbjct: 1137 AEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKL 1196

Query: 1619 KNKN-KQDPLP---------DKKWSVDEKALQSYFDPHPDVEKYPGXXXXXXXXXXXXXX 1668
            K+ N K+  LP         +K++S +    +SY D H   EKY                
Sbjct: 1197 KDSNLKKGSLPLYQQNPYRENKQFSAESS--ESYIDIHYTTEKYSDYSASSP-------- 1246

Query: 1669 XXEEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAG 1703
                    +G  +    + G+ Y+V  +GN+YY G
Sbjct: 1247 -------PIGENIIVDSAQGIQYKVDNEGNYYYNG 1274

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  113 bits (283), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 114/242 (47%), Gaps = 45/242 (18%)

Query: 1289 SKPSQSVAGSRTSS---DWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIP 1345
            S P  +  G +T S   +WLP+ ++  S   +    SSF+  AT +LPQFI P       
Sbjct: 699  SPPPATPTGPKTLSSDENWLPSGIIFQSDF-ATTVSSSFNPTATKSLPQFIAPPKMTVKS 757

Query: 1346 ANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYF 1405
             N + +TIG ++ LNY FLI NPL+SAQIF FLP VL YPF S                 
Sbjct: 758  PNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAP-------------- 803

Query: 1406 KEFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXX 1465
             +FP +  +++  L+  +  L N  T             +H                   
Sbjct: 804  NDFPINSLIDDNALAFLDSNLFNAST-----------ISVHGIVPLL------------- 839

Query: 1466 XXXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITG 1525
                 G+++  SV  VYFP   ++ L  +I +  S LYSNP+ +  +LA LIDP IP+TG
Sbjct: 840  ---IPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTG 896

Query: 1526 LV 1527
            L+
Sbjct: 897  LI 898

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  109 bits (272), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 106/223 (47%), Gaps = 12/223 (5%)

Query: 1302 SDWLPTLLVTASATESV-NTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALN 1360
            +DWLP  ++T S  + + N  S+    +T  LP  I P + V     Y  I+IGF K LN
Sbjct: 1496 TDWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLN 1555

Query: 1361 YPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLS 1420
            Y F+    L+SAQIF FLP VL YPF S  + T  + +    R  +  P         +S
Sbjct: 1556 YVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPP--------VS 1607

Query: 1421 EDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVAI 1480
               R  ++  T   F   Q +  +    +     +F              G  YIA++A 
Sbjct: 1608 FYSRASRDTTTLSSFTHSQVIAVQKET-SDVPDLSFVKVKQLAPDVSEERG--YIATLAH 1664

Query: 1481 VYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPI 1523
            VYFP+  V  LQ++IL+S S LY+NPD   +  A LIDP I +
Sbjct: 1665 VYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707

 Score =  104 bits (260), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/398 (25%), Positives = 156/398 (39%), Gaps = 78/398 (19%)

Query: 1582 MSFSVAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDPLPDKKWSVDEKALQS 1641
            ++F + K+L+IFL V    + LW                   +  L +KK         S
Sbjct: 1752 ITFKITKRLLIFLTVLTFGVFLWRLVFLYLFRRLYRINKVKSKIVLGEKKIPPSLGLFYS 1811

Query: 1642 Y------FDPHP------DVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGL 1689
            +       D  P      D EK  G                ++D++  G    +S S G+
Sbjct: 1812 HQFNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYAT-DDDIIVTGENTVYSLSQGI 1870

Query: 1690 TYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGEVNNEALH-LS 1748
             Y +  +GN+YYAG    + P        T+  +Q+ +      L+ E EV +  ++ L 
Sbjct: 1871 AYHIDEEGNYYYAG----IDP-------FTDAFEQEADC-----LYHESEVESVNVNNLD 1914

Query: 1749 QVGQDLDEIIVDEDGNVELPLADLEQLSFEE--NNTDTIESYNNQQYYKMNQLLSAITGA 1806
             +  D+ E  +D DGN+EL  +D +  S ++    T+TIE YNN QYYKMN L++  +  
Sbjct: 1915 HLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNC 1974

Query: 1807 DIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGG-DENLEDYFYSEIEPL 1865
                   SS + TT          V    +S+E+S    +L G   EN +DY Y   E  
Sbjct: 1975 QGNTVALSSDYGTT---------SVHVENVSNENSLGFIRLQGDIPENYDDYLYEGDEDD 2025

Query: 1866 EDPEEA----------------HIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXXXXXXX 1909
             D + +                H+A S  E   + EDF+                     
Sbjct: 2026 FDNDSSAAAQLTQVSNLASQGIHLAASVQEP--EYEDFDFARSEDDDDVSDVM------- 2076

Query: 1910 XXXXXXXXXIHIGEFDELDEEMYRRLSSVSGITGFRGG 1947
                       +G+FDELDEEMYR LS ++      GG
Sbjct: 2077 -----------LGDFDELDEEMYRHLSMINAFDSRFGG 2103

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 106/233 (45%), Gaps = 76/233 (32%)

Query: 1303 DWLPT-LLVTASATESVNTQSS-------FDTAATATLPQFIVPSTPVSIPANYSQITIG 1354
            +WLPT +LV ++AT+  N Q++         T AT TLPQ I  +T VS P  Y+ ITIG
Sbjct: 901  NWLPTAMLVESTATD--NGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIG 958

Query: 1355 FQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHL 1414
            F+K+LNYPF                 V+ +P          VS +Q + Y          
Sbjct: 959  FKKSLNYPF-----------------VVSHP----------VSSAQLFSYLP-------- 983

Query: 1415 ENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDY 1474
                       + N   N+ F D Q  Q                              DY
Sbjct: 984  ----------NVLNYPFNYTFSDVQVYQL---------------------VPLKSSSRDY 1012

Query: 1475 IASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            + +VA VYFP+  V VLQK+I N+A+ LY N + T++SLA LIDP IP+TG++
Sbjct: 1013 LITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLASLIDPTIPLTGII 1065

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 123/255 (48%), Gaps = 78/255 (30%)

Query: 1284 TSTFLSKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDT--------AATA--TLP 1333
            T+T +  P+ S      +S WLPT ++T S  +S  T +  DT        A+TA  TLP
Sbjct: 756  TTTPIVTPNYSWGPHTPTSTWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLP 815

Query: 1334 QFIVPSTPVSIP-ANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDR 1392
            +FI  S    IP  NY+ IT+GF++ LNYPF++ NP++SAQIF FLP+VL YP+   F R
Sbjct: 816  KFIS-SANGKIPEGNYTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY--GF-R 871

Query: 1393 TTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAF 1452
              NVS    WR                      LK+G  +++                  
Sbjct: 872  CANVSV---WRLL-------------------PLKSGSRDYLVT---------------- 893

Query: 1453 SANFXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQES 1512
                                  +A+V   +FPT  ++ L +++ ++ S LYS+ D T ++
Sbjct: 894  ----------------------VAAV---FFPTEHLDELARLVADNTSSLYSSYDETGKT 928

Query: 1513 LALLIDPKIPITGLV 1527
            +A LIDP IP+TG++
Sbjct: 929  MASLIDPMIPLTGII 943

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 67/104 (64%), Gaps = 5/104 (4%)

Query: 1296 AGSRTSSDWLPTLLVTASA-TESVNTQSSFDTA----ATATLPQFIVPSTPVSIPANYSQ 1350
            A S TSS+WLPT ++TA+A TES +   S D      AT TLPQ I   T V  P  Y+ 
Sbjct: 1216 ASSATSSNWLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTL 1275

Query: 1351 ITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            IT+GF+KALNYPF++ NP+ SAQIF FLPD L  PF + F   T
Sbjct: 1276 ITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPFDNAFTNIT 1319

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 1/83 (1%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            WLPT ++    T+S  + +SF+ + TA+LP  I P+  V+ PAN++ ITIGF   LNY F
Sbjct: 1205 WLPTAII-VEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVF 1263

Query: 1364 LIKNPLASAQIFGFLPDVLRYPF 1386
            L++NPL+SAQIF FLP VL+YPF
Sbjct: 1264 LVQNPLSSAQIFNFLPLVLKYPF 1286

 Score = 82.8 bits (203), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 194/497 (39%), Gaps = 110/497 (22%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVXXXXXX 1533
            Y+ +VA VYFPT A++ LQ++IL++ S LY+NP ++ ++LA LID  +P+ GL       
Sbjct: 1373 YVIAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGL------- 1425

Query: 1534 XXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGT--LGGFDFF------HMSFS 1585
                                        TN++   +N GT   G  D F      HM + 
Sbjct: 1426 ----TLYGSNNGCSICDSSSSSVSEVSNTNST---KNGGTNKYGALDDFTNSLTDHMPWR 1478

Query: 1586 VAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDPLPDKKWSVDEKALQ----- 1640
            + K+ II+L      + LW                +   + +  +K   +E+ L+     
Sbjct: 1479 ITKRFIIYLTCLTAGVLLWLLLALFAFRHRNVLLGRRPSNCI--EKTPNNERGLEGVGVS 1536

Query: 1641 ---SYFDPHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQVGPDG 1697
               S  D H   EK P                 ++  +  G    +S + GL Y V  DG
Sbjct: 1537 TSRSSSDNHNYNEKKPN------TESESFYSMEDDQYIPTGENTVYSATHGLHYTVDEDG 1590

Query: 1698 N-FYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVT--TLFKEGEVNNEALHLSQVGQDL 1754
            + FY     +D+   N+         ++D  ++++    ++   +   E ++L+   + +
Sbjct: 1591 DLFYRKSMPNDIDEINE---------NEDSGIDSILRECVYDRHQDTTE-VYLND-EESM 1639

Query: 1755 DEII-VDEDGNVEL--PLADLEQLSFEENNTDTIESYNNQQYYKMNQLLSAITGA----- 1806
              I+ VDE+GN+ L    ++ ++ +      + IE YNN   YKM QL     G+     
Sbjct: 1640 SSILDVDENGNIRLYDSYSEDDEPNCPHLQEEVIEDYNNSHVYKM-QLQGLEIGSYTTED 1698

Query: 1807 --DIQDALT---SSGHETTGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENLEDYFYSE 1861
              D ++ +    SSG +T    +PS        PL + S  L      G           
Sbjct: 1699 DPDTENLIANEFSSGSQTC---LPST---AYTTPLDTNSIKLHILGHAGSS--------- 1743

Query: 1862 IEPLEDPEEAHIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHI 1921
               L+ P++A I+  D  +  D++D                                I +
Sbjct: 1744 ---LQKPDQAFISNHDELEIEDIDD--------------------------NGSVSDIQV 1774

Query: 1922 GEFDELDEEMYRRLSSV 1938
             E D LDEE+Y+R+S +
Sbjct: 1775 EELDALDEELYKRMSKI 1791

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 119/270 (44%), Gaps = 51/270 (18%)

Query: 1284 TSTFLSKPSQSVA--------GSRTSSDWLPT-LLVTASATESVNTQSSFDTAATATLPQ 1334
            TST L+ P+ S A         +R S  WLPT ++V +S T+  N+  +     T+ LP 
Sbjct: 492  TSTALAVPTTSTAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPET--NTNTSGLPV 549

Query: 1335 FIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVS------ 1388
             I P T V+ PA+   I+IGF+  LNYPFLIK   ASAQIF FLP +L YPF        
Sbjct: 550  RIAP-TAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQ 608

Query: 1389 -----RFDRTTNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQ---- 1439
                      T+V  ++   Y   F  +  L N            GLT +   DG+    
Sbjct: 609  LDPSISLQSDTSVISTEYQDYSSIFSYETTLSNL-----------GLTLYDLSDGETSVL 657

Query: 1440 ------ALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVNVLQK 1493
                  A   +    T + S                 GN YI S+A   FP   V+ LQ 
Sbjct: 658  EASPTVASMNKYQRDTSSISVK-------QIIPILIPGNLYITSLAEGLFPGEKVDELQN 710

Query: 1494 MILNSASMLYSNPDSTQESLALLIDPKIPI 1523
             I N  S++Y NPD   + +A LID  IPI
Sbjct: 711  YINNLTSIIYQNPDPRLKDMAALIDSTIPI 740

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score = 95.5 bits (236), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 1/83 (1%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            WLPT ++  S+ E+  T +SF+ + T +LP  I P+  VS P N++ ITIGF  ALNY F
Sbjct: 1210 WLPTAIIVESS-ETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVF 1268

Query: 1364 LIKNPLASAQIFGFLPDVLRYPF 1386
            L++NPL+SAQIF FLP VL+YPF
Sbjct: 1269 LVQNPLSSAQIFNFLPLVLKYPF 1291

 Score = 76.6 bits (187), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 123/504 (24%), Positives = 181/504 (35%), Gaps = 126/504 (25%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVXXXXXX 1533
            YI SVA VYFPT AV  LQ++IL+  S LYSNP +   SLA LID  IP+ GL       
Sbjct: 1375 YIVSVAEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGD 1434

Query: 1534 XXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNL-GT--LGGFDFFHMSFS----- 1585
                                             + +N+ GT   G  D F  SF+     
Sbjct: 1435 GGYVPSLTSSSVLDSSKG---------------NSQNIDGTYKYGALDDFINSFTDSASA 1479

Query: 1586 --VAKKLIIFLPVFLVSIALWXXXX----------XXXXXXXXXSKNKNKQDPLPDKKWS 1633
               A K+IIFL V  + + LW                        K+ N +  L   + S
Sbjct: 1480 GKYAVKIIIFLIVLTIGVLLWLFVAFFAFRHRNILLKRHPRNCIGKSLNNERELESTELS 1539

Query: 1634 VDEKALQSYFDPHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQV 1693
                  Q Y +  P+ E                    ++  +  G    ++    L Y +
Sbjct: 1540 RSSSGNQVYNEKPPESEN------------ESVYSAVDDHYIVTGENTVYNTIHRLHYTI 1587

Query: 1694 GPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVT--TLFKEGEVNNEALHLSQ-- 1749
              DG+  Y     D  P +   F  TN GD    ++++    ++ + +   EA    +  
Sbjct: 1588 NDDGDLLY----RDAIPLD---FDQTN-GDDGSGIDSIVRDCVYDKNQDATEAFLNDEES 1639

Query: 1750 VGQDLDEIIVDEDGNVEL--PLADLEQLSFEENNTDTIESYNNQQYY--KMNQLLSAI-- 1803
            +   LD   VDE+G++ L    +D E+ +      + IE+YN       K++ L +    
Sbjct: 1640 ISGILD---VDENGDIRLYDSYSDNEESNSFHLPDEVIENYNKNHLCETKLHGLGTESCT 1696

Query: 1804 -----TGADIQDALTSSGHET----TGEGIPSNYNEVKDAPLSSESSNLVAQLSGGDENL 1854
                 TG  I +   S+G +T    T    P + N +K   L    S+L         NL
Sbjct: 1697 TDDPDTGNQITNEF-STGSQTCLPSTAYTTPLHTNSIKLHTLRYTESSLPKPNQTLFSNL 1755

Query: 1855 EDYFYSEIEPLEDPEEAHIAQSDSEDSNDVEDFNVXXXXXXXXXXXXXXXXXXXXXXXXX 1914
            ED    EIE             D +D+  V D                            
Sbjct: 1756 EDL---EIE-------------DIDDNGSVSD---------------------------- 1771

Query: 1915 XXXXIHIGEFDELDEEMYRRLSSV 1938
                +HI E D LDEE+Y+R+S V
Sbjct: 1772 ----VHIEELDALDEELYKRMSKV 1791

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 95.1 bits (235), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 64/97 (65%), Gaps = 4/97 (4%)

Query: 1302 SDWLPTLLVTASA----TESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQK 1357
            S+WLPT LVTAS+    T+S +T S+    AT TLPQ I   T VS P  Y+ ITIGF++
Sbjct: 1177 SNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQ 1236

Query: 1358 ALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            ALNYPF++ N + SAQIF +LP+ L +PF   F   T
Sbjct: 1237 ALNYPFVVTNAVTSAQIFAYLPETLNFPFDDAFSDIT 1273

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score = 90.5 bits (223), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 1288 LSKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPAN 1347
            LS  S ++  S  S  WLPT ++  S+ E+  + + F+   T +LP  I P+   S P N
Sbjct: 952  LSIYSTNLDSSSNSYAWLPTAIIVQSS-ETDTSTTLFNPTITGSLPNLIEPAVTASEPIN 1010

Query: 1348 YSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPF 1386
            ++ IT+GF  ALNY FL++NPL+SAQIF FLP VL+YPF
Sbjct: 1011 HTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF 1049

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 137/355 (38%), Gaps = 72/355 (20%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVXXXXXX 1533
            YI +VA VYFPT AV+ LQ++IL+  S LY+NP S   +LA LID  IP+  L       
Sbjct: 1133 YIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGN 1192

Query: 1534 XXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTL-----GGFDFFHMSF---- 1584
                                           S+ + + G +     G  D F  SF    
Sbjct: 1193 EGHVSSLFPSGVLD-----------------SSKENSKGIVATYKYGALDDFTNSFTDSA 1235

Query: 1585 ---SVAKKLIIFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDPLP-----DKKWSVDE 1636
               S A + I+FL +  +   LW                +  +D +      ++K+  D 
Sbjct: 1236 PGWSYAARTIVFLAILTIGALLWLLFAFFVFHYRNILLKRYPKDCIEKSLGNERKF--DS 1293

Query: 1637 KAL------QSYFDPHPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLT 1690
             AL         F+  P                       ++  +  G    +S + GL 
Sbjct: 1294 TALSRSSSGNQIFNEKP-----------SGSENESVHSVTDDHYIITGENTVYSTTHGLH 1342

Query: 1691 YQVGPDGNFYYAGRT-DDVYPKNQGAFQATNTGDQDKNLNAVT--TLFKEGEVNNEALHL 1747
            Y +  DG+ +Y   T +D+    +          +D  ++++    ++ E + + EA +L
Sbjct: 1343 YTINDDGDLFYKEATLNDLEETAE---------REDSGIDSILRDCVYDEHQESTEA-YL 1392

Query: 1748 SQVGQDLDEII-VDEDGNVELPLA---DLEQLSFEENNTDTIESYNNQQYYKMNQ 1798
            +   + +  I+ VDE+GN+ L  +   D E  SF   N + IE YNN   YK+  
Sbjct: 1393 ND-EESISSIVDVDENGNIRLYDSYSDDEEPNSFYLPN-EVIEEYNNNNVYKIKH 1445

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 9/95 (9%)

Query: 1301 SSDWLPTLLVTASATESV------NTQSSFDTAATA---TLPQFIVPSTPVSIPANYSQI 1351
            S +WLPT+++TA+  E V      NTQS     AT    TLPQ I     V+   +Y+ I
Sbjct: 754  SGNWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLI 813

Query: 1352 TIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPF 1386
            TIGF+K LNYPF+  NP A+AQIF +LP +L YPF
Sbjct: 814  TIGFKKQLNYPFIAMNPFANAQIFDYLPGILNYPF 848

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            WLPT ++    +++ ++ + F+ + T +LP  I P+  VS PAN++ IT+GF   LNY F
Sbjct: 918  WLPTTII-VEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEF 976

Query: 1364 LIKNPLASAQIFGFLPDVLRYPF 1386
            L++NPL+SAQIF FLP VL YPF
Sbjct: 977  LVQNPLSSAQIFNFLPLVLGYPF 999

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 41/53 (77%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526
            Y+ +VA VYFPT A++ LQK+IL+++S +Y+NP +   +LA LID +IP+ GL
Sbjct: 1083 YVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 1298 SRTSSD---WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIG 1354
            +R SSD   W+PT+L+T S   S +        AT TLPQ I   T +  P  YS ITIG
Sbjct: 597  TRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITIG 656

Query: 1355 FQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            F+K LNY F++ NP +SAQIF FLPDVL  PF + F+  T
Sbjct: 657  FKKPLNYEFIVANPKSSAQIFSFLPDVLNAPFNNTFNNIT 696

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score = 88.2 bits (217), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 60/91 (65%), Gaps = 1/91 (1%)

Query: 1297 GSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQ 1356
            G++ ++DWLP  ++ AS  +S +T SS +   TATLP  I   T    P N + +TIGF+
Sbjct: 585  GTQNTNDWLPNSMIFASD-QSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFK 643

Query: 1357 KALNYPFLIKNPLASAQIFGFLPDVLRYPFV 1387
            K LNY FLI NPLASAQIF FLP  L YPF+
Sbjct: 644  KELNYIFLIDNPLASAQIFEFLPLTLSYPFL 674

 Score = 57.4 bits (137), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 34/54 (62%)

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526
            DYI SVA VYFPT  + +LQK I    S LYSNP +   +L  LIDP I +T L
Sbjct: 774  DYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDL 827

 Score = 33.9 bits (76), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 1680 GLFFSRSTGLTYQVGPDGNFYYAG 1703
            G+ + +S G+ Y V  DGNFYY G
Sbjct: 981  GVVYDQSNGMQYTVDYDGNFYYFG 1004

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 65/103 (63%), Gaps = 4/103 (3%)

Query: 1304 WLPTLLVTA-SATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362
            WLPT +V     + + +T ++    AT TLPQ I  +T +  PA Y+ IT+GF+K LNYP
Sbjct: 535  WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 1363 FLIKNPLASAQIFGFLPDVLRYPF--VSRFDRTTNVSESQPWR 1403
            F + NP+++AQIF FLP VL YPF    +FD  T+V E  P +
Sbjct: 595  FTVNNPVSNAQIFEFLPKVLNYPFNGAQKFDN-TSVLELVPLK 636

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 86.7 bits (213), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 71/107 (66%), Gaps = 5/107 (4%)

Query: 1288 LSKPSQSVAGSRTSSD---WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSI 1344
            +S P+ ++A S ++++   W+PT ++T  A  +  T SS  + ATATLPQ I  +T    
Sbjct: 1140 VSGPTTTLAPSSSTTNDNWWVPTKIITQPAPNT--TASSTSSQATATLPQAIAAATQQVR 1197

Query: 1345 PANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFD 1391
            P  YS +TIGF+ ALNY FLI +PL+SAQIF FLP +L  PF ++F+
Sbjct: 1198 PKGYSLLTIGFKSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFN 1244

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            DY+A+VA VYFPT  ++ L  +I N+AS LY++   + + LA LIDP IP+TGLV
Sbjct: 1260 DYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAELIDPTIPLTGLV 1314

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score = 86.3 bits (212), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 3/91 (3%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            W+PT +VT +   S  T S     ATATLPQ I  +T V+ P  Y+ IT+GF++ALNY F
Sbjct: 796  WVPTQIVTQT---SQTTSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYNF 852

Query: 1364 LIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            ++ NP++SAQIF FLP++LR PF + ++  T
Sbjct: 853  VVSNPISSAQIFAFLPEMLRTPFENSYENIT 883

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (63%), Gaps = 2/91 (2%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            W+PT L+TAS    V   +   +AAT TLPQ I  +T V  P  Y+ ITIGF++ALNY F
Sbjct: 452  WIPTQLITAST--QVTGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEF 509

Query: 1364 LIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            ++ +P +SAQIF FLP VL  PF   +D  T
Sbjct: 510  IVSSPKSSAQIFSFLPYVLNTPFDDIYDNIT 540

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 34/54 (62%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            Y  +VA V FP SA+  L   I ++ S LY+  D    SLALLIDP IP+TGLV
Sbjct: 554  YFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLIDPSIPLTGLV 607

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 58/98 (59%), Gaps = 3/98 (3%)

Query: 1300 TSSD---WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQ 1356
            TSSD   W+PT L+T +   +    S+     T TLP  I  +T V  P  Y+ ITIGF+
Sbjct: 954  TSSDNNWWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFK 1013

Query: 1357 KALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            KALNY F++  P +SAQIFG+LP+ L  PF + F   T
Sbjct: 1014 KALNYEFVVSEPKSSAQIFGYLPEALNTPFKNVFTNIT 1051

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 1297 GSRTSSDW-LPTLLVTASATESVNTQSSFDTAATATL-PQFIVPSTPVSIPANYSQITIG 1354
             S TSS+W +PT ++T S  ++ N+ SS  T +T  + P+ I   T + +P+ Y+ ITIG
Sbjct: 480  ASNTSSNWWVPTRIITESD-KTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIG 538

Query: 1355 FQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPW 1402
            F++ALNY F++ NP++SAQIF FLP+ L  PF    D + ++ +  P+
Sbjct: 539  FKEALNYDFVLDNPVSSAQIFAFLPEALDLPFQFANDSSVSILKLVPY 586

 Score = 42.4 bits (98), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%)

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            +Y   VA VYFP+ +++ L  +I +S S LY+    ++ +L  LID  IP+TGLV
Sbjct: 592  NYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNTGSRLALVNLIDQNIPLTGLV 646

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 77.4 bits (189), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 1298 SRTSSD---WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIG 1354
            S TSSD   W+PT L+T +   +    S+     T TLP  I  +T +     YS IT+G
Sbjct: 833  SVTSSDNNWWIPTELITQAPEAASTASSTASGTQTMTLPHAIAAATQIPASEGYSLITVG 892

Query: 1355 FQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQ 1400
            F++ALNY F++  P +SAQIFG+LP+ L  PF + F   TN+S  Q
Sbjct: 893  FKRALNYEFVVSEPKSSAQIFGYLPEALNTPFKNVF---TNISVLQ 935

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            Y+ SVA VYFPT+ +  L  +I N++S  Y++   T +S+A ++DP IP+TGL+
Sbjct: 946  YLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVDPSIPLTGLL 999

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 76.3 bits (186), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            W+PT L+T     + +  ++     T TLP  I  +T ++ P  YS ITIGF+KALNY F
Sbjct: 790  WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 1364 LIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQ 1400
            ++  P +SAQIF +LP+ L  PF   F   TN+S  Q
Sbjct: 850  VVSEPKSSAQIFAYLPEALNTPFKDVF---TNISVLQ 883

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 37/54 (68%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            Y+ SVA VYFPT+ +  L  +I N++S  Y++   T +S+A ++D  IP+TGL+
Sbjct: 894  YLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVDASIPLTGLL 947

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 75.5 bits (184), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 52/91 (57%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            W+PT L+T +   +    S+     T TLPQ +  +T +     YS IT+GF+K LNY F
Sbjct: 823  WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYEF 882

Query: 1364 LIKNPLASAQIFGFLPDVLRYPFVSRFDRTT 1394
            ++  P +SAQIFG+LP  L  PF + F   T
Sbjct: 883  VVSEPKSSAQIFGYLPAALNTPFKNVFTNIT 913

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score = 75.5 bits (184), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 1301 SSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALN 1360
            S DWLP+ +   S + + + + SF    T+ LP  I   T ++IP+N + IT+ F++ LN
Sbjct: 513  SFDWLPSEIAIQSDSTAESMEPSF-LIDTSGLPNIITAPTAITIPSNTTLITVAFKRELN 571

Query: 1361 YPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTN 1395
            Y FL+ N  +SAQIF FLP ++++PF +    + N
Sbjct: 572  YAFLVNNFYSSAQIFNFLPIIIKHPFTALVSESCN 606

 Score = 60.1 bits (144), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 140/347 (40%), Gaps = 49/347 (14%)

Query: 1472 NDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVXXXX 1531
            N YI S+A VY P   V  LQ++ILN AS  Y++  S+ ++LA LIDP IP+TG++    
Sbjct: 713  NKYIISIAEVYVPNEIVETLQELILNPASSFYNSESSSLKTLAFLIDPNIPLTGML---D 769

Query: 1532 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNASTDDRNLGTLGGFDFFHMSFSVAKKLI 1591
                                          ++ S+    LGTL    +  +S ++ K+L 
Sbjct: 770  SNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQTLKLGTLDSSAYKGLSTNLKKRLS 829

Query: 1592 IFLPVFLVSIALWXXXXXXXXXXXXXSKNKNKQDP------LP------DKKWSVDEKAL 1639
            IF+  F V   L+              K   K DP      LP      D   +++ ++ 
Sbjct: 830  IFIVCFTVGAVLY-IQLSLFGLNFMYKKLSMKADPESDKSSLPQYHITRDSTSNIEGRSS 888

Query: 1640 QSYFDP-HPDVEKYPGXXXXXXXXXXXXXXXXEEDLLAVGNGLFFSRSTGLTYQVGPDGN 1698
            +S+  P +P  +KY                      + +     ++RS  +TY V   GN
Sbjct: 889  KSFSTPSNPFSDKY------------QKSSSDSSKSITLPGKAVYNRSQDMTYLVDEQGN 936

Query: 1699 FYYA------GRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGEVNNEALHLSQVGQ 1752
            FYY       GRT  +    +G+  +     +D + N      K    +N +   + +  
Sbjct: 937  FYYTNLDNVQGRTVHIMRTPEGSIYS-----KDVSYN------KYVYDSNNSTSNTYLDD 985

Query: 1753 DLDEIIVDEDGNVELPLADLEQLSFEENNTDTIES---YNNQQYYKM 1796
               E  V++  ++E+   D      +E++T+ IE+   +NN   YKM
Sbjct: 986  QYHENTVNKGDDLEITYPDFLLNEVKESHTNIIENVKRFNNNGLYKM 1032

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 72.8 bits (177), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (62%), Gaps = 2/89 (2%)

Query: 1304 WLPTLLVT--ASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNY 1361
            W+PT L+T  A+   + NT S+   +AT  +PQ I+    V++   Y+ ITIGF+K L+Y
Sbjct: 646  WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 1362 PFLIKNPLASAQIFGFLPDVLRYPFVSRF 1390
             F++  P +SAQI  FLP++L  P+ + F
Sbjct: 706  EFVVTQPKSSAQIISFLPNLLNQPYGNIF 734

 Score = 54.3 bits (129), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 39/54 (72%)

Query: 1474 YIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            Y  +VA VYFPT+ +  L +++ +++S+LY+    + ++LA +IDP IPITGLV
Sbjct: 752  YYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADMIDPSIPITGLV 805

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (62%), Gaps = 4/97 (4%)

Query: 1304 WLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYPF 1363
            W+ + L+TAS  E+  T  +  T AT +LPQ I   T V+ P +YS ITIGF+KALNY F
Sbjct: 591  WVASDLMTASE-EASTTTRASATTATGSLPQAIAAPTEVTAPDDYSLITIGFKKALNYEF 649

Query: 1364 LIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQ 1400
            ++  P +SAQ+F +LP  L  PF + F   TN+S  Q
Sbjct: 650  VVNTPESSAQLFSYLPIALNTPFNNSF---TNISVYQ 683

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLV 1527
            +Y  +VA VYFP   +  LQ+MI +++S L++      ++L  LIDP IP+ GL+
Sbjct: 693  NYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSIPLVGLL 747

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 70.1 bits (170), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 62/111 (55%), Gaps = 13/111 (11%)

Query: 1289 SKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFI--VPSTPVSIPA 1346
            S PS ++  +R S+ W+PT L  AS   S +T     T  T  +PQ I  V   P   P 
Sbjct: 1485 SAPSSTI--TRQSNWWIPTSLAVASTMNSTDT----STLPTQAIPQAIGSVEQPPA--PE 1536

Query: 1347 NYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVS 1397
            N+S ITIGF+K LNY F++ +P++ AQI  +LP+ L   F   F   TN+S
Sbjct: 1537 NHSLITIGFKKELNYEFVVSHPMSGAQIINYLPNTLVNAF---FGNVTNIS 1584

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1430 LTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVAIVYFPTSAVN 1489
            + +H     Q + Y  +    AF  N                +DY+ ++A VYFPT  + 
Sbjct: 1554 VVSHPMSGAQIINYLPNTLVNAFFGNVTNISVNNLVPYNDTKSDYLITIATVYFPTDEIK 1613

Query: 1490 VLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526
             L+++I + +S  Y+        LA L+DP IP+TGL
Sbjct: 1614 HLRELIHDKSSSFYTASQDVARQLANLVDPSIPLTGL 1650

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 97/228 (42%), Gaps = 72/228 (31%)

Query: 1304 WLPTLLVTA---SATESVNTQSSFDTAATATLPQFIVPST-PVSIPANYSQITIGFQKAL 1359
            W+PT L+ A   + +ES  T+S+ D    ++LP+ I  S    S+P  YS ITIGF+K L
Sbjct: 591  WIPTSLIIAPTETESESTPTESN-DGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPL 649

Query: 1360 NYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNL 1419
            NY                       PFV    +    S +Q   Y               
Sbjct: 650  NY-----------------------PFVVSESK----SSAQIMYYLP------------- 669

Query: 1420 SEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFXXXXXXXXXXXXXXGNDYIASVA 1479
                 KL N     IF D + +Q                             + Y+++VA
Sbjct: 670  -----KLLNANFESIFSDIKTVQLM---------------------PLEIQDSGYLSTVA 703

Query: 1480 IVYFPTSAVNVLQKMILNSASMLYSNP-DSTQESLALLIDPKIPITGL 1526
            +++FPTS +  L  M+ N++S LYS   ++  +SL+ LIDP+IP+TGL
Sbjct: 704  LLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLSALIDPRIPVTGL 751

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 4/102 (3%)

Query: 1304 WLPTLLVTAS-ATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362
            W+PT L+T S  T+S  T  +   +AT ++P  I  ST  + P   S +TIGF++ALNY 
Sbjct: 643  WVPTSLITESDVTDSAVTTRTL--SATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQ 700

Query: 1363 FLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRY 1404
            F++ + +  AQIF FLP  L  PF  +    T V    P  Y
Sbjct: 701  FVLSSSVTVAQIFAFLPGGLIAPFEEQLANVT-VYRLSPLNY 741

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 57.0 bits (136), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 5/89 (5%)

Query: 1302 SDWLP-TLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPA--NYSQITIGFQKA 1358
            S+WLP TL+V  + + S N Q  F+ + T   P+ I P      PA  +   I +   + 
Sbjct: 1554 SNWLPSTLVVENNPSGSANMQ--FNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRP 1611

Query: 1359 LNYPFLIKNPLASAQIFGFLPDVLRYPFV 1387
            LNYPFLI+N ++SAQ+  ++P +L Y  +
Sbjct: 1612 LNYPFLIENLVSSAQVMNYIPFILSYSLI 1640

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 98/278 (35%), Gaps = 54/278 (19%)

Query: 1681 LFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGEV 1740
            + +  + GL Y V  +GN+YY              F   NT  QD          KEG  
Sbjct: 2002 IVYDNNNGLAYTVDKEGNYYYHHNL-----TTGKDFITFNTSLQDYR--------KEGH- 2047

Query: 1741 NNEALHLSQVGQDLDEIIVDEDGNVE---------LPLADLEQLSFEENNTDTIESYNNQ 1791
                          D+I +D+DGN+E         +P +          N D I  YNNQ
Sbjct: 2048 --------------DDIFIDQDGNIEIEDSHGIYDIPTSSSISHGSSIKNLDNIRKYNNQ 2093

Query: 1792 ------QY--YKMNQLLSA-ITGADIQDALTSSGHETTG---EGIPSNYNEVKDAPLSSE 1839
                  +Y  Y    +L   +T  D  D    S +E T         N +   ++  S  
Sbjct: 2094 YQTEPHKYHSYSHRSILDLQLTSPDANDHNNLSLNEKTDYTTSNTGCNSDSYSNSHESDY 2153

Query: 1840 SSNLVAQLSGGDENLEDYFYSEI-EPLEDPEEAHIAQSDSEDSNDVE--DFNVXXXXXXX 1896
            SS     LS     LE+Y Y ++  P ED  ++   ++D+  ++D    D+ V       
Sbjct: 2154 SSGSYRDLSFSIGELEEYLYEDVMNPFED--DSLDIETDTYTTDDSMSFDYQVSSFSKDN 2211

Query: 1897 XXXXXXXXXXXXXXXXXXXXXXIHIGEFDELDEEMYRR 1934
                                  I I E D LD+E++R+
Sbjct: 2212 YSINHPNSNNNNSNTNIMSVDDIDIDELDSLDQEIFRK 2249

 Score = 40.8 bits (94), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%)

Query: 1473 DYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITG 1525
            DY  +   VY P + V+ LQ  I +  S+LY NP      L+  ID  IPI G
Sbjct: 1791 DYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFIDSSIPIVG 1843

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.303    0.118    0.314 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 164,766,298
Number of extensions: 6359472
Number of successful extensions: 94275
Number of sequences better than 10.0: 1323
Number of HSP's gapped: 74596
Number of HSP's successfully gapped: 8083
Length of query: 2159
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 2034
Effective length of database: 39,148,149
Effective search space: 79627335066
Effective search space used: 79627335066
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 74 (33.1 bits)